mtr-0.85/0000755000175000017500000000000012162522624011266 5ustar wolffwolffmtr-0.85/version.h.in0000664000175000017500000000137112106217130013524 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #define MTR_VERSION "@VERSION@" mtr-0.85/.deps/0000775000175000017500000000000012162522442012277 5ustar wolffwolffmtr-0.85/.deps/curses.Po0000664000175000017500000001575512162522442014120 0ustar wolffwolffcurses.o: curses.c config.h /usr/include/strings.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/xlocale.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/ctype.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/string.h \ /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/arpa/inet.h \ /usr/include/ncurses.h /usr/include/ncurses_dll.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdbool.h \ /usr/include/unctrl.h /usr/include/curses.h mtr.h mtr-curses.h display.h \ net.h /usr/include/netdb.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/netinet/ip6.h \ /usr/include/inttypes.h /usr/include/netinet/icmp6.h dns.h \ /usr/include/resolv.h /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h asn.h version.h config.h: /usr/include/strings.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/xlocale.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/ctype.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/string.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/arpa/inet.h: /usr/include/ncurses.h: /usr/include/ncurses_dll.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdbool.h: /usr/include/unctrl.h: /usr/include/curses.h: mtr.h: mtr-curses.h: display.h: net.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: asn.h: version.h: mtr-0.85/.deps/getopt1.Po0000664000175000017500000000354412162522233014166 0ustar wolffwolffgetopt1.o: getopt1.c config.h getopt.h /usr/include/ctype.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h /usr/include/xlocale.h \ /usr/include/stdio.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h config.h: getopt.h: /usr/include/ctype.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/xlocale.h: /usr/include/stdio.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: mtr-0.85/.deps/report.Po0000664000175000017500000001351112162522442014113 0ustar wolffwolffreport.o: report.c config.h /usr/include/x86_64-linux-gnu/sys/types.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/time.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/netdb.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/string.h \ /usr/include/xlocale.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/string3.h /usr/include/strings.h \ mtr.h version.h report.h net.h /usr/include/arpa/inet.h \ /usr/include/netinet/ip6.h /usr/include/inttypes.h \ /usr/include/netinet/icmp6.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h asn.h config.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/time.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/netdb.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/strings.h: mtr.h: version.h: report.h: net.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: asn.h: mtr-0.85/.deps/dns.Po0000664000175000017500000001702712162522232013367 0ustar wolffwolffdns.o: dns.c config.h /usr/include/x86_64-linux-gnu/sys/types.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/time.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h \ /usr/include/x86_64-linux-gnu/sys/time.h \ /usr/include/x86_64-linux-gnu/sys/stat.h \ /usr/include/x86_64-linux-gnu/bits/stat.h \ /usr/include/x86_64-linux-gnu/sys/errno.h /usr/include/errno.h \ /usr/include/x86_64-linux-gnu/bits/errno.h /usr/include/linux/errno.h \ /usr/include/x86_64-linux-gnu/asm/errno.h \ /usr/include/asm-generic/errno.h /usr/include/asm-generic/errno-base.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/arpa/inet.h \ /usr/include/arpa/nameser.h /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h /usr/include/netdb.h \ /usr/include/rpc/netdb.h /usr/include/x86_64-linux-gnu/bits/netdb.h \ /usr/include/resolv.h /usr/include/stdio.h /usr/include/libio.h \ /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/fcntl2.h /usr/include/ctype.h \ /usr/include/xlocale.h /usr/include/string.h \ /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/string3.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h mtr.h dns.h net.h \ /usr/include/netinet/ip6.h /usr/include/inttypes.h \ /usr/include/netinet/icmp6.h config.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/time.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/x86_64-linux-gnu/sys/time.h: /usr/include/x86_64-linux-gnu/sys/stat.h: /usr/include/x86_64-linux-gnu/bits/stat.h: /usr/include/x86_64-linux-gnu/sys/errno.h: /usr/include/errno.h: /usr/include/x86_64-linux-gnu/bits/errno.h: /usr/include/linux/errno.h: /usr/include/x86_64-linux-gnu/asm/errno.h: /usr/include/asm-generic/errno.h: /usr/include/asm-generic/errno-base.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/arpa/inet.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/resolv.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/fcntl.h: /usr/include/x86_64-linux-gnu/bits/fcntl.h: /usr/include/x86_64-linux-gnu/bits/fcntl2.h: /usr/include/ctype.h: /usr/include/xlocale.h: /usr/include/string.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: mtr.h: dns.h: net.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: mtr-0.85/.deps/split.Po0000664000175000017500000001470412162522232013735 0ustar wolffwolffsplit.o: split.c config.h /usr/include/ctype.h /usr/include/features.h \ /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h /usr/include/xlocale.h \ /usr/include/stdlib.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/string.h \ /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h mtr.h display.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h net.h /usr/include/netdb.h \ /usr/include/rpc/netdb.h /usr/include/x86_64-linux-gnu/bits/netdb.h \ /usr/include/arpa/inet.h /usr/include/netinet/ip6.h \ /usr/include/inttypes.h /usr/include/netinet/icmp6.h split.h \ /usr/include/ncurses.h /usr/include/ncurses_dll.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdbool.h \ /usr/include/unctrl.h /usr/include/curses.h config.h: /usr/include/ctype.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/xlocale.h: /usr/include/stdlib.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/string.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: mtr.h: display.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: net.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: split.h: /usr/include/ncurses.h: /usr/include/ncurses_dll.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdbool.h: /usr/include/unctrl.h: /usr/include/curses.h: mtr-0.85/.deps/net.Po0000664000175000017500000002164612162522231013372 0ustar wolffwolffnet.o: net.c config.h /usr/include/x86_64-linux-gnu/sys/types.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/time.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h \ /usr/include/x86_64-linux-gnu/sys/time.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/sys/ioctl.h \ /usr/include/x86_64-linux-gnu/bits/ioctls.h \ /usr/include/x86_64-linux-gnu/asm/ioctls.h \ /usr/include/asm-generic/ioctls.h /usr/include/linux/ioctl.h \ /usr/include/x86_64-linux-gnu/asm/ioctl.h \ /usr/include/asm-generic/ioctl.h \ /usr/include/x86_64-linux-gnu/bits/ioctl-types.h \ /usr/include/x86_64-linux-gnu/sys/ttydefaults.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/memory.h \ /usr/include/string.h /usr/include/xlocale.h \ /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/string3.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/stat.h \ /usr/include/x86_64-linux-gnu/bits/fcntl2.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/math.h \ /usr/include/x86_64-linux-gnu/bits/huge_val.h \ /usr/include/x86_64-linux-gnu/bits/huge_valf.h \ /usr/include/x86_64-linux-gnu/bits/huge_vall.h \ /usr/include/x86_64-linux-gnu/bits/inf.h \ /usr/include/x86_64-linux-gnu/bits/nan.h \ /usr/include/x86_64-linux-gnu/bits/mathdef.h \ /usr/include/x86_64-linux-gnu/bits/mathcalls.h \ /usr/include/x86_64-linux-gnu/bits/mathinline.h /usr/include/errno.h \ /usr/include/x86_64-linux-gnu/bits/errno.h /usr/include/linux/errno.h \ /usr/include/x86_64-linux-gnu/asm/errno.h \ /usr/include/asm-generic/errno.h /usr/include/asm-generic/errno-base.h \ mtr.h net.h /usr/include/netdb.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/arpa/inet.h \ /usr/include/netinet/ip6.h /usr/include/inttypes.h \ /usr/include/netinet/icmp6.h display.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h config.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/time.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/x86_64-linux-gnu/sys/time.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/sys/ioctl.h: /usr/include/x86_64-linux-gnu/bits/ioctls.h: /usr/include/x86_64-linux-gnu/asm/ioctls.h: /usr/include/asm-generic/ioctls.h: /usr/include/linux/ioctl.h: /usr/include/x86_64-linux-gnu/asm/ioctl.h: /usr/include/asm-generic/ioctl.h: /usr/include/x86_64-linux-gnu/bits/ioctl-types.h: /usr/include/x86_64-linux-gnu/sys/ttydefaults.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/memory.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/fcntl.h: /usr/include/x86_64-linux-gnu/bits/fcntl.h: /usr/include/x86_64-linux-gnu/bits/stat.h: /usr/include/x86_64-linux-gnu/bits/fcntl2.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/math.h: /usr/include/x86_64-linux-gnu/bits/huge_val.h: /usr/include/x86_64-linux-gnu/bits/huge_valf.h: /usr/include/x86_64-linux-gnu/bits/huge_vall.h: /usr/include/x86_64-linux-gnu/bits/inf.h: /usr/include/x86_64-linux-gnu/bits/nan.h: /usr/include/x86_64-linux-gnu/bits/mathdef.h: /usr/include/x86_64-linux-gnu/bits/mathcalls.h: /usr/include/x86_64-linux-gnu/bits/mathinline.h: /usr/include/errno.h: /usr/include/x86_64-linux-gnu/bits/errno.h: /usr/include/linux/errno.h: /usr/include/x86_64-linux-gnu/asm/errno.h: /usr/include/asm-generic/errno.h: /usr/include/asm-generic/errno-base.h: mtr.h: net.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: display.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: mtr-0.85/.deps/mtr.Po0000664000175000017500000001710612162522441013405 0ustar wolffwolffmtr.o: mtr.c /usr/include/x86_64-linux-gnu/sys/types.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/time.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h config.h \ /usr/include/netdb.h /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/string.h \ /usr/include/xlocale.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/strings.h \ /usr/include/errno.h /usr/include/x86_64-linux-gnu/bits/errno.h \ /usr/include/linux/errno.h /usr/include/x86_64-linux-gnu/asm/errno.h \ /usr/include/asm-generic/errno.h /usr/include/asm-generic/errno-base.h \ /usr/include/ctype.h /usr/include/assert.h /usr/include/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/fcntl.h \ /usr/include/x86_64-linux-gnu/bits/stat.h \ /usr/include/x86_64-linux-gnu/bits/fcntl2.h \ /usr/include/x86_64-linux-gnu/sys/stat.h mtr.h mtr-curses.h getopt.h \ display.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h report.h net.h \ /usr/include/arpa/inet.h /usr/include/netinet/ip6.h \ /usr/include/inttypes.h /usr/include/netinet/icmp6.h asn.h version.h /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/time.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: config.h: /usr/include/netdb.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/strings.h: /usr/include/errno.h: /usr/include/x86_64-linux-gnu/bits/errno.h: /usr/include/linux/errno.h: /usr/include/x86_64-linux-gnu/asm/errno.h: /usr/include/asm-generic/errno.h: /usr/include/asm-generic/errno-base.h: /usr/include/ctype.h: /usr/include/assert.h: /usr/include/fcntl.h: /usr/include/x86_64-linux-gnu/bits/fcntl.h: /usr/include/x86_64-linux-gnu/bits/stat.h: /usr/include/x86_64-linux-gnu/bits/fcntl2.h: /usr/include/x86_64-linux-gnu/sys/stat.h: mtr.h: mtr-curses.h: getopt.h: display.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: report.h: net.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: asn.h: version.h: mtr-0.85/.deps/display.Po0000664000175000017500000001266512162522232014253 0ustar wolffwolffdisplay.o: display.c config.h /usr/include/stdio.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/libio.h \ /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h mtr.h display.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h mtr-curses.h mtr-gtk.h report.h \ select.h raw.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h asn.h split.h config.h: /usr/include/stdio.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: mtr.h: display.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: mtr-curses.h: mtr-gtk.h: report.h: select.h: raw.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: asn.h: split.h: mtr-0.85/.deps/asn.Po0000664000175000017500000001450012162522233013356 0ustar wolffwolffasn.o: asn.c /usr/include/unistd.h /usr/include/features.h \ /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h /usr/include/netdb.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/resolv.h \ /usr/include/string.h /usr/include/xlocale.h \ /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h /usr/include/search.h \ config.h mtr.h asn.h /usr/include/unistd.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: /usr/include/netdb.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/resolv.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/search.h: config.h: mtr.h: asn.h: mtr-0.85/.deps/raw.Po0000664000175000017500000001415012162522232013366 0ustar wolffwolffraw.o: raw.c config.h /usr/include/ctype.h /usr/include/features.h \ /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h /usr/include/xlocale.h \ /usr/include/stdlib.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/arpa/inet.h mtr.h \ raw.h net.h /usr/include/netdb.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/netinet/ip6.h \ /usr/include/inttypes.h /usr/include/netinet/icmp6.h \ /usr/include/string.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h config.h: /usr/include/ctype.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/xlocale.h: /usr/include/stdlib.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/arpa/inet.h: mtr.h: raw.h: net.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: /usr/include/string.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: mtr-0.85/.deps/gtk.Po0000664000175000017500000014565112162522442013400 0ustar wolffwolffgtk.o: gtk.c config.h /usr/include/stdio.h /usr/include/features.h \ /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/libio.h \ /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/types.h /usr/include/time.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h \ /usr/include/x86_64-linux-gnu/sys/time.h /usr/include/string.h \ /usr/include/xlocale.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h \ /usr/include/gtk-2.0/gtk/gtk.h /usr/include/gtk-2.0/gdk/gdk.h \ /usr/include/gtk-2.0/gdk/gdkapplaunchcontext.h \ /usr/include/glib-2.0/gio/gio.h /usr/include/glib-2.0/gio/giotypes.h \ /usr/include/glib-2.0/gio/gioenums.h /usr/include/glib-2.0/glib-object.h \ /usr/include/glib-2.0/gobject/gbinding.h /usr/include/glib-2.0/glib.h \ /usr/include/glib-2.0/glib/galloca.h /usr/include/glib-2.0/glib/gtypes.h \ /usr/lib/x86_64-linux-gnu/glib-2.0/include/glibconfig.h \ /usr/include/glib-2.0/glib/gmacros.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/float.h \ /usr/include/glib-2.0/glib/garray.h \ /usr/include/glib-2.0/glib/gasyncqueue.h \ /usr/include/glib-2.0/glib/gthread.h /usr/include/glib-2.0/glib/gerror.h \ /usr/include/glib-2.0/glib/gquark.h /usr/include/glib-2.0/glib/gutils.h \ /usr/include/glib-2.0/glib/gatomic.h \ /usr/include/glib-2.0/glib/gbacktrace.h /usr/include/signal.h \ /usr/include/x86_64-linux-gnu/bits/signum.h \ /usr/include/x86_64-linux-gnu/bits/siginfo.h \ /usr/include/x86_64-linux-gnu/bits/sigaction.h \ /usr/include/x86_64-linux-gnu/bits/sigcontext.h \ /usr/include/x86_64-linux-gnu/bits/sigstack.h \ /usr/include/x86_64-linux-gnu/sys/ucontext.h \ /usr/include/x86_64-linux-gnu/bits/sigthread.h \ /usr/include/glib-2.0/glib/gbase64.h \ /usr/include/glib-2.0/glib/gbitlock.h \ /usr/include/glib-2.0/glib/gbookmarkfile.h \ /usr/include/glib-2.0/glib/gcache.h /usr/include/glib-2.0/glib/glist.h \ /usr/include/glib-2.0/glib/gmem.h /usr/include/glib-2.0/glib/gslice.h \ /usr/include/glib-2.0/glib/gchecksum.h \ /usr/include/glib-2.0/glib/gcompletion.h \ /usr/include/glib-2.0/glib/gconvert.h \ /usr/include/glib-2.0/glib/gdataset.h /usr/include/glib-2.0/glib/gdate.h \ /usr/include/glib-2.0/glib/gdatetime.h \ /usr/include/glib-2.0/glib/gtimezone.h /usr/include/glib-2.0/glib/gdir.h \ /usr/include/glib-2.0/glib/gfileutils.h \ /usr/include/glib-2.0/glib/ghash.h /usr/include/glib-2.0/glib/ghmac.h \ /usr/include/glib-2.0/glib/gchecksum.h \ /usr/include/glib-2.0/glib/ghook.h \ /usr/include/glib-2.0/glib/ghostutils.h \ /usr/include/glib-2.0/glib/giochannel.h \ /usr/include/glib-2.0/glib/gmain.h /usr/include/glib-2.0/glib/gpoll.h \ /usr/include/glib-2.0/glib/gslist.h /usr/include/glib-2.0/glib/gstring.h \ /usr/include/glib-2.0/glib/gunicode.h \ /usr/include/glib-2.0/glib/gkeyfile.h \ /usr/include/glib-2.0/glib/gmappedfile.h \ /usr/include/glib-2.0/glib/gmarkup.h \ /usr/include/glib-2.0/glib/gmessages.h \ /usr/include/glib-2.0/glib/gnode.h /usr/include/glib-2.0/glib/goption.h \ /usr/include/glib-2.0/glib/gpattern.h \ /usr/include/glib-2.0/glib/gprimes.h /usr/include/glib-2.0/glib/gqsort.h \ /usr/include/glib-2.0/glib/gqueue.h /usr/include/glib-2.0/glib/grand.h \ /usr/include/glib-2.0/glib/grel.h /usr/include/glib-2.0/glib/gregex.h \ /usr/include/glib-2.0/glib/gscanner.h \ /usr/include/glib-2.0/glib/gsequence.h \ /usr/include/glib-2.0/glib/gshell.h /usr/include/glib-2.0/glib/gspawn.h \ /usr/include/glib-2.0/glib/gstrfuncs.h \ /usr/include/glib-2.0/glib/gtestutils.h \ /usr/include/glib-2.0/glib/gthreadpool.h \ /usr/include/glib-2.0/glib/gtimer.h /usr/include/glib-2.0/glib/gtree.h \ /usr/include/glib-2.0/glib/gurifuncs.h \ /usr/include/glib-2.0/glib/gvarianttype.h \ /usr/include/glib-2.0/glib/gvariant.h \ /usr/include/glib-2.0/gobject/gobject.h \ /usr/include/glib-2.0/gobject/gtype.h \ /usr/include/glib-2.0/gobject/gvalue.h \ /usr/include/glib-2.0/gobject/gparam.h \ /usr/include/glib-2.0/gobject/gclosure.h \ /usr/include/glib-2.0/gobject/gsignal.h \ /usr/include/glib-2.0/gobject/gmarshal.h \ /usr/include/glib-2.0/gobject/gboxed.h \ /usr/include/glib-2.0/gobject/glib-types.h \ /usr/include/glib-2.0/gobject/genums.h \ /usr/include/glib-2.0/gobject/gparamspecs.h \ /usr/include/glib-2.0/gobject/gsourceclosure.h \ /usr/include/glib-2.0/gobject/gtypemodule.h \ /usr/include/glib-2.0/gobject/gtypeplugin.h \ /usr/include/glib-2.0/gobject/gvaluearray.h \ /usr/include/glib-2.0/gobject/gvaluetypes.h \ /usr/include/glib-2.0/gio/gappinfo.h /usr/include/glib-2.0/gio/gaction.h \ /usr/include/glib-2.0/gio/gsimpleaction.h \ /usr/include/glib-2.0/gio/gactiongroup.h \ /usr/include/glib-2.0/gio/gsimpleactiongroup.h \ /usr/include/glib-2.0/gio/gactiongroup.h \ /usr/include/glib-2.0/gio/gapplication.h \ /usr/include/glib-2.0/gio/gapplicationcommandline.h \ /usr/include/glib-2.0/gio/gasyncinitable.h \ /usr/include/glib-2.0/gio/ginitable.h \ /usr/include/glib-2.0/gio/gasyncresult.h \ /usr/include/glib-2.0/gio/gbufferedinputstream.h \ /usr/include/glib-2.0/gio/gfilterinputstream.h \ /usr/include/glib-2.0/gio/ginputstream.h \ /usr/include/glib-2.0/gio/gbufferedoutputstream.h \ /usr/include/glib-2.0/gio/gfilteroutputstream.h \ /usr/include/glib-2.0/gio/goutputstream.h \ /usr/include/glib-2.0/gio/gcancellable.h \ /usr/include/glib-2.0/gio/gcharsetconverter.h \ /usr/include/glib-2.0/gio/gconverter.h \ /usr/include/glib-2.0/gio/gcontenttype.h \ /usr/include/glib-2.0/gio/gconverterinputstream.h \ /usr/include/glib-2.0/gio/gconverteroutputstream.h \ /usr/include/glib-2.0/gio/gcredentials.h \ /usr/include/glib-2.0/gio/gdatainputstream.h \ /usr/include/glib-2.0/gio/gdataoutputstream.h \ /usr/include/glib-2.0/gio/gdbusaddress.h \ /usr/include/glib-2.0/gio/gdbusauthobserver.h \ /usr/include/glib-2.0/gio/gdbusconnection.h \ /usr/include/glib-2.0/gio/gdbuserror.h \ /usr/include/glib-2.0/gio/gdbusintrospection.h \ /usr/include/glib-2.0/gio/gdbusmessage.h \ /usr/include/glib-2.0/gio/gdbusmethodinvocation.h \ /usr/include/glib-2.0/gio/gdbusnameowning.h \ /usr/include/glib-2.0/gio/gdbusnamewatching.h \ /usr/include/glib-2.0/gio/gdbusproxy.h \ /usr/include/glib-2.0/gio/gdbusserver.h \ /usr/include/glib-2.0/gio/gdbusutils.h \ /usr/include/glib-2.0/gio/gdrive.h \ /usr/include/glib-2.0/gio/gemblemedicon.h \ /usr/include/glib-2.0/gio/gicon.h /usr/include/glib-2.0/gio/gemblem.h \ /usr/include/glib-2.0/gio/gfileattribute.h \ /usr/include/glib-2.0/gio/gfileenumerator.h \ /usr/include/glib-2.0/gio/gfile.h /usr/include/glib-2.0/gio/gfileicon.h \ /usr/include/glib-2.0/gio/gfileinfo.h \ /usr/include/glib-2.0/gio/gfileinputstream.h \ /usr/include/glib-2.0/gio/gfileiostream.h \ /usr/include/glib-2.0/gio/giostream.h \ /usr/include/glib-2.0/gio/gioerror.h \ /usr/include/glib-2.0/gio/gfilemonitor.h \ /usr/include/glib-2.0/gio/gfilenamecompleter.h \ /usr/include/glib-2.0/gio/gfileoutputstream.h \ /usr/include/glib-2.0/gio/ginetaddress.h \ /usr/include/glib-2.0/gio/ginetsocketaddress.h \ /usr/include/glib-2.0/gio/gsocketaddress.h \ /usr/include/glib-2.0/gio/gioenumtypes.h \ /usr/include/glib-2.0/gio/giomodule.h /usr/include/glib-2.0/gmodule.h \ /usr/include/glib-2.0/gio/gioscheduler.h \ /usr/include/glib-2.0/gio/gloadableicon.h \ /usr/include/glib-2.0/gio/gmemoryinputstream.h \ /usr/include/glib-2.0/gio/gmemoryoutputstream.h \ /usr/include/glib-2.0/gio/gmount.h \ /usr/include/glib-2.0/gio/gmountoperation.h \ /usr/include/glib-2.0/gio/gnativevolumemonitor.h \ /usr/include/glib-2.0/gio/gvolumemonitor.h \ /usr/include/glib-2.0/gio/gnetworkaddress.h \ /usr/include/glib-2.0/gio/gnetworkservice.h \ /usr/include/glib-2.0/gio/gpermission.h \ /usr/include/glib-2.0/gio/gpollableinputstream.h \ /usr/include/glib-2.0/gio/gpollableoutputstream.h \ /usr/include/glib-2.0/gio/gproxy.h \ /usr/include/glib-2.0/gio/gproxyaddress.h \ /usr/include/glib-2.0/gio/gproxyaddressenumerator.h \ /usr/include/glib-2.0/gio/gsocketaddressenumerator.h \ /usr/include/glib-2.0/gio/gproxyresolver.h \ /usr/include/glib-2.0/gio/gresolver.h \ /usr/include/glib-2.0/gio/gseekable.h \ /usr/include/glib-2.0/gio/gsettings.h \ /usr/include/glib-2.0/gio/gsimpleasyncresult.h \ /usr/include/glib-2.0/gio/gsimplepermission.h \ /usr/include/glib-2.0/gio/gsocketclient.h \ /usr/include/glib-2.0/gio/gsocketconnectable.h \ /usr/include/glib-2.0/gio/gsocketconnection.h \ /usr/include/glib-2.0/gio/gsocket.h \ /usr/include/glib-2.0/gio/gsocketcontrolmessage.h \ /usr/include/glib-2.0/gio/gsocketlistener.h \ /usr/include/glib-2.0/gio/gsocketservice.h \ /usr/include/glib-2.0/gio/gsrvtarget.h \ /usr/include/glib-2.0/gio/gtcpconnection.h \ /usr/include/glib-2.0/gio/gtcpwrapperconnection.h \ /usr/include/glib-2.0/gio/gthemedicon.h \ /usr/include/glib-2.0/gio/gthreadedsocketservice.h \ /usr/include/glib-2.0/gio/gtlsbackend.h \ /usr/include/glib-2.0/gio/gtlscertificate.h \ /usr/include/glib-2.0/gio/gtlsclientconnection.h \ /usr/include/glib-2.0/gio/gtlsconnection.h \ /usr/include/glib-2.0/gio/gtlsdatabase.h \ /usr/include/glib-2.0/gio/gtlsfiledatabase.h \ /usr/include/glib-2.0/gio/gtlsinteraction.h \ /usr/include/glib-2.0/gio/gtlsserverconnection.h \ /usr/include/glib-2.0/gio/gtlspassword.h \ /usr/include/glib-2.0/gio/gvfs.h /usr/include/glib-2.0/gio/gvolume.h \ /usr/include/glib-2.0/gio/gzlibcompressor.h \ /usr/include/glib-2.0/gio/gzlibdecompressor.h \ /usr/include/glib-2.0/gio/gdbusinterface.h \ /usr/include/glib-2.0/gio/gdbusinterfaceskeleton.h \ /usr/include/glib-2.0/gio/gdbusobject.h \ /usr/include/glib-2.0/gio/gdbusobjectskeleton.h \ /usr/include/glib-2.0/gio/gdbusobjectproxy.h \ /usr/include/glib-2.0/gio/gdbusobjectmanager.h \ /usr/include/glib-2.0/gio/gdbusobjectmanagerclient.h \ /usr/include/glib-2.0/gio/gdbusobjectmanagerserver.h \ /usr/include/gtk-2.0/gdk/gdkscreen.h /usr/include/cairo/cairo.h \ /usr/include/cairo/cairo-version.h /usr/include/cairo/cairo-features.h \ /usr/include/cairo/cairo-deprecated.h \ /usr/include/gtk-2.0/gdk/gdktypes.h /usr/include/pango-1.0/pango/pango.h \ /usr/include/pango-1.0/pango/pango-attributes.h \ /usr/include/pango-1.0/pango/pango-font.h \ /usr/include/pango-1.0/pango/pango-coverage.h \ /usr/include/pango-1.0/pango/pango-types.h \ /usr/include/pango-1.0/pango/pango-gravity.h \ /usr/include/pango-1.0/pango/pango-matrix.h \ /usr/include/pango-1.0/pango/pango-script.h \ /usr/include/pango-1.0/pango/pango-language.h \ /usr/include/pango-1.0/pango/pango-bidi-type.h \ /usr/include/pango-1.0/pango/pango-break.h \ /usr/include/pango-1.0/pango/pango-item.h \ /usr/include/pango-1.0/pango/pango-context.h \ /usr/include/pango-1.0/pango/pango-fontmap.h \ /usr/include/pango-1.0/pango/pango-fontset.h \ /usr/include/pango-1.0/pango/pango-engine.h \ /usr/include/pango-1.0/pango/pango-glyph.h \ /usr/include/pango-1.0/pango/pango-enum-types.h \ /usr/include/pango-1.0/pango/pango-features.h \ /usr/include/pango-1.0/pango/pango-glyph-item.h \ /usr/include/pango-1.0/pango/pango-layout.h \ /usr/include/pango-1.0/pango/pango-tabs.h \ /usr/include/pango-1.0/pango/pango-renderer.h \ /usr/include/pango-1.0/pango/pango-utils.h \ /usr/lib/x86_64-linux-gnu/gtk-2.0/include/gdkconfig.h \ /usr/include/gtk-2.0/gdk/gdkdisplay.h \ /usr/include/gtk-2.0/gdk/gdkevents.h /usr/include/gtk-2.0/gdk/gdkcolor.h \ /usr/include/gtk-2.0/gdk/gdkdnd.h /usr/include/gtk-2.0/gdk/gdkinput.h \ /usr/include/gtk-2.0/gdk/gdkcairo.h /usr/include/gtk-2.0/gdk/gdkpixbuf.h \ /usr/include/gtk-2.0/gdk/gdkrgb.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-features.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-core.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-transform.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-animation.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-simple-anim.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-io.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-loader.h \ /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-enum-types.h \ /usr/include/pango-1.0/pango/pangocairo.h \ /usr/include/gtk-2.0/gdk/gdkcursor.h \ /usr/include/gtk-2.0/gdk/gdkdisplaymanager.h \ /usr/include/gtk-2.0/gdk/gdkdrawable.h /usr/include/gtk-2.0/gdk/gdkgc.h \ /usr/include/gtk-2.0/gdk/gdkenumtypes.h \ /usr/include/gtk-2.0/gdk/gdkfont.h /usr/include/gtk-2.0/gdk/gdkimage.h \ /usr/include/gtk-2.0/gdk/gdkkeys.h /usr/include/gtk-2.0/gdk/gdkpango.h \ /usr/include/gtk-2.0/gdk/gdkpixmap.h \ /usr/include/gtk-2.0/gdk/gdkproperty.h \ /usr/include/gtk-2.0/gdk/gdkregion.h \ /usr/include/gtk-2.0/gdk/gdkselection.h \ /usr/include/gtk-2.0/gdk/gdkspawn.h \ /usr/include/gtk-2.0/gdk/gdktestutils.h \ /usr/include/gtk-2.0/gdk/gdkwindow.h \ /usr/include/gtk-2.0/gdk/gdkvisual.h \ /usr/include/gtk-2.0/gtk/gtkaboutdialog.h \ /usr/include/gtk-2.0/gtk/gtkdialog.h \ /usr/include/gtk-2.0/gtk/gtkwindow.h \ /usr/include/gtk-2.0/gtk/gtkaccelgroup.h \ /usr/include/gtk-2.0/gtk/gtkenums.h /usr/include/gtk-2.0/gtk/gtkbin.h \ /usr/include/gtk-2.0/gtk/gtkcontainer.h \ /usr/include/gtk-2.0/gtk/gtkwidget.h \ /usr/include/gtk-2.0/gtk/gtkobject.h \ /usr/include/gtk-2.0/gtk/gtktypeutils.h \ /usr/include/gtk-2.0/gtk/gtktypebuiltins.h \ /usr/include/gtk-2.0/gtk/gtkdebug.h \ /usr/include/gtk-2.0/gtk/gtkadjustment.h \ /usr/include/gtk-2.0/gtk/gtkstyle.h \ /usr/include/gtk-2.0/gtk/gtksettings.h /usr/include/gtk-2.0/gtk/gtkrc.h \ /usr/include/atk-1.0/atk/atk.h /usr/include/atk-1.0/atk/atkobject.h \ /usr/include/atk-1.0/atk/atkstate.h \ /usr/include/atk-1.0/atk/atkrelationtype.h \ /usr/include/atk-1.0/atk/atkaction.h \ /usr/include/atk-1.0/atk/atkcomponent.h \ /usr/include/atk-1.0/atk/atkutil.h \ /usr/include/atk-1.0/atk/atkdocument.h \ /usr/include/atk-1.0/atk/atkeditabletext.h \ /usr/include/atk-1.0/atk/atktext.h \ /usr/include/atk-1.0/atk/atkgobjectaccessible.h \ /usr/include/atk-1.0/atk/atkhyperlink.h \ /usr/include/atk-1.0/atk/atkhyperlinkimpl.h \ /usr/include/atk-1.0/atk/atkhypertext.h \ /usr/include/atk-1.0/atk/atkimage.h \ /usr/include/atk-1.0/atk/atknoopobject.h \ /usr/include/atk-1.0/atk/atknoopobjectfactory.h \ /usr/include/atk-1.0/atk/atkobjectfactory.h \ /usr/include/atk-1.0/atk/atkplug.h \ /usr/include/atk-1.0/atk/atkregistry.h \ /usr/include/atk-1.0/atk/atkobjectfactory.h \ /usr/include/atk-1.0/atk/atkrelation.h \ /usr/include/atk-1.0/atk/atkrelationset.h \ /usr/include/atk-1.0/atk/atkselection.h \ /usr/include/atk-1.0/atk/atksocket.h \ /usr/include/atk-1.0/atk/atkstateset.h \ /usr/include/atk-1.0/atk/atkstreamablecontent.h \ /usr/include/atk-1.0/atk/atktable.h /usr/include/atk-1.0/atk/atkmisc.h \ /usr/include/atk-1.0/atk/atkvalue.h /usr/include/atk-1.0/atk/atkwindow.h \ /usr/include/gtk-2.0/gtk/gtkaccellabel.h \ /usr/include/gtk-2.0/gtk/gtklabel.h /usr/include/gtk-2.0/gtk/gtkmisc.h \ /usr/include/gtk-2.0/gtk/gtkmenu.h \ /usr/include/gtk-2.0/gtk/gtkmenushell.h \ /usr/include/gtk-2.0/gtk/gtkaccelmap.h \ /usr/include/gtk-2.0/gtk/gtkaccessible.h \ /usr/include/gtk-2.0/gtk/gtkaction.h \ /usr/include/gtk-2.0/gtk/gtkactiongroup.h \ /usr/include/gtk-2.0/gtk/gtkactivatable.h \ /usr/include/gtk-2.0/gtk/gtkalignment.h \ /usr/include/gtk-2.0/gtk/gtkarrow.h \ /usr/include/gtk-2.0/gtk/gtkaspectframe.h \ /usr/include/gtk-2.0/gtk/gtkframe.h \ /usr/include/gtk-2.0/gtk/gtkassistant.h \ /usr/include/gtk-2.0/gtk/gtkbbox.h /usr/include/gtk-2.0/gtk/gtkbox.h \ /usr/include/gtk-2.0/gtk/gtkbindings.h \ /usr/include/gtk-2.0/gtk/gtkbuildable.h \ /usr/include/gtk-2.0/gtk/gtkbuilder.h \ /usr/include/gtk-2.0/gtk/gtkbutton.h /usr/include/gtk-2.0/gtk/gtkimage.h \ /usr/include/gtk-2.0/gtk/gtkcalendar.h \ /usr/include/gtk-2.0/gtk/gtksignal.h \ /usr/include/gtk-2.0/gtk/gtkmarshal.h \ /usr/include/gtk-2.0/gtk/gtkcelleditable.h \ /usr/include/gtk-2.0/gtk/gtkcelllayout.h \ /usr/include/gtk-2.0/gtk/gtkcellrenderer.h \ /usr/include/gtk-2.0/gtk/gtktreeviewcolumn.h \ /usr/include/gtk-2.0/gtk/gtktreemodel.h \ /usr/include/gtk-2.0/gtk/gtktreesortable.h \ /usr/include/gtk-2.0/gtk/gtkcellrendereraccel.h \ /usr/include/gtk-2.0/gtk/gtkcellrenderertext.h \ /usr/include/gtk-2.0/gtk/gtkcellrenderercombo.h \ /usr/include/gtk-2.0/gtk/gtkcellrendererpixbuf.h \ /usr/include/gtk-2.0/gtk/gtkcellrendererprogress.h \ /usr/include/gtk-2.0/gtk/gtkcellrendererspin.h \ /usr/include/gtk-2.0/gtk/gtkcellrendererspinner.h \ /usr/include/gtk-2.0/gtk/gtkcellrenderertoggle.h \ /usr/include/gtk-2.0/gtk/gtkcellview.h \ /usr/include/gtk-2.0/gtk/gtkcheckbutton.h \ /usr/include/gtk-2.0/gtk/gtktogglebutton.h \ /usr/include/gtk-2.0/gtk/gtkcheckmenuitem.h \ /usr/include/gtk-2.0/gtk/gtkmenuitem.h \ /usr/include/gtk-2.0/gtk/gtkitem.h \ /usr/include/gtk-2.0/gtk/ubuntumenuproxy.h \ /usr/include/gtk-2.0/gtk/ubuntumenuproxymodule.h \ /usr/include/gtk-2.0/gtk/gtkclipboard.h \ /usr/include/gtk-2.0/gtk/gtkselection.h \ /usr/include/gtk-2.0/gtk/gtktextiter.h \ /usr/include/gtk-2.0/gtk/gtktexttag.h \ /usr/include/gtk-2.0/gtk/gtktextchild.h \ /usr/include/gtk-2.0/gtk/gtkcolorbutton.h \ /usr/include/gtk-2.0/gtk/gtkcolorsel.h \ /usr/include/gtk-2.0/gtk/gtkvbox.h \ /usr/include/gtk-2.0/gtk/gtkcolorseldialog.h \ /usr/include/gtk-2.0/gtk/gtkcombobox.h \ /usr/include/gtk-2.0/gtk/gtktreeview.h /usr/include/gtk-2.0/gtk/gtkdnd.h \ /usr/include/gtk-2.0/gtk/gtkentry.h \ /usr/include/gtk-2.0/gtk/gtkeditable.h \ /usr/include/gtk-2.0/gtk/gtkimcontext.h \ /usr/include/gtk-2.0/gtk/gtkentrybuffer.h \ /usr/include/gtk-2.0/gtk/gtkentrycompletion.h \ /usr/include/gtk-2.0/gtk/gtkliststore.h \ /usr/include/gtk-2.0/gtk/gtktreemodelfilter.h \ /usr/include/gtk-2.0/gtk/gtkcomboboxentry.h \ /usr/include/gtk-2.0/gtk/gtkcomboboxtext.h \ /usr/include/gtk-2.0/gtk/gtkdrawingarea.h \ /usr/include/gtk-2.0/gtk/gtkeventbox.h \ /usr/include/gtk-2.0/gtk/gtkexpander.h \ /usr/include/gtk-2.0/gtk/gtkfixed.h \ /usr/include/gtk-2.0/gtk/gtkfilechooser.h \ /usr/include/gtk-2.0/gtk/gtkfilefilter.h \ /usr/include/gtk-2.0/gtk/gtkfilechooserbutton.h \ /usr/include/gtk-2.0/gtk/gtkhbox.h \ /usr/include/gtk-2.0/gtk/gtkfilechooserdialog.h \ /usr/include/gtk-2.0/gtk/gtkfilechooserwidget.h \ /usr/include/gtk-2.0/gtk/gtkfontbutton.h \ /usr/include/gtk-2.0/gtk/gtkfontsel.h /usr/include/gtk-2.0/gtk/gtkgc.h \ /usr/include/gtk-2.0/gtk/gtkhandlebox.h \ /usr/include/gtk-2.0/gtk/gtkhbbox.h /usr/include/gtk-2.0/gtk/gtkhpaned.h \ /usr/include/gtk-2.0/gtk/gtkpaned.h /usr/include/gtk-2.0/gtk/gtkhruler.h \ /usr/include/gtk-2.0/gtk/gtkruler.h /usr/include/gtk-2.0/gtk/gtkhscale.h \ /usr/include/gtk-2.0/gtk/gtkscale.h /usr/include/gtk-2.0/gtk/gtkrange.h \ /usr/include/gtk-2.0/gtk/gtkhscrollbar.h \ /usr/include/gtk-2.0/gtk/gtkscrollbar.h \ /usr/include/gtk-2.0/gtk/gtkhseparator.h \ /usr/include/gtk-2.0/gtk/gtkseparator.h \ /usr/include/gtk-2.0/gtk/gtkhsv.h \ /usr/include/gtk-2.0/gtk/gtkiconfactory.h \ /usr/include/gtk-2.0/gtk/gtkicontheme.h \ /usr/include/gtk-2.0/gtk/gtkiconview.h \ /usr/include/gtk-2.0/gtk/gtktooltip.h \ /usr/include/gtk-2.0/gtk/gtkimagemenuitem.h \ /usr/include/gtk-2.0/gtk/gtkimcontextsimple.h \ /usr/include/gtk-2.0/gtk/gtkimmulticontext.h \ /usr/include/gtk-2.0/gtk/gtkinfobar.h \ /usr/include/gtk-2.0/gtk/gtkinvisible.h \ /usr/include/gtk-2.0/gtk/gtklayout.h \ /usr/include/gtk-2.0/gtk/gtklinkbutton.h \ /usr/include/gtk-2.0/gtk/gtkmain.h /usr/include/gtk-2.0/gtk/gtkmenubar.h \ /usr/include/gtk-2.0/gtk/gtkmenutoolbutton.h \ /usr/include/gtk-2.0/gtk/gtktoolbutton.h \ /usr/include/gtk-2.0/gtk/gtktoolitem.h \ /usr/include/gtk-2.0/gtk/gtktooltips.h \ /usr/include/gtk-2.0/gtk/gtksizegroup.h \ /usr/include/gtk-2.0/gtk/gtkmessagedialog.h \ /usr/include/gtk-2.0/gtk/gtkmodules.h \ /usr/include/gtk-2.0/gtk/gtkmountoperation.h \ /usr/include/gtk-2.0/gtk/gtknotebook.h \ /usr/include/gtk-2.0/gtk/gtkoffscreenwindow.h \ /usr/include/gtk-2.0/gtk/gtkorientable.h \ /usr/include/gtk-2.0/gtk/gtkpagesetup.h \ /usr/include/gtk-2.0/gtk/gtkpapersize.h \ /usr/include/gtk-2.0/gtk/gtkplug.h /usr/include/gtk-2.0/gtk/gtksocket.h \ /usr/include/gtk-2.0/gtk/gtkprintcontext.h \ /usr/include/gtk-2.0/gtk/gtkprintoperation.h \ /usr/include/gtk-2.0/gtk/gtkprintsettings.h \ /usr/include/gtk-2.0/gtk/gtkprintoperationpreview.h \ /usr/include/gtk-2.0/gtk/gtkprogressbar.h \ /usr/include/gtk-2.0/gtk/gtkprogress.h \ /usr/include/gtk-2.0/gtk/gtkradioaction.h \ /usr/include/gtk-2.0/gtk/gtktoggleaction.h \ /usr/include/gtk-2.0/gtk/gtkradiobutton.h \ /usr/include/gtk-2.0/gtk/gtkradiomenuitem.h \ /usr/include/gtk-2.0/gtk/gtkradiotoolbutton.h \ /usr/include/gtk-2.0/gtk/gtktoggletoolbutton.h \ /usr/include/gtk-2.0/gtk/gtkrecentaction.h \ /usr/include/gtk-2.0/gtk/gtkrecentmanager.h \ /usr/include/gtk-2.0/gtk/gtkrecentchooser.h \ /usr/include/gtk-2.0/gtk/gtkrecentfilter.h \ /usr/include/gtk-2.0/gtk/gtkrecentchooserdialog.h \ /usr/include/gtk-2.0/gtk/gtkrecentchoosermenu.h \ /usr/include/gtk-2.0/gtk/gtkrecentchooserwidget.h \ /usr/include/gtk-2.0/gtk/gtkscalebutton.h \ /usr/include/gtk-2.0/gtk/gtkscrolledwindow.h \ /usr/include/gtk-2.0/gtk/gtkvscrollbar.h \ /usr/include/gtk-2.0/gtk/gtkviewport.h \ /usr/include/gtk-2.0/gtk/gtkseparatormenuitem.h \ /usr/include/gtk-2.0/gtk/gtkseparatortoolitem.h \ /usr/include/gtk-2.0/gtk/gtkshow.h \ /usr/include/gtk-2.0/gtk/gtkspinbutton.h \ /usr/include/gtk-2.0/gtk/gtkspinner.h \ /usr/include/gtk-2.0/gtk/gtkstatusbar.h \ /usr/include/gtk-2.0/gtk/gtkstatusicon.h \ /usr/include/gtk-2.0/gtk/gtkstock.h /usr/include/gtk-2.0/gtk/gtktable.h \ /usr/include/gtk-2.0/gtk/gtktearoffmenuitem.h \ /usr/include/gtk-2.0/gtk/gtktextbuffer.h \ /usr/include/gtk-2.0/gtk/gtktexttagtable.h \ /usr/include/gtk-2.0/gtk/gtktextmark.h \ /usr/include/gtk-2.0/gtk/gtktextbufferrichtext.h \ /usr/include/gtk-2.0/gtk/gtktextview.h \ /usr/include/gtk-2.0/gtk/gtktoolbar.h \ /usr/include/gtk-2.0/gtk/gtkpixmap.h \ /usr/include/gtk-2.0/gtk/gtktoolitemgroup.h \ /usr/include/gtk-2.0/gtk/gtktoolpalette.h \ /usr/include/gtk-2.0/gtk/gtktoolshell.h \ /usr/include/gtk-2.0/gtk/gtktestutils.h \ /usr/include/gtk-2.0/gtk/gtktreednd.h \ /usr/include/gtk-2.0/gtk/gtktreemodelsort.h \ /usr/include/gtk-2.0/gtk/gtktreeselection.h \ /usr/include/gtk-2.0/gtk/gtktreestore.h \ /usr/include/gtk-2.0/gtk/gtkuimanager.h \ /usr/include/gtk-2.0/gtk/gtkvbbox.h \ /usr/include/gtk-2.0/gtk/gtkversion.h \ /usr/include/gtk-2.0/gtk/gtkvolumebutton.h \ /usr/include/gtk-2.0/gtk/gtkvpaned.h \ /usr/include/gtk-2.0/gtk/gtkvruler.h \ /usr/include/gtk-2.0/gtk/gtkvscale.h \ /usr/include/gtk-2.0/gtk/gtkvseparator.h \ /usr/include/gtk-2.0/gtk/gtktext.h /usr/include/gtk-2.0/gtk/gtktree.h \ /usr/include/gtk-2.0/gtk/gtktreeitem.h \ /usr/include/gtk-2.0/gtk/gtkclist.h /usr/include/gtk-2.0/gtk/gtkcombo.h \ /usr/include/gtk-2.0/gtk/gtkctree.h /usr/include/gtk-2.0/gtk/gtkcurve.h \ /usr/include/gtk-2.0/gtk/gtkfilesel.h \ /usr/include/gtk-2.0/gtk/gtkgamma.h \ /usr/include/gtk-2.0/gtk/gtkinputdialog.h \ /usr/include/gtk-2.0/gtk/gtkitemfactory.h \ /usr/include/gtk-2.0/gtk/gtklist.h \ /usr/include/gtk-2.0/gtk/gtklistitem.h \ /usr/include/gtk-2.0/gtk/gtkoldeditable.h \ /usr/include/gtk-2.0/gtk/gtkoptionmenu.h \ /usr/include/gtk-2.0/gtk/gtkpreview.h \ /usr/include/gtk-2.0/gtk/gtktipsquery.h mtr.h net.h /usr/include/netdb.h \ /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h /usr/include/rpc/netdb.h \ /usr/include/x86_64-linux-gnu/bits/netdb.h /usr/include/arpa/inet.h \ /usr/include/netinet/ip6.h /usr/include/inttypes.h \ /usr/include/netinet/icmp6.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h /usr/include/linux/param.h \ /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h mtr-gtk.h version.h img/mtr_icon.xpm config.h: /usr/include/stdio.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/time.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/x86_64-linux-gnu/sys/time.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/gtk-2.0/gtk/gtk.h: /usr/include/gtk-2.0/gdk/gdk.h: /usr/include/gtk-2.0/gdk/gdkapplaunchcontext.h: /usr/include/glib-2.0/gio/gio.h: /usr/include/glib-2.0/gio/giotypes.h: /usr/include/glib-2.0/gio/gioenums.h: /usr/include/glib-2.0/glib-object.h: /usr/include/glib-2.0/gobject/gbinding.h: /usr/include/glib-2.0/glib.h: /usr/include/glib-2.0/glib/galloca.h: /usr/include/glib-2.0/glib/gtypes.h: /usr/lib/x86_64-linux-gnu/glib-2.0/include/glibconfig.h: /usr/include/glib-2.0/glib/gmacros.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/float.h: /usr/include/glib-2.0/glib/garray.h: /usr/include/glib-2.0/glib/gasyncqueue.h: /usr/include/glib-2.0/glib/gthread.h: /usr/include/glib-2.0/glib/gerror.h: /usr/include/glib-2.0/glib/gquark.h: /usr/include/glib-2.0/glib/gutils.h: /usr/include/glib-2.0/glib/gatomic.h: /usr/include/glib-2.0/glib/gbacktrace.h: /usr/include/signal.h: /usr/include/x86_64-linux-gnu/bits/signum.h: /usr/include/x86_64-linux-gnu/bits/siginfo.h: /usr/include/x86_64-linux-gnu/bits/sigaction.h: /usr/include/x86_64-linux-gnu/bits/sigcontext.h: /usr/include/x86_64-linux-gnu/bits/sigstack.h: /usr/include/x86_64-linux-gnu/sys/ucontext.h: /usr/include/x86_64-linux-gnu/bits/sigthread.h: /usr/include/glib-2.0/glib/gbase64.h: /usr/include/glib-2.0/glib/gbitlock.h: /usr/include/glib-2.0/glib/gbookmarkfile.h: /usr/include/glib-2.0/glib/gcache.h: /usr/include/glib-2.0/glib/glist.h: /usr/include/glib-2.0/glib/gmem.h: /usr/include/glib-2.0/glib/gslice.h: /usr/include/glib-2.0/glib/gchecksum.h: /usr/include/glib-2.0/glib/gcompletion.h: /usr/include/glib-2.0/glib/gconvert.h: /usr/include/glib-2.0/glib/gdataset.h: /usr/include/glib-2.0/glib/gdate.h: /usr/include/glib-2.0/glib/gdatetime.h: /usr/include/glib-2.0/glib/gtimezone.h: /usr/include/glib-2.0/glib/gdir.h: /usr/include/glib-2.0/glib/gfileutils.h: /usr/include/glib-2.0/glib/ghash.h: /usr/include/glib-2.0/glib/ghmac.h: /usr/include/glib-2.0/glib/gchecksum.h: /usr/include/glib-2.0/glib/ghook.h: /usr/include/glib-2.0/glib/ghostutils.h: /usr/include/glib-2.0/glib/giochannel.h: /usr/include/glib-2.0/glib/gmain.h: /usr/include/glib-2.0/glib/gpoll.h: /usr/include/glib-2.0/glib/gslist.h: /usr/include/glib-2.0/glib/gstring.h: /usr/include/glib-2.0/glib/gunicode.h: /usr/include/glib-2.0/glib/gkeyfile.h: /usr/include/glib-2.0/glib/gmappedfile.h: /usr/include/glib-2.0/glib/gmarkup.h: /usr/include/glib-2.0/glib/gmessages.h: /usr/include/glib-2.0/glib/gnode.h: /usr/include/glib-2.0/glib/goption.h: /usr/include/glib-2.0/glib/gpattern.h: /usr/include/glib-2.0/glib/gprimes.h: /usr/include/glib-2.0/glib/gqsort.h: /usr/include/glib-2.0/glib/gqueue.h: /usr/include/glib-2.0/glib/grand.h: /usr/include/glib-2.0/glib/grel.h: /usr/include/glib-2.0/glib/gregex.h: /usr/include/glib-2.0/glib/gscanner.h: /usr/include/glib-2.0/glib/gsequence.h: /usr/include/glib-2.0/glib/gshell.h: /usr/include/glib-2.0/glib/gspawn.h: /usr/include/glib-2.0/glib/gstrfuncs.h: /usr/include/glib-2.0/glib/gtestutils.h: /usr/include/glib-2.0/glib/gthreadpool.h: /usr/include/glib-2.0/glib/gtimer.h: /usr/include/glib-2.0/glib/gtree.h: /usr/include/glib-2.0/glib/gurifuncs.h: /usr/include/glib-2.0/glib/gvarianttype.h: /usr/include/glib-2.0/glib/gvariant.h: /usr/include/glib-2.0/gobject/gobject.h: /usr/include/glib-2.0/gobject/gtype.h: /usr/include/glib-2.0/gobject/gvalue.h: /usr/include/glib-2.0/gobject/gparam.h: /usr/include/glib-2.0/gobject/gclosure.h: /usr/include/glib-2.0/gobject/gsignal.h: /usr/include/glib-2.0/gobject/gmarshal.h: /usr/include/glib-2.0/gobject/gboxed.h: /usr/include/glib-2.0/gobject/glib-types.h: /usr/include/glib-2.0/gobject/genums.h: /usr/include/glib-2.0/gobject/gparamspecs.h: /usr/include/glib-2.0/gobject/gsourceclosure.h: /usr/include/glib-2.0/gobject/gtypemodule.h: /usr/include/glib-2.0/gobject/gtypeplugin.h: /usr/include/glib-2.0/gobject/gvaluearray.h: /usr/include/glib-2.0/gobject/gvaluetypes.h: /usr/include/glib-2.0/gio/gappinfo.h: /usr/include/glib-2.0/gio/gaction.h: /usr/include/glib-2.0/gio/gsimpleaction.h: /usr/include/glib-2.0/gio/gactiongroup.h: /usr/include/glib-2.0/gio/gsimpleactiongroup.h: /usr/include/glib-2.0/gio/gactiongroup.h: /usr/include/glib-2.0/gio/gapplication.h: /usr/include/glib-2.0/gio/gapplicationcommandline.h: /usr/include/glib-2.0/gio/gasyncinitable.h: /usr/include/glib-2.0/gio/ginitable.h: /usr/include/glib-2.0/gio/gasyncresult.h: /usr/include/glib-2.0/gio/gbufferedinputstream.h: /usr/include/glib-2.0/gio/gfilterinputstream.h: /usr/include/glib-2.0/gio/ginputstream.h: /usr/include/glib-2.0/gio/gbufferedoutputstream.h: /usr/include/glib-2.0/gio/gfilteroutputstream.h: /usr/include/glib-2.0/gio/goutputstream.h: /usr/include/glib-2.0/gio/gcancellable.h: /usr/include/glib-2.0/gio/gcharsetconverter.h: /usr/include/glib-2.0/gio/gconverter.h: /usr/include/glib-2.0/gio/gcontenttype.h: /usr/include/glib-2.0/gio/gconverterinputstream.h: /usr/include/glib-2.0/gio/gconverteroutputstream.h: /usr/include/glib-2.0/gio/gcredentials.h: /usr/include/glib-2.0/gio/gdatainputstream.h: /usr/include/glib-2.0/gio/gdataoutputstream.h: /usr/include/glib-2.0/gio/gdbusaddress.h: /usr/include/glib-2.0/gio/gdbusauthobserver.h: /usr/include/glib-2.0/gio/gdbusconnection.h: /usr/include/glib-2.0/gio/gdbuserror.h: /usr/include/glib-2.0/gio/gdbusintrospection.h: /usr/include/glib-2.0/gio/gdbusmessage.h: /usr/include/glib-2.0/gio/gdbusmethodinvocation.h: /usr/include/glib-2.0/gio/gdbusnameowning.h: /usr/include/glib-2.0/gio/gdbusnamewatching.h: /usr/include/glib-2.0/gio/gdbusproxy.h: /usr/include/glib-2.0/gio/gdbusserver.h: /usr/include/glib-2.0/gio/gdbusutils.h: /usr/include/glib-2.0/gio/gdrive.h: /usr/include/glib-2.0/gio/gemblemedicon.h: /usr/include/glib-2.0/gio/gicon.h: /usr/include/glib-2.0/gio/gemblem.h: /usr/include/glib-2.0/gio/gfileattribute.h: /usr/include/glib-2.0/gio/gfileenumerator.h: /usr/include/glib-2.0/gio/gfile.h: /usr/include/glib-2.0/gio/gfileicon.h: /usr/include/glib-2.0/gio/gfileinfo.h: /usr/include/glib-2.0/gio/gfileinputstream.h: /usr/include/glib-2.0/gio/gfileiostream.h: /usr/include/glib-2.0/gio/giostream.h: /usr/include/glib-2.0/gio/gioerror.h: /usr/include/glib-2.0/gio/gfilemonitor.h: /usr/include/glib-2.0/gio/gfilenamecompleter.h: /usr/include/glib-2.0/gio/gfileoutputstream.h: /usr/include/glib-2.0/gio/ginetaddress.h: /usr/include/glib-2.0/gio/ginetsocketaddress.h: /usr/include/glib-2.0/gio/gsocketaddress.h: /usr/include/glib-2.0/gio/gioenumtypes.h: /usr/include/glib-2.0/gio/giomodule.h: /usr/include/glib-2.0/gmodule.h: /usr/include/glib-2.0/gio/gioscheduler.h: /usr/include/glib-2.0/gio/gloadableicon.h: /usr/include/glib-2.0/gio/gmemoryinputstream.h: /usr/include/glib-2.0/gio/gmemoryoutputstream.h: /usr/include/glib-2.0/gio/gmount.h: /usr/include/glib-2.0/gio/gmountoperation.h: /usr/include/glib-2.0/gio/gnativevolumemonitor.h: /usr/include/glib-2.0/gio/gvolumemonitor.h: /usr/include/glib-2.0/gio/gnetworkaddress.h: /usr/include/glib-2.0/gio/gnetworkservice.h: /usr/include/glib-2.0/gio/gpermission.h: /usr/include/glib-2.0/gio/gpollableinputstream.h: /usr/include/glib-2.0/gio/gpollableoutputstream.h: /usr/include/glib-2.0/gio/gproxy.h: /usr/include/glib-2.0/gio/gproxyaddress.h: /usr/include/glib-2.0/gio/gproxyaddressenumerator.h: /usr/include/glib-2.0/gio/gsocketaddressenumerator.h: /usr/include/glib-2.0/gio/gproxyresolver.h: /usr/include/glib-2.0/gio/gresolver.h: /usr/include/glib-2.0/gio/gseekable.h: /usr/include/glib-2.0/gio/gsettings.h: /usr/include/glib-2.0/gio/gsimpleasyncresult.h: /usr/include/glib-2.0/gio/gsimplepermission.h: /usr/include/glib-2.0/gio/gsocketclient.h: /usr/include/glib-2.0/gio/gsocketconnectable.h: /usr/include/glib-2.0/gio/gsocketconnection.h: /usr/include/glib-2.0/gio/gsocket.h: /usr/include/glib-2.0/gio/gsocketcontrolmessage.h: /usr/include/glib-2.0/gio/gsocketlistener.h: /usr/include/glib-2.0/gio/gsocketservice.h: /usr/include/glib-2.0/gio/gsrvtarget.h: /usr/include/glib-2.0/gio/gtcpconnection.h: /usr/include/glib-2.0/gio/gtcpwrapperconnection.h: /usr/include/glib-2.0/gio/gthemedicon.h: /usr/include/glib-2.0/gio/gthreadedsocketservice.h: /usr/include/glib-2.0/gio/gtlsbackend.h: /usr/include/glib-2.0/gio/gtlscertificate.h: /usr/include/glib-2.0/gio/gtlsclientconnection.h: /usr/include/glib-2.0/gio/gtlsconnection.h: /usr/include/glib-2.0/gio/gtlsdatabase.h: /usr/include/glib-2.0/gio/gtlsfiledatabase.h: /usr/include/glib-2.0/gio/gtlsinteraction.h: /usr/include/glib-2.0/gio/gtlsserverconnection.h: /usr/include/glib-2.0/gio/gtlspassword.h: /usr/include/glib-2.0/gio/gvfs.h: /usr/include/glib-2.0/gio/gvolume.h: /usr/include/glib-2.0/gio/gzlibcompressor.h: /usr/include/glib-2.0/gio/gzlibdecompressor.h: /usr/include/glib-2.0/gio/gdbusinterface.h: /usr/include/glib-2.0/gio/gdbusinterfaceskeleton.h: /usr/include/glib-2.0/gio/gdbusobject.h: /usr/include/glib-2.0/gio/gdbusobjectskeleton.h: /usr/include/glib-2.0/gio/gdbusobjectproxy.h: /usr/include/glib-2.0/gio/gdbusobjectmanager.h: /usr/include/glib-2.0/gio/gdbusobjectmanagerclient.h: /usr/include/glib-2.0/gio/gdbusobjectmanagerserver.h: /usr/include/gtk-2.0/gdk/gdkscreen.h: /usr/include/cairo/cairo.h: /usr/include/cairo/cairo-version.h: /usr/include/cairo/cairo-features.h: /usr/include/cairo/cairo-deprecated.h: /usr/include/gtk-2.0/gdk/gdktypes.h: /usr/include/pango-1.0/pango/pango.h: /usr/include/pango-1.0/pango/pango-attributes.h: /usr/include/pango-1.0/pango/pango-font.h: /usr/include/pango-1.0/pango/pango-coverage.h: /usr/include/pango-1.0/pango/pango-types.h: /usr/include/pango-1.0/pango/pango-gravity.h: /usr/include/pango-1.0/pango/pango-matrix.h: /usr/include/pango-1.0/pango/pango-script.h: /usr/include/pango-1.0/pango/pango-language.h: /usr/include/pango-1.0/pango/pango-bidi-type.h: /usr/include/pango-1.0/pango/pango-break.h: /usr/include/pango-1.0/pango/pango-item.h: /usr/include/pango-1.0/pango/pango-context.h: /usr/include/pango-1.0/pango/pango-fontmap.h: /usr/include/pango-1.0/pango/pango-fontset.h: /usr/include/pango-1.0/pango/pango-engine.h: /usr/include/pango-1.0/pango/pango-glyph.h: /usr/include/pango-1.0/pango/pango-enum-types.h: /usr/include/pango-1.0/pango/pango-features.h: /usr/include/pango-1.0/pango/pango-glyph-item.h: /usr/include/pango-1.0/pango/pango-layout.h: /usr/include/pango-1.0/pango/pango-tabs.h: /usr/include/pango-1.0/pango/pango-renderer.h: /usr/include/pango-1.0/pango/pango-utils.h: /usr/lib/x86_64-linux-gnu/gtk-2.0/include/gdkconfig.h: /usr/include/gtk-2.0/gdk/gdkdisplay.h: /usr/include/gtk-2.0/gdk/gdkevents.h: /usr/include/gtk-2.0/gdk/gdkcolor.h: /usr/include/gtk-2.0/gdk/gdkdnd.h: /usr/include/gtk-2.0/gdk/gdkinput.h: /usr/include/gtk-2.0/gdk/gdkcairo.h: /usr/include/gtk-2.0/gdk/gdkpixbuf.h: /usr/include/gtk-2.0/gdk/gdkrgb.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-features.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-core.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-transform.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-animation.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-simple-anim.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-io.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-loader.h: /usr/include/gdk-pixbuf-2.0/gdk-pixbuf/gdk-pixbuf-enum-types.h: /usr/include/pango-1.0/pango/pangocairo.h: /usr/include/gtk-2.0/gdk/gdkcursor.h: /usr/include/gtk-2.0/gdk/gdkdisplaymanager.h: /usr/include/gtk-2.0/gdk/gdkdrawable.h: /usr/include/gtk-2.0/gdk/gdkgc.h: /usr/include/gtk-2.0/gdk/gdkenumtypes.h: /usr/include/gtk-2.0/gdk/gdkfont.h: /usr/include/gtk-2.0/gdk/gdkimage.h: /usr/include/gtk-2.0/gdk/gdkkeys.h: /usr/include/gtk-2.0/gdk/gdkpango.h: /usr/include/gtk-2.0/gdk/gdkpixmap.h: /usr/include/gtk-2.0/gdk/gdkproperty.h: /usr/include/gtk-2.0/gdk/gdkregion.h: /usr/include/gtk-2.0/gdk/gdkselection.h: /usr/include/gtk-2.0/gdk/gdkspawn.h: /usr/include/gtk-2.0/gdk/gdktestutils.h: /usr/include/gtk-2.0/gdk/gdkwindow.h: /usr/include/gtk-2.0/gdk/gdkvisual.h: /usr/include/gtk-2.0/gtk/gtkaboutdialog.h: /usr/include/gtk-2.0/gtk/gtkdialog.h: /usr/include/gtk-2.0/gtk/gtkwindow.h: /usr/include/gtk-2.0/gtk/gtkaccelgroup.h: /usr/include/gtk-2.0/gtk/gtkenums.h: /usr/include/gtk-2.0/gtk/gtkbin.h: /usr/include/gtk-2.0/gtk/gtkcontainer.h: /usr/include/gtk-2.0/gtk/gtkwidget.h: /usr/include/gtk-2.0/gtk/gtkobject.h: /usr/include/gtk-2.0/gtk/gtktypeutils.h: /usr/include/gtk-2.0/gtk/gtktypebuiltins.h: /usr/include/gtk-2.0/gtk/gtkdebug.h: /usr/include/gtk-2.0/gtk/gtkadjustment.h: /usr/include/gtk-2.0/gtk/gtkstyle.h: /usr/include/gtk-2.0/gtk/gtksettings.h: /usr/include/gtk-2.0/gtk/gtkrc.h: /usr/include/atk-1.0/atk/atk.h: /usr/include/atk-1.0/atk/atkobject.h: /usr/include/atk-1.0/atk/atkstate.h: /usr/include/atk-1.0/atk/atkrelationtype.h: /usr/include/atk-1.0/atk/atkaction.h: /usr/include/atk-1.0/atk/atkcomponent.h: /usr/include/atk-1.0/atk/atkutil.h: /usr/include/atk-1.0/atk/atkdocument.h: /usr/include/atk-1.0/atk/atkeditabletext.h: /usr/include/atk-1.0/atk/atktext.h: /usr/include/atk-1.0/atk/atkgobjectaccessible.h: /usr/include/atk-1.0/atk/atkhyperlink.h: /usr/include/atk-1.0/atk/atkhyperlinkimpl.h: /usr/include/atk-1.0/atk/atkhypertext.h: /usr/include/atk-1.0/atk/atkimage.h: /usr/include/atk-1.0/atk/atknoopobject.h: /usr/include/atk-1.0/atk/atknoopobjectfactory.h: /usr/include/atk-1.0/atk/atkobjectfactory.h: /usr/include/atk-1.0/atk/atkplug.h: /usr/include/atk-1.0/atk/atkregistry.h: /usr/include/atk-1.0/atk/atkobjectfactory.h: /usr/include/atk-1.0/atk/atkrelation.h: /usr/include/atk-1.0/atk/atkrelationset.h: /usr/include/atk-1.0/atk/atkselection.h: /usr/include/atk-1.0/atk/atksocket.h: /usr/include/atk-1.0/atk/atkstateset.h: /usr/include/atk-1.0/atk/atkstreamablecontent.h: /usr/include/atk-1.0/atk/atktable.h: /usr/include/atk-1.0/atk/atkmisc.h: /usr/include/atk-1.0/atk/atkvalue.h: /usr/include/atk-1.0/atk/atkwindow.h: /usr/include/gtk-2.0/gtk/gtkaccellabel.h: /usr/include/gtk-2.0/gtk/gtklabel.h: /usr/include/gtk-2.0/gtk/gtkmisc.h: /usr/include/gtk-2.0/gtk/gtkmenu.h: /usr/include/gtk-2.0/gtk/gtkmenushell.h: /usr/include/gtk-2.0/gtk/gtkaccelmap.h: /usr/include/gtk-2.0/gtk/gtkaccessible.h: /usr/include/gtk-2.0/gtk/gtkaction.h: /usr/include/gtk-2.0/gtk/gtkactiongroup.h: /usr/include/gtk-2.0/gtk/gtkactivatable.h: /usr/include/gtk-2.0/gtk/gtkalignment.h: /usr/include/gtk-2.0/gtk/gtkarrow.h: /usr/include/gtk-2.0/gtk/gtkaspectframe.h: /usr/include/gtk-2.0/gtk/gtkframe.h: /usr/include/gtk-2.0/gtk/gtkassistant.h: /usr/include/gtk-2.0/gtk/gtkbbox.h: /usr/include/gtk-2.0/gtk/gtkbox.h: /usr/include/gtk-2.0/gtk/gtkbindings.h: /usr/include/gtk-2.0/gtk/gtkbuildable.h: /usr/include/gtk-2.0/gtk/gtkbuilder.h: /usr/include/gtk-2.0/gtk/gtkbutton.h: /usr/include/gtk-2.0/gtk/gtkimage.h: /usr/include/gtk-2.0/gtk/gtkcalendar.h: /usr/include/gtk-2.0/gtk/gtksignal.h: /usr/include/gtk-2.0/gtk/gtkmarshal.h: /usr/include/gtk-2.0/gtk/gtkcelleditable.h: /usr/include/gtk-2.0/gtk/gtkcelllayout.h: /usr/include/gtk-2.0/gtk/gtkcellrenderer.h: /usr/include/gtk-2.0/gtk/gtktreeviewcolumn.h: /usr/include/gtk-2.0/gtk/gtktreemodel.h: /usr/include/gtk-2.0/gtk/gtktreesortable.h: /usr/include/gtk-2.0/gtk/gtkcellrendereraccel.h: /usr/include/gtk-2.0/gtk/gtkcellrenderertext.h: /usr/include/gtk-2.0/gtk/gtkcellrenderercombo.h: /usr/include/gtk-2.0/gtk/gtkcellrendererpixbuf.h: /usr/include/gtk-2.0/gtk/gtkcellrendererprogress.h: /usr/include/gtk-2.0/gtk/gtkcellrendererspin.h: /usr/include/gtk-2.0/gtk/gtkcellrendererspinner.h: /usr/include/gtk-2.0/gtk/gtkcellrenderertoggle.h: /usr/include/gtk-2.0/gtk/gtkcellview.h: /usr/include/gtk-2.0/gtk/gtkcheckbutton.h: /usr/include/gtk-2.0/gtk/gtktogglebutton.h: /usr/include/gtk-2.0/gtk/gtkcheckmenuitem.h: /usr/include/gtk-2.0/gtk/gtkmenuitem.h: /usr/include/gtk-2.0/gtk/gtkitem.h: /usr/include/gtk-2.0/gtk/ubuntumenuproxy.h: /usr/include/gtk-2.0/gtk/ubuntumenuproxymodule.h: /usr/include/gtk-2.0/gtk/gtkclipboard.h: /usr/include/gtk-2.0/gtk/gtkselection.h: /usr/include/gtk-2.0/gtk/gtktextiter.h: /usr/include/gtk-2.0/gtk/gtktexttag.h: /usr/include/gtk-2.0/gtk/gtktextchild.h: /usr/include/gtk-2.0/gtk/gtkcolorbutton.h: /usr/include/gtk-2.0/gtk/gtkcolorsel.h: /usr/include/gtk-2.0/gtk/gtkvbox.h: /usr/include/gtk-2.0/gtk/gtkcolorseldialog.h: /usr/include/gtk-2.0/gtk/gtkcombobox.h: /usr/include/gtk-2.0/gtk/gtktreeview.h: /usr/include/gtk-2.0/gtk/gtkdnd.h: /usr/include/gtk-2.0/gtk/gtkentry.h: /usr/include/gtk-2.0/gtk/gtkeditable.h: /usr/include/gtk-2.0/gtk/gtkimcontext.h: /usr/include/gtk-2.0/gtk/gtkentrybuffer.h: /usr/include/gtk-2.0/gtk/gtkentrycompletion.h: /usr/include/gtk-2.0/gtk/gtkliststore.h: /usr/include/gtk-2.0/gtk/gtktreemodelfilter.h: /usr/include/gtk-2.0/gtk/gtkcomboboxentry.h: /usr/include/gtk-2.0/gtk/gtkcomboboxtext.h: /usr/include/gtk-2.0/gtk/gtkdrawingarea.h: /usr/include/gtk-2.0/gtk/gtkeventbox.h: /usr/include/gtk-2.0/gtk/gtkexpander.h: /usr/include/gtk-2.0/gtk/gtkfixed.h: /usr/include/gtk-2.0/gtk/gtkfilechooser.h: /usr/include/gtk-2.0/gtk/gtkfilefilter.h: /usr/include/gtk-2.0/gtk/gtkfilechooserbutton.h: /usr/include/gtk-2.0/gtk/gtkhbox.h: /usr/include/gtk-2.0/gtk/gtkfilechooserdialog.h: /usr/include/gtk-2.0/gtk/gtkfilechooserwidget.h: /usr/include/gtk-2.0/gtk/gtkfontbutton.h: /usr/include/gtk-2.0/gtk/gtkfontsel.h: /usr/include/gtk-2.0/gtk/gtkgc.h: /usr/include/gtk-2.0/gtk/gtkhandlebox.h: /usr/include/gtk-2.0/gtk/gtkhbbox.h: /usr/include/gtk-2.0/gtk/gtkhpaned.h: /usr/include/gtk-2.0/gtk/gtkpaned.h: /usr/include/gtk-2.0/gtk/gtkhruler.h: /usr/include/gtk-2.0/gtk/gtkruler.h: /usr/include/gtk-2.0/gtk/gtkhscale.h: /usr/include/gtk-2.0/gtk/gtkscale.h: /usr/include/gtk-2.0/gtk/gtkrange.h: /usr/include/gtk-2.0/gtk/gtkhscrollbar.h: /usr/include/gtk-2.0/gtk/gtkscrollbar.h: /usr/include/gtk-2.0/gtk/gtkhseparator.h: /usr/include/gtk-2.0/gtk/gtkseparator.h: /usr/include/gtk-2.0/gtk/gtkhsv.h: /usr/include/gtk-2.0/gtk/gtkiconfactory.h: /usr/include/gtk-2.0/gtk/gtkicontheme.h: /usr/include/gtk-2.0/gtk/gtkiconview.h: /usr/include/gtk-2.0/gtk/gtktooltip.h: /usr/include/gtk-2.0/gtk/gtkimagemenuitem.h: /usr/include/gtk-2.0/gtk/gtkimcontextsimple.h: /usr/include/gtk-2.0/gtk/gtkimmulticontext.h: /usr/include/gtk-2.0/gtk/gtkinfobar.h: /usr/include/gtk-2.0/gtk/gtkinvisible.h: /usr/include/gtk-2.0/gtk/gtklayout.h: /usr/include/gtk-2.0/gtk/gtklinkbutton.h: /usr/include/gtk-2.0/gtk/gtkmain.h: /usr/include/gtk-2.0/gtk/gtkmenubar.h: /usr/include/gtk-2.0/gtk/gtkmenutoolbutton.h: /usr/include/gtk-2.0/gtk/gtktoolbutton.h: /usr/include/gtk-2.0/gtk/gtktoolitem.h: /usr/include/gtk-2.0/gtk/gtktooltips.h: /usr/include/gtk-2.0/gtk/gtksizegroup.h: /usr/include/gtk-2.0/gtk/gtkmessagedialog.h: /usr/include/gtk-2.0/gtk/gtkmodules.h: /usr/include/gtk-2.0/gtk/gtkmountoperation.h: /usr/include/gtk-2.0/gtk/gtknotebook.h: /usr/include/gtk-2.0/gtk/gtkoffscreenwindow.h: /usr/include/gtk-2.0/gtk/gtkorientable.h: /usr/include/gtk-2.0/gtk/gtkpagesetup.h: /usr/include/gtk-2.0/gtk/gtkpapersize.h: /usr/include/gtk-2.0/gtk/gtkplug.h: /usr/include/gtk-2.0/gtk/gtksocket.h: /usr/include/gtk-2.0/gtk/gtkprintcontext.h: /usr/include/gtk-2.0/gtk/gtkprintoperation.h: /usr/include/gtk-2.0/gtk/gtkprintsettings.h: /usr/include/gtk-2.0/gtk/gtkprintoperationpreview.h: /usr/include/gtk-2.0/gtk/gtkprogressbar.h: /usr/include/gtk-2.0/gtk/gtkprogress.h: /usr/include/gtk-2.0/gtk/gtkradioaction.h: /usr/include/gtk-2.0/gtk/gtktoggleaction.h: /usr/include/gtk-2.0/gtk/gtkradiobutton.h: /usr/include/gtk-2.0/gtk/gtkradiomenuitem.h: /usr/include/gtk-2.0/gtk/gtkradiotoolbutton.h: /usr/include/gtk-2.0/gtk/gtktoggletoolbutton.h: /usr/include/gtk-2.0/gtk/gtkrecentaction.h: /usr/include/gtk-2.0/gtk/gtkrecentmanager.h: /usr/include/gtk-2.0/gtk/gtkrecentchooser.h: /usr/include/gtk-2.0/gtk/gtkrecentfilter.h: /usr/include/gtk-2.0/gtk/gtkrecentchooserdialog.h: /usr/include/gtk-2.0/gtk/gtkrecentchoosermenu.h: /usr/include/gtk-2.0/gtk/gtkrecentchooserwidget.h: /usr/include/gtk-2.0/gtk/gtkscalebutton.h: /usr/include/gtk-2.0/gtk/gtkscrolledwindow.h: /usr/include/gtk-2.0/gtk/gtkvscrollbar.h: /usr/include/gtk-2.0/gtk/gtkviewport.h: /usr/include/gtk-2.0/gtk/gtkseparatormenuitem.h: /usr/include/gtk-2.0/gtk/gtkseparatortoolitem.h: /usr/include/gtk-2.0/gtk/gtkshow.h: /usr/include/gtk-2.0/gtk/gtkspinbutton.h: /usr/include/gtk-2.0/gtk/gtkspinner.h: /usr/include/gtk-2.0/gtk/gtkstatusbar.h: /usr/include/gtk-2.0/gtk/gtkstatusicon.h: /usr/include/gtk-2.0/gtk/gtkstock.h: /usr/include/gtk-2.0/gtk/gtktable.h: /usr/include/gtk-2.0/gtk/gtktearoffmenuitem.h: /usr/include/gtk-2.0/gtk/gtktextbuffer.h: /usr/include/gtk-2.0/gtk/gtktexttagtable.h: /usr/include/gtk-2.0/gtk/gtktextmark.h: /usr/include/gtk-2.0/gtk/gtktextbufferrichtext.h: /usr/include/gtk-2.0/gtk/gtktextview.h: /usr/include/gtk-2.0/gtk/gtktoolbar.h: /usr/include/gtk-2.0/gtk/gtkpixmap.h: /usr/include/gtk-2.0/gtk/gtktoolitemgroup.h: /usr/include/gtk-2.0/gtk/gtktoolpalette.h: /usr/include/gtk-2.0/gtk/gtktoolshell.h: /usr/include/gtk-2.0/gtk/gtktestutils.h: /usr/include/gtk-2.0/gtk/gtktreednd.h: /usr/include/gtk-2.0/gtk/gtktreemodelsort.h: /usr/include/gtk-2.0/gtk/gtktreeselection.h: /usr/include/gtk-2.0/gtk/gtktreestore.h: /usr/include/gtk-2.0/gtk/gtkuimanager.h: /usr/include/gtk-2.0/gtk/gtkvbbox.h: /usr/include/gtk-2.0/gtk/gtkversion.h: /usr/include/gtk-2.0/gtk/gtkvolumebutton.h: /usr/include/gtk-2.0/gtk/gtkvpaned.h: /usr/include/gtk-2.0/gtk/gtkvruler.h: /usr/include/gtk-2.0/gtk/gtkvscale.h: /usr/include/gtk-2.0/gtk/gtkvseparator.h: /usr/include/gtk-2.0/gtk/gtktext.h: /usr/include/gtk-2.0/gtk/gtktree.h: /usr/include/gtk-2.0/gtk/gtktreeitem.h: /usr/include/gtk-2.0/gtk/gtkclist.h: /usr/include/gtk-2.0/gtk/gtkcombo.h: /usr/include/gtk-2.0/gtk/gtkctree.h: /usr/include/gtk-2.0/gtk/gtkcurve.h: /usr/include/gtk-2.0/gtk/gtkfilesel.h: /usr/include/gtk-2.0/gtk/gtkgamma.h: /usr/include/gtk-2.0/gtk/gtkinputdialog.h: /usr/include/gtk-2.0/gtk/gtkitemfactory.h: /usr/include/gtk-2.0/gtk/gtklist.h: /usr/include/gtk-2.0/gtk/gtklistitem.h: /usr/include/gtk-2.0/gtk/gtkoldeditable.h: /usr/include/gtk-2.0/gtk/gtkoptionmenu.h: /usr/include/gtk-2.0/gtk/gtkpreview.h: /usr/include/gtk-2.0/gtk/gtktipsquery.h: mtr.h: net.h: /usr/include/netdb.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: mtr-gtk.h: version.h: img/mtr_icon.xpm: mtr-0.85/.deps/getopt.Po0000664000175000017500000000422612162522233014103 0ustar wolffwolffgetopt.o: getopt.c config.h /usr/include/stdio.h /usr/include/features.h \ /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/libio.h \ /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/string.h \ /usr/include/xlocale.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h /usr/include/endian.h \ /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/string3.h config.h: /usr/include/stdio.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/string.h: /usr/include/xlocale.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/string3.h: mtr-0.85/.deps/select.Po0000664000175000017500000001751312162522233014063 0ustar wolffwolffselect.o: select.c config.h /usr/include/x86_64-linux-gnu/sys/types.h \ /usr/include/features.h /usr/include/x86_64-linux-gnu/bits/predefs.h \ /usr/include/x86_64-linux-gnu/sys/cdefs.h \ /usr/include/x86_64-linux-gnu/bits/wordsize.h \ /usr/include/x86_64-linux-gnu/gnu/stubs.h \ /usr/include/x86_64-linux-gnu/gnu/stubs-64.h \ /usr/include/x86_64-linux-gnu/bits/types.h \ /usr/include/x86_64-linux-gnu/bits/typesizes.h /usr/include/time.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h \ /usr/include/endian.h /usr/include/x86_64-linux-gnu/bits/endian.h \ /usr/include/x86_64-linux-gnu/bits/byteswap.h \ /usr/include/x86_64-linux-gnu/sys/select.h \ /usr/include/x86_64-linux-gnu/bits/select.h \ /usr/include/x86_64-linux-gnu/bits/sigset.h \ /usr/include/x86_64-linux-gnu/bits/time.h \ /usr/include/x86_64-linux-gnu/sys/sysmacros.h \ /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h \ /usr/include/x86_64-linux-gnu/sys/time.h /usr/include/stdlib.h \ /usr/include/x86_64-linux-gnu/bits/waitflags.h \ /usr/include/x86_64-linux-gnu/bits/waitstatus.h /usr/include/alloca.h \ /usr/include/x86_64-linux-gnu/bits/stdlib.h /usr/include/stdio.h \ /usr/include/libio.h /usr/include/_G_config.h /usr/include/wchar.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h \ /usr/include/x86_64-linux-gnu/bits/stdio_lim.h \ /usr/include/x86_64-linux-gnu/bits/sys_errlist.h \ /usr/include/x86_64-linux-gnu/bits/stdio.h \ /usr/include/x86_64-linux-gnu/bits/stdio2.h /usr/include/unistd.h \ /usr/include/x86_64-linux-gnu/bits/posix_opt.h \ /usr/include/x86_64-linux-gnu/bits/environments.h \ /usr/include/x86_64-linux-gnu/bits/confname.h getopt.h \ /usr/include/x86_64-linux-gnu/bits/unistd.h /usr/include/xlocale.h \ /usr/include/string.h /usr/include/x86_64-linux-gnu/bits/string.h \ /usr/include/x86_64-linux-gnu/bits/string2.h \ /usr/include/x86_64-linux-gnu/bits/string3.h /usr/include/math.h \ /usr/include/x86_64-linux-gnu/bits/huge_val.h \ /usr/include/x86_64-linux-gnu/bits/huge_valf.h \ /usr/include/x86_64-linux-gnu/bits/huge_vall.h \ /usr/include/x86_64-linux-gnu/bits/inf.h \ /usr/include/x86_64-linux-gnu/bits/nan.h \ /usr/include/x86_64-linux-gnu/bits/mathdef.h \ /usr/include/x86_64-linux-gnu/bits/mathcalls.h \ /usr/include/x86_64-linux-gnu/bits/mathinline.h /usr/include/errno.h \ /usr/include/x86_64-linux-gnu/bits/errno.h /usr/include/linux/errno.h \ /usr/include/x86_64-linux-gnu/asm/errno.h \ /usr/include/asm-generic/errno.h /usr/include/asm-generic/errno-base.h \ mtr.h display.h /usr/include/netinet/in.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h \ /usr/include/stdint.h /usr/include/x86_64-linux-gnu/bits/wchar.h \ /usr/include/x86_64-linux-gnu/sys/socket.h \ /usr/include/x86_64-linux-gnu/sys/uio.h \ /usr/include/x86_64-linux-gnu/bits/uio.h \ /usr/include/x86_64-linux-gnu/bits/socket.h \ /usr/include/x86_64-linux-gnu/bits/sockaddr.h \ /usr/include/x86_64-linux-gnu/asm/socket.h \ /usr/include/asm-generic/socket.h \ /usr/include/x86_64-linux-gnu/asm/sockios.h \ /usr/include/asm-generic/sockios.h \ /usr/include/x86_64-linux-gnu/bits/socket2.h \ /usr/include/x86_64-linux-gnu/bits/in.h dns.h /usr/include/resolv.h \ /usr/include/x86_64-linux-gnu/sys/param.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h \ /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h \ /usr/include/limits.h /usr/include/x86_64-linux-gnu/bits/posix1_lim.h \ /usr/include/x86_64-linux-gnu/bits/local_lim.h \ /usr/include/linux/limits.h \ /usr/include/x86_64-linux-gnu/bits/posix2_lim.h \ /usr/include/linux/param.h /usr/include/x86_64-linux-gnu/asm/param.h \ /usr/include/asm-generic/param.h /usr/include/arpa/nameser.h \ /usr/include/x86_64-linux-gnu/sys/bitypes.h \ /usr/include/arpa/nameser_compat.h net.h /usr/include/netdb.h \ /usr/include/rpc/netdb.h /usr/include/x86_64-linux-gnu/bits/netdb.h \ /usr/include/arpa/inet.h /usr/include/netinet/ip6.h \ /usr/include/inttypes.h /usr/include/netinet/icmp6.h asn.h config.h: /usr/include/x86_64-linux-gnu/sys/types.h: /usr/include/features.h: /usr/include/x86_64-linux-gnu/bits/predefs.h: /usr/include/x86_64-linux-gnu/sys/cdefs.h: /usr/include/x86_64-linux-gnu/bits/wordsize.h: /usr/include/x86_64-linux-gnu/gnu/stubs.h: /usr/include/x86_64-linux-gnu/gnu/stubs-64.h: /usr/include/x86_64-linux-gnu/bits/types.h: /usr/include/x86_64-linux-gnu/bits/typesizes.h: /usr/include/time.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stddef.h: /usr/include/endian.h: /usr/include/x86_64-linux-gnu/bits/endian.h: /usr/include/x86_64-linux-gnu/bits/byteswap.h: /usr/include/x86_64-linux-gnu/sys/select.h: /usr/include/x86_64-linux-gnu/bits/select.h: /usr/include/x86_64-linux-gnu/bits/sigset.h: /usr/include/x86_64-linux-gnu/bits/time.h: /usr/include/x86_64-linux-gnu/sys/sysmacros.h: /usr/include/x86_64-linux-gnu/bits/pthreadtypes.h: /usr/include/x86_64-linux-gnu/sys/time.h: /usr/include/stdlib.h: /usr/include/x86_64-linux-gnu/bits/waitflags.h: /usr/include/x86_64-linux-gnu/bits/waitstatus.h: /usr/include/alloca.h: /usr/include/x86_64-linux-gnu/bits/stdlib.h: /usr/include/stdio.h: /usr/include/libio.h: /usr/include/_G_config.h: /usr/include/wchar.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdarg.h: /usr/include/x86_64-linux-gnu/bits/stdio_lim.h: /usr/include/x86_64-linux-gnu/bits/sys_errlist.h: /usr/include/x86_64-linux-gnu/bits/stdio.h: /usr/include/x86_64-linux-gnu/bits/stdio2.h: /usr/include/unistd.h: /usr/include/x86_64-linux-gnu/bits/posix_opt.h: /usr/include/x86_64-linux-gnu/bits/environments.h: /usr/include/x86_64-linux-gnu/bits/confname.h: getopt.h: /usr/include/x86_64-linux-gnu/bits/unistd.h: /usr/include/xlocale.h: /usr/include/string.h: /usr/include/x86_64-linux-gnu/bits/string.h: /usr/include/x86_64-linux-gnu/bits/string2.h: /usr/include/x86_64-linux-gnu/bits/string3.h: /usr/include/math.h: /usr/include/x86_64-linux-gnu/bits/huge_val.h: /usr/include/x86_64-linux-gnu/bits/huge_valf.h: /usr/include/x86_64-linux-gnu/bits/huge_vall.h: /usr/include/x86_64-linux-gnu/bits/inf.h: /usr/include/x86_64-linux-gnu/bits/nan.h: /usr/include/x86_64-linux-gnu/bits/mathdef.h: /usr/include/x86_64-linux-gnu/bits/mathcalls.h: /usr/include/x86_64-linux-gnu/bits/mathinline.h: /usr/include/errno.h: /usr/include/x86_64-linux-gnu/bits/errno.h: /usr/include/linux/errno.h: /usr/include/x86_64-linux-gnu/asm/errno.h: /usr/include/asm-generic/errno.h: /usr/include/asm-generic/errno-base.h: mtr.h: display.h: /usr/include/netinet/in.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/stdint.h: /usr/include/stdint.h: /usr/include/x86_64-linux-gnu/bits/wchar.h: /usr/include/x86_64-linux-gnu/sys/socket.h: /usr/include/x86_64-linux-gnu/sys/uio.h: /usr/include/x86_64-linux-gnu/bits/uio.h: /usr/include/x86_64-linux-gnu/bits/socket.h: /usr/include/x86_64-linux-gnu/bits/sockaddr.h: /usr/include/x86_64-linux-gnu/asm/socket.h: /usr/include/asm-generic/socket.h: /usr/include/x86_64-linux-gnu/asm/sockios.h: /usr/include/asm-generic/sockios.h: /usr/include/x86_64-linux-gnu/bits/socket2.h: /usr/include/x86_64-linux-gnu/bits/in.h: dns.h: /usr/include/resolv.h: /usr/include/x86_64-linux-gnu/sys/param.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/limits.h: /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include-fixed/syslimits.h: /usr/include/limits.h: /usr/include/x86_64-linux-gnu/bits/posix1_lim.h: /usr/include/x86_64-linux-gnu/bits/local_lim.h: /usr/include/linux/limits.h: /usr/include/x86_64-linux-gnu/bits/posix2_lim.h: /usr/include/linux/param.h: /usr/include/x86_64-linux-gnu/asm/param.h: /usr/include/asm-generic/param.h: /usr/include/arpa/nameser.h: /usr/include/x86_64-linux-gnu/sys/bitypes.h: /usr/include/arpa/nameser_compat.h: net.h: /usr/include/netdb.h: /usr/include/rpc/netdb.h: /usr/include/x86_64-linux-gnu/bits/netdb.h: /usr/include/arpa/inet.h: /usr/include/netinet/ip6.h: /usr/include/inttypes.h: /usr/include/netinet/icmp6.h: asn.h: mtr-0.85/stamp-h10000664000175000017500000000002712162522231012636 0ustar wolffwolfftimestamp for config.h mtr-0.85/dns.c0000664000175000017500000011253312162522624012225 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Non-blocking DNS portion -- Copyright (C) 1998 by Simon Kirby Released under GPL, as above. */ #include #include #include #include #include #include #include #include #include #ifndef __APPLE__ #define BIND_8_COMPAT #endif #include #ifdef HAVE_ARPA_NAMESER_COMPAT_H #include #endif #include #include #include #include #include #include #include #include #include #include #include "mtr.h" #include "dns.h" #include "net.h" #ifdef ENABLE_IPV6 #ifdef __GLIBC__ #define NSCOUNT6 myres._u._ext.nscount6 #define NSSOCKADDR6(i) (myres._u._ext.nsaddrs[i]) #else #define NSCOUNT6 myres.nscount #define NSSOCKADDR6(i) (&(myres._u._ext.ext->nsaddrs[i].sin6)) #endif #endif #ifdef NO_STRERROR extern int sys_nerr; extern char *sys_errlist[]; #define strerror(errno) (((errno) >= 0 && (errno) < sys_nerr) ? sys_errlist[errno] : "unlisted error") #endif #if !HAVE_DECL_ERRNO /* Hmm, it seems Irix requires this */ extern int errno; #endif extern int af; /* Defines */ #undef Debug #undef CorruptCheck #undef WipeFrees #undef WipeMallocs #define BashSize 8192 /* Size of hash tables */ #define BashModulo(x) ((x) & 8191) /* Modulo for hash table size: */ #define HostnameLength 255 /* From RFC */ #define ResRetryDelay1 3 #define ResRetryDelay2 4 #define ResRetryDelay3 5 /* Macros */ #define nonull(s) (s) ? s : nullstring /* Structures */ struct resolve { struct resolve *next; struct resolve *previous; struct resolve *nextid; struct resolve *previousid; struct resolve *nextip; struct resolve *previousip; struct resolve *nexthost; struct resolve *previoushost; float expiretime; /* Fucking HPUX has a problem with "double" here. */ char *hostname; ip_t ip; word id; byte state; }; /* Non-blocking nameserver interface routines */ #define MaxPacketsize (PACKETSZ) #define DomainLength (MAXDNAME) #define OpcodeCount 3 char *opcodes[OpcodeCount+1] = { "standard query", "inverse query", "server status request", "unknown", }; #define ResponsecodeCount 6 char *responsecodes[ResponsecodeCount+1] = { "no error", "format error in query", "server failure", "queried domain name does not exist", "requested query type not implemented", "refused by name server", "unknown error", }; #define ResourcetypeCount 17 char *resourcetypes[ResourcetypeCount+1] = { "unknown type", "A: host address", "NS: authoritative name server", "MD: mail destination (OBSOLETE)", "MF: mail forwarder (OBSOLETE)", "CNAME: name alias", "SOA: authority record", "MB: mailbox domain name (EXPERIMENTAL)", "MG: mail group member (EXPERIMENTAL)", "MR: mail rename domain name (EXPERIMENTAL)", "NULL: NULL RR (EXPERIMENTAL)", "WKS: well known service description", "PTR: domain name pointer", "HINFO: host information", "MINFO: mailbox or mail list information", "MX: mail exchange", "TXT: text string", "unknown type", }; #define ClasstypeCount 5 char *classtypes[ClasstypeCount+1] = { "unknown class", "IN: the Internet", "CS: CSNET (OBSOLETE)", "CH: CHAOS", "HS: Hesoid [Dyer 87]", "unknown class" }; char *rrtypes[] = { "Unknown", "Query", "Answer", "Authority reference", "Resource reference", }; /* Please don't use a trailing comma in enumerations: It doesn't work on all compilers */ enum { RR_UNKNOWN, RR_QUERY, RR_ANSWER, RR_AUTHORITY, RR_RESOURCE }; typedef struct { word id; /* Packet id */ byte databyte_a; /* rd:1 recursion desired * tc:1 truncated message * aa:1 authoritive answer * opcode:4 purpose of message * qr:1 response flag */ byte databyte_b; /* rcode:4 response code * unassigned:2 unassigned bits * pr:1 primary server required (non standard) * ra:1 recursion available */ word qdcount; /* Query record count */ word ancount; /* Answer record count */ word nscount; /* Authority reference record count */ word arcount; /* Resource reference record count */ } packetheader; #ifndef HFIXEDSZ #define HFIXEDSZ (sizeof(packetheader)) #endif /* * Byte order independent macros for packetheader */ #define getheader_rd(x) (x->databyte_a & 1) #define getheader_tc(x) ((x->databyte_a >> 1) & 1) #define getheader_aa(x) ((x->databyte_a >> 2) & 1) #define getheader_opcode(x) ((x->databyte_a >> 3) & 15) #define getheader_qr(x) (x->databyte_a >> 7) #define getheader_rcode(x) (x->databyte_b & 15) #define getheader_pr(x) ((x->databyte_b >> 6) & 1) #define getheader_ra(x) (x->databyte_b >> 7) #if 0 /* The execution order inside an expression is undefined! That means that this might work, but then again, it might not... */ #define sucknetword(x) (((word)*(x) << 8) | (((x)+= 2)[-1])) #define sucknetshort(x) (((short)*(x) << 8) | (((x)+= 2)[-1])) #define sucknetdword(x) (((dword)*(x) << 24) | ((x)[1] << 16) | ((x)[2] << 8) | (((x)+= 4)[-1])) #define sucknetlong(x) (((long)*(x) << 24) | ((x)[1] << 16) | ((x)[2] << 8) | (((x)+= 4)[-1])) #else #define sucknetword(x) ((x)+=2,((word) (((x)[-2] << 8) | ((x)[-1] << 0)))) #define sucknetshort(x) ((x)+=2,((short) (((x)[-2] << 8) | ((x)[-1] << 0)))) #define sucknetdword(x) ((x)+=4,((dword) (((x)[-4] << 24) | ((x)[-3] << 16) | \ ((x)[-2] << 8) | ((x)[-1] << 0)))) #define sucknetlong(x) ((x)+=4,((long) (((x)[-4] << 24) | ((x)[-3] << 16) | \ ((x)[-2] << 8) | ((x)[-1] << 0)))) #endif enum { STATE_FINISHED, STATE_FAILED, STATE_PTRREQ1, STATE_PTRREQ2, STATE_PTRREQ3 }; #define Is_PTR(x) ((x->state == STATE_PTRREQ1) || (x->state == STATE_PTRREQ2) || (x->state == STATE_PTRREQ3)) dword resrecvbuf[(MaxPacketsize + 7) >> 2]; /* MUST BE DWORD ALIGNED */ struct resolve *idbash[BashSize]; struct resolve *ipbash[BashSize]; struct resolve *hostbash[BashSize]; struct resolve *expireresolves = NULL; struct resolve *lastresolve = NULL; struct logline *streamlog = NULL; struct logline *lastlog = NULL; ip_t alignedip; ip_t localhost; #ifdef ENABLE_IPV6 ip_t localhost6; #endif double sweeptime; #ifdef Debug int debug = 1; #else int debug = 0; #endif dword mem = 0; dword res_iplookupsuccess = 0; dword res_reversesuccess = 0; dword res_nxdomain = 0; dword res_nserror = 0; dword res_hostipmismatch = 0; dword res_unknownid = 0; dword res_resend = 0; dword res_timeout = 0; dword resolvecount = 0; long idseed = 0xdeadbeef; long aseed; #ifdef ENABLE_IPV6 struct sockaddr_storage from_sastruct; struct sockaddr_in6 * from6 = (struct sockaddr_in6 *) &from_sastruct; #else struct sockaddr_in from_sastruct; #endif struct sockaddr_in * from4 = (struct sockaddr_in *) &from_sastruct; struct sockaddr * from = (struct sockaddr *) &from_sastruct; int resfd; #ifdef ENABLE_IPV6 int resfd6; #endif socklen_t fromlen = sizeof from_sastruct; char tempstring[16384+1+1]; char sendstring[1024+1]; char namestring[1024+1]; char stackstring[1024+1]; char nullstring[] = ""; int use_dns = 1; #ifdef res_ninit #define MY_RES_INIT() res_ninit(&myres); #define RES_MKQUERY(a, b, c, d, e, f, g, h, i) \ res_nmkquery(&myres, a, b, c, d, e, f, g, h, i) struct __res_state myres; #else #define MY_RES_INIT() res_init(); #define RES_MKQUERY(a, b, c, d, e, f, g, h, i) \ res_mkquery(a, b, c, d, e, f, g, h, i) #define myres _res #endif /* Code */ #ifdef CorruptCheck #define TOT_SLACK 2 #define HEAD_SLACK 1 /* Need an entry for sparc systems here too. Don't try this on Sparc for now. */ #else #ifdef sparc #define TOT_SLACK 2 #define HEAD_SLACK 2 #else #define TOT_SLACK 1 #define HEAD_SLACK 1 #endif #endif void *statmalloc(size_t size) { void *p; size_t mallocsize; mem+= size; mallocsize = size + TOT_SLACK * sizeof(dword); p = malloc(mallocsize); if (!p) { fprintf(stderr,"malloc() of %u bytes failed: %s\n", (unsigned int)size, strerror(errno)); exit(-1); } *((dword *)p) = (dword)size; #ifdef CorruptCheck *(byte *)((char *)p + size + sizeof(dword) + sizeof(byte) * 0) = 0xde; *(byte *)((char *)p + size + sizeof(dword) + sizeof(byte) * 1) = 0xad; *(byte *)((char *)p + size + sizeof(dword) + sizeof(byte) * 2) = 0xbe; *(byte *)((char *)p + size + sizeof(dword) + sizeof(byte) * 3) = 0xef; #endif p = (void *)((dword *)p + HEAD_SLACK); #ifdef WipeMallocs memset(p,0xf0,size); #endif return p; } void statfree(void *p) { if (p) { if (*((dword *)p - HEAD_SLACK) == 0) { fprintf(stderr,"ERROR: Attempt to free pointer twice.\n"); abort(); exit(-1); } else { if (*((dword *)p - HEAD_SLACK) > 8192) { fprintf (stderr,"ERROR: Corrupted free() buffer. (header)\n"); abort(); exit(-1); } #ifdef CorruptCheck if ((*(byte *)((char *)p + (*((dword *)p - 1)) + sizeof(byte) * 0) != 0xde) || (*(byte *)((char *)p + (*((dword *)p - 1)) + sizeof(byte) * 1) != 0xad) || (*(byte *)((char *)p + (*((dword *)p - 1)) + sizeof(byte) * 2) != 0xbe) || (*(byte *)((char *)p + (*((dword *)p - 1)) + sizeof(byte) * 3) != 0xef)) { fprintf(stderr,"ERROR: Corrupted free() buffer. (footer)\n"); abort(); exit(-1); } #endif mem-= *((dword *)p - HEAD_SLACK); #ifdef WipeFrees memset(p,0xfe,*((dword *)p - HEAD_SLACK)); *((dword *)p - 1) = 0; #endif free((dword *)p - HEAD_SLACK); } } } char *strtdiff(char *d,long signeddiff) { dword diff; dword seconds,minutes,hours; long days; if ((diff = labs(signeddiff))) { seconds = diff % 60; diff/= 60; minutes = diff % 60; diff/= 60; hours = diff % 24; days = signeddiff / (60 * 60 * 24); if (days) sprintf(d,"%lid",days); else *d = '\0'; if (hours) sprintf(d + strlen(d),"%luh",hours); if (minutes) sprintf(d + strlen(d),"%lum",minutes); if (seconds) sprintf(d + strlen(d),"%lus",seconds); } else sprintf(d,"0s"); return d; } int issetfd(fd_set *set,int fd) { return (int)((FD_ISSET(fd,set)) && 1); } void setfd(fd_set *set,int fd) { FD_SET(fd,set); } void clearfd(fd_set *set,int fd) { FD_CLR(fd,set); } void clearset(fd_set *set) { FD_ZERO(set); } char *strlongip(ip_t * ip) { #ifdef ENABLE_IPV6 static char addrstr[INET6_ADDRSTRLEN]; return (char *) inet_ntop( af, ip, addrstr, sizeof addrstr ); #else return inet_ntoa( *ip ); #endif } int longipstr( char *s, ip_t *dst, int af ) { #ifdef ENABLE_IPV6 return inet_pton( af, s, dst ); #else return inet_aton( s, dst ); #endif } struct hostent * dns_forward(const char *name) { struct hostent *host; if ((host = gethostbyname(name))) return host; else return NULL; } int dns_waitfd(void) { return resfd; } #ifdef ENABLE_IPV6 int dns_waitfd6(void) { return resfd6; } #endif void dns_open(void) { int option,i; if (!dns) return; MY_RES_INIT(); if (!myres.nscount) { fprintf(stderr,"No nameservers defined.\n"); exit(-1); } myres.options|= RES_RECURSE | RES_DEFNAMES | RES_DNSRCH; resfd = socket(AF_INET, SOCK_DGRAM, 0); if (resfd == -1) { fprintf(stderr, "Unable to allocate IPv4 socket for nameserver communication: %s\n", strerror(errno)); exit(-1); } #ifdef ENABLE_IPV6 resfd6 = socket(AF_INET6, SOCK_DGRAM, 0); if (resfd6 == -1) { fprintf(stderr, "Unable to allocate IPv6 socket for nameserver communication: %s\n", strerror(errno)); exit(-1); } #endif option = 1; if (setsockopt(resfd,SOL_SOCKET,SO_BROADCAST,(char *)&option,sizeof(option))) { fprintf(stderr, "Unable to setsockopt() on IPv4 nameserver communication socket: %s\n", strerror(errno)); exit(-1); } #ifdef ENABLE_IPV6 if (setsockopt(resfd6,SOL_SOCKET,SO_BROADCAST,(char *)&option,sizeof(option))) { fprintf(stderr, "Unable to setsockopt() on IPv6 nameserver communication socket: %s\n", strerror(errno)); exit(-1); } #endif longipstr( "127.0.0.1", &localhost, AF_INET ); #ifdef ENABLE_IPV6 longipstr( "::1", &localhost6, AF_INET6 ); #endif aseed = time(NULL) ^ (time(NULL) << 3) ^ (dword)getpid(); for (i = 0;i < BashSize;i++) { idbash[i] = NULL; hostbash[i] = NULL; } } struct resolve *allocresolve(void) { struct resolve *rp; rp = (struct resolve *)statmalloc(sizeof(struct resolve)); if (!rp) { fprintf(stderr,"statmalloc() failed: %s\n",strerror(errno)); exit(-1); } memset(rp,0, sizeof(struct resolve)); return rp; } dword getidbash(word id) { return (dword)BashModulo(id); } dword getipbash(ip_t * ip) { char *p = (char *) ip; int i, len = 0; dword bashvalue = 0; switch ( af ) { case AF_INET: len = sizeof (struct in_addr); break; #ifdef ENABLE_IPV6 case AF_INET6: len = sizeof (struct in6_addr); break; #endif } for (i = 0; i < len; i++, p++) { bashvalue^= *p; bashvalue+= (*p >> 1) + (bashvalue >> 1); } return BashModulo(bashvalue); } dword gethostbash(char *host) { dword bashvalue = 0; for (;*host;host++) { bashvalue^= *host; bashvalue+= (*host >> 1) + (bashvalue >> 1); } return BashModulo(bashvalue); } void linkresolveid(struct resolve *addrp) { struct resolve *rp; dword bashnum; bashnum = getidbash(addrp->id); rp = idbash[bashnum]; if (rp) { while ((rp->nextid) && (addrp->id > rp->nextid->id)) rp = rp->nextid; while ((rp->previousid) && (addrp->id < rp->previousid->id)) rp = rp->previousid; if (rp->id < addrp->id) { addrp->previousid = rp; addrp->nextid = rp->nextid; if (rp->nextid) rp->nextid->previousid = addrp; rp->nextid = addrp; } else { addrp->previousid = rp->previousid; addrp->nextid = rp; if (rp->previousid) rp->previousid->nextid = addrp; rp->previousid = addrp; } } else addrp->nextid = addrp->previousid = NULL; idbash[bashnum] = addrp; } void unlinkresolveid(struct resolve *rp) { dword bashnum; bashnum = getidbash(rp->id); if (idbash[bashnum] == rp) idbash[bashnum] = (rp->previousid)? rp->previousid : rp->nextid; if (rp->nextid) rp->nextid->previousid = rp->previousid; if (rp->previousid) rp->previousid->nextid = rp->nextid; } void linkresolvehost(struct resolve *addrp) { struct resolve *rp; dword bashnum; bashnum = gethostbash(addrp->hostname); rp = hostbash[bashnum]; if (rp) { while ((rp->nexthost) && (strcasecmp(addrp->hostname,rp->nexthost->hostname) < 0)) rp = rp->nexthost; while ((rp->previoushost) && (strcasecmp(addrp->hostname,rp->previoushost->hostname) > 0)) rp = rp->previoushost; if (strcasecmp(addrp->hostname,rp->hostname) < 0) { addrp->previoushost = rp; addrp->nexthost = rp->nexthost; if (rp->nexthost) rp->nexthost->previoushost = addrp; rp->nexthost = addrp; } else { addrp->previoushost = rp->previoushost; addrp->nexthost = rp; if (rp->previoushost) rp->previoushost->nexthost = addrp; rp->previoushost = addrp; } } else addrp->nexthost = addrp->previoushost = NULL; hostbash[bashnum] = addrp; } void unlinkresolvehost(struct resolve *rp) { dword bashnum; bashnum = gethostbash(rp->hostname); if (hostbash[bashnum] == rp) hostbash[bashnum] = (rp->previoushost)? rp->previoushost : rp->nexthost; if (rp->nexthost) rp->nexthost->previoushost = rp->previoushost; if (rp->previoushost) rp->previoushost->nexthost = rp->nexthost; statfree(rp->hostname); } void linkresolveip(struct resolve *addrp) { struct resolve *rp; dword bashnum; bashnum = getipbash( &(addrp->ip) ); rp = ipbash[bashnum]; if (rp) { while ((rp->nextip) && ( addrcmp( (void *) &(addrp->ip), (void *) &(rp->nextip->ip), af ) > 0 )) rp = rp->nextip; while ((rp->previousip) && ( addrcmp( (void *) &(addrp->ip), (void *) &(rp->previousip->ip), af ) < 0 )) rp = rp->previousip; if ( addrcmp( (void *) &(rp->ip), (void *) &(addrp->ip), af ) < 0 ) { addrp->previousip = rp; addrp->nextip = rp->nextip; if (rp->nextip) rp->nextip->previousip = addrp; rp->nextip = addrp; } else { addrp->previousip = rp->previousip; addrp->nextip = rp; if (rp->previousip) rp->previousip->nextip = addrp; rp->previousip = addrp; } } else addrp->nextip = addrp->previousip = NULL; ipbash[bashnum] = addrp; } void unlinkresolveip(struct resolve *rp) { dword bashnum; bashnum = getipbash( &(rp->ip) ); if (ipbash[bashnum] == rp) ipbash[bashnum] = (rp->previousip)? rp->previousip : rp->nextip; if (rp->nextip) rp->nextip->previousip = rp->previousip; if (rp->previousip) rp->previousip->nextip = rp->nextip; } void linkresolve(struct resolve *rp) { struct resolve *irp; if (expireresolves) { irp = expireresolves; while ((irp->next) && (rp->expiretime >= irp->expiretime)) irp = irp->next; if (rp->expiretime >= irp->expiretime) { rp->next = NULL; rp->previous = irp; irp->next = rp; lastresolve = rp; } else { rp->previous = irp->previous; rp->next = irp; if (irp->previous) irp->previous->next = rp; else expireresolves = rp; irp->previous = rp; } } else { rp->next = NULL; rp->previous = NULL; expireresolves = lastresolve = rp; } resolvecount++; } void lastlinkresolve(struct resolve *rp) { struct resolve *irp; if (lastresolve) { irp = lastresolve; while ((irp->previous) && (rp->expiretime < irp->expiretime)) irp = irp->previous; while ((irp->next) && (rp->expiretime >= irp->expiretime)) irp = irp->next; if (rp->expiretime >= irp->expiretime) { rp->next = NULL; rp->previous = irp; irp->next = rp; lastresolve = rp; } else { rp->previous = irp->previous; rp->next = irp; if (irp->previous) irp->previous->next = rp; else expireresolves = rp; irp->previous = rp; } } else { rp->next = NULL; rp->previous = NULL; expireresolves = lastresolve = rp; } resolvecount++; } void untieresolve(struct resolve *rp) { if (rp->previous) rp->previous->next = rp->next; else expireresolves = rp->next; if (rp->next) rp->next->previous = rp->previous; else lastresolve = rp->previous; resolvecount--; } void unlinkresolve(struct resolve *rp) { untieresolve(rp); unlinkresolveid(rp); unlinkresolveip(rp); if (rp->hostname) unlinkresolvehost(rp); } struct resolve *findid(word id) { struct resolve *rp; int bashnum; bashnum = getidbash(id); rp = idbash[bashnum]; if (rp) { while ((rp->nextid) && (id >= rp->nextid->id)) rp = rp->nextid; while ((rp->previousid) && (id <= rp->previousid->id)) rp = rp->previousid; if (id == rp->id) { idbash[bashnum] = rp; return rp; } else return NULL; } return rp; /* NULL */ } struct resolve *findhost(char *hostname) { struct resolve *rp; int bashnum; bashnum = gethostbash(hostname); rp = hostbash[bashnum]; if (rp) { while ((rp->nexthost) && (strcasecmp(hostname,rp->nexthost->hostname) >= 0)) rp = rp->nexthost; while ((rp->previoushost) && (strcasecmp(hostname,rp->nexthost->hostname) <= 0)) rp = rp->previoushost; if (strcasecmp(hostname,rp->hostname)) return NULL; else { hostbash[bashnum] = rp; return rp; } } return rp; /* NULL */ } struct resolve *findip(ip_t * ip) { struct resolve *rp; dword bashnum; bashnum = getipbash(ip); rp = ipbash[bashnum]; if (rp) { while ((rp->nextip) && ( addrcmp( (void *) ip, (void *) &(rp->nextip->ip), af ) >= 0 )) rp = rp->nextip; while ((rp->previousip) && ( addrcmp( (void *) ip, (void *) &(rp->previousip->ip), af ) <= 0 )) rp = rp->previousip; if ( addrcmp( (void *) ip, (void *) &(rp->ip), af ) == 0 ) { ipbash[bashnum] = rp; return rp; } else return NULL; } return rp; /* NULL */ } void restell(char *s) { fputs(s,stderr); fputs("\r",stderr); } void dorequest(char *s,int type,word id) { packetheader *hp; int r,i; unsigned char buf[MaxPacketsize]; r = RES_MKQUERY(QUERY,s,C_IN,type,NULL,0,NULL,(unsigned char*)buf,MaxPacketsize); if (r == -1) { restell("Resolver error: Query too large."); return; } hp = (packetheader *)buf; hp->id = id; /* htons() deliberately left out (redundant) */ #ifdef ENABLE_IPV6 for (i = 0;i < NSCOUNT6;i++) { if (!NSSOCKADDR6(i)) continue; if (NSSOCKADDR6(i)->sin6_family == AF_INET6) (void)sendto(resfd6,buf,r,0,(struct sockaddr *) NSSOCKADDR6(i), sizeof(struct sockaddr_in6)); } #endif for (i = 0;i < myres.nscount;i++) if (myres.nsaddr_list[i].sin_family == AF_INET) (void)sendto(resfd,buf,r,0,(struct sockaddr *)&myres.nsaddr_list[i], sizeof(struct sockaddr)); } void resendrequest(struct resolve *rp,int type) { if (type == T_A) { dorequest(rp->hostname,type,rp->id); if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Sent reverse authentication request for \"%s\".", rp->hostname); restell(tempstring); } } else if (type == T_PTR) { switch ( af ) { case AF_INET: sprintf(tempstring,"%u.%u.%u.%u.in-addr.arpa", ((byte *)&rp->ip)[3], ((byte *)&rp->ip)[2], ((byte *)&rp->ip)[1], ((byte *)&rp->ip)[0]); break; #ifdef ENABLE_IPV6 case AF_INET6: addr2ip6arpa( &(rp->ip), tempstring ); break; #endif } dorequest(tempstring,type,rp->id); if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Sent domain lookup request for \"%s\".", strlongip( &(rp->ip) )); restell(tempstring); } } } void sendrequest(struct resolve *rp,int type) { do { idseed = (((idseed + idseed) | (long)time(NULL)) + idseed - 0x54bad4a) ^ aseed; aseed^= idseed; rp->id = (word)idseed; } while (findid(rp->id)); linkresolveid(rp); resendrequest(rp,type); } void failrp(struct resolve *rp) { if (rp->state == STATE_FINISHED) return; rp->state = STATE_FAILED; untieresolve(rp); if (debug) restell("Resolver: Lookup failed.\n"); } void passrp(struct resolve *rp,long ttl) { rp->state = STATE_FINISHED; rp->expiretime = sweeptime + (double)ttl; untieresolve(rp); if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Lookup successful: %s\n",rp->hostname); restell(tempstring); } } void parserespacket(byte *s, int l) { struct resolve *rp; packetheader *hp; byte *eob; byte *c; long ttl; int r,usefulanswer; word rr,datatype,class,qdatatype,qclass; byte rdatalength; if (l < (int) sizeof(packetheader)) { restell("Resolver error: Packet smaller than standard header size."); return; } if (l == (int) sizeof(packetheader)) { restell("Resolver error: Packet has empty body."); return; } hp = (packetheader *)s; /* Convert data to host byte order */ /* hp->id does not need to be redundantly byte-order flipped, it is only echoed by nameserver */ rp = findid(hp->id); if (!rp) { res_unknownid++; return; } if ((rp->state == STATE_FINISHED) || (rp->state == STATE_FAILED)) return; hp->qdcount = ntohs(hp->qdcount); hp->ancount = ntohs(hp->ancount); hp->nscount = ntohs(hp->nscount); hp->arcount = ntohs(hp->arcount); if (getheader_tc(hp)) { /* Packet truncated */ restell("Resolver error: Nameserver packet truncated."); return; } if (!getheader_qr(hp)) { /* Not a reply */ restell("Resolver error: Query packet received on nameserver communication socket."); return; } if (getheader_opcode(hp)) { /* Not opcode 0 (standard query) */ restell("Resolver error: Invalid opcode in response packet."); return; } eob = s + l; c = s + HFIXEDSZ; switch (getheader_rcode(hp)) { case NOERROR: if (hp->ancount) { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Received nameserver reply. (qd:%u an:%u ns:%u ar:%u)", hp->qdcount,hp->ancount,hp->nscount,hp->arcount); restell(tempstring); } if (hp->qdcount != 1) { restell("Resolver error: Reply does not contain one query."); return; } if (c > eob) { restell("Resolver error: Reply too short."); return; } switch (rp->state) { /* Construct expected query reply */ case STATE_PTRREQ1: case STATE_PTRREQ2: case STATE_PTRREQ3: switch ( af ) { case AF_INET: sprintf(stackstring,"%u.%u.%u.%u.in-addr.arpa", ((byte *)&rp->ip)[3], ((byte *)&rp->ip)[2], ((byte *)&rp->ip)[1], ((byte *)&rp->ip)[0]); break; #ifdef ENABLE_IPV6 case AF_INET6: addr2ip6arpa( &(rp->ip), stackstring ); break; #endif } } *namestring = '\0'; r = dn_expand(s,s + l,c,namestring,MAXDNAME); if (r == -1) { restell("Resolver error: dn_expand() failed while expanding query domain."); return; } namestring[strlen(stackstring)] = '\0'; if (strcasecmp(stackstring,namestring)) { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Unknown query packet dropped. (\"%s\" does not match \"%s\")", stackstring,namestring); restell(tempstring); } return; } if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Queried domain name: \"%s\"",namestring); restell(tempstring); } c+= r; if (c + 4 > eob) { restell("Resolver error: Query resource record truncated."); return; } qdatatype = sucknetword(c); qclass = sucknetword(c); if (qclass != C_IN) { snprintf(tempstring, sizeof(tempstring), "Resolver error: Received unsupported query class: %u (%s)", qclass,qclass < ClasstypeCount ? classtypes[qclass] : classtypes[ClasstypeCount]); restell(tempstring); } switch (qdatatype) { case T_PTR: if (!Is_PTR(rp)) if (debug) { restell("Resolver warning: Ignoring response with unexpected query type \"PTR\"."); return; } break; default: snprintf(tempstring, sizeof(tempstring), "Resolver error: Received unimplemented query type: %u (%s)", qdatatype,qdatatype < ResourcetypeCount ? resourcetypes[qdatatype] : resourcetypes[ResourcetypeCount]); restell(tempstring); } for (rr = hp->ancount + hp->nscount + hp->arcount;rr;rr--) { if (c > eob) { restell("Resolver error: Packet does not contain all specified resouce records."); return; } *namestring = '\0'; r = dn_expand(s,s + l,c,namestring,MAXDNAME); if (r == -1) { restell("Resolver error: dn_expand() failed while expanding answer domain."); return; } namestring[strlen(stackstring)] = '\0'; if (strcasecmp(stackstring,namestring)) usefulanswer = 0; else usefulanswer = 1; if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: answered domain query: \"%s\"",namestring); restell(tempstring); } c+= r; if (c + 10 > eob) { restell("Resolver error: Resource record truncated."); return; } datatype = sucknetword(c); class = sucknetword(c); ttl = sucknetlong(c); rdatalength = sucknetword(c); if (class != qclass) { snprintf(tempstring, sizeof(tempstring), "query class: %u (%s)",qclass,qclass < ClasstypeCount ? classtypes[qclass] : classtypes[ClasstypeCount]); restell(tempstring); snprintf(tempstring, sizeof(tempstring), "rr class: %u (%s)",class,class < ClasstypeCount ? classtypes[class] : classtypes[ClasstypeCount]); restell(tempstring); restell("Resolver error: Answered class does not match queried class."); return; } if (!rdatalength) { restell("Resolver error: Zero size rdata."); return; } if (c + rdatalength > eob) { restell("Resolver error: Specified rdata length exceeds packet size."); return; } if (datatype == qdatatype || datatype == T_CNAME) { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: TTL: %s",strtdiff(sendstring,ttl)); restell(tempstring); } if (usefulanswer) switch (datatype) { case T_A: if (rdatalength != 4) { snprintf(tempstring, sizeof(tempstring), "Resolver error: Unsupported rdata format for \"A\" type. (%u bytes)", rdatalength); restell(tempstring); return; } if ( addrcmp( (void *) &(rp->ip), (void *) c, af ) == 0 ) { snprintf(tempstring, sizeof(tempstring), "Resolver: Reverse authentication failed: %s != ", strlongip( &(rp->ip) )); addrcpy( (void *) &alignedip, (void *) c, af ); strcat(tempstring,strlongip( &alignedip )); restell(tempstring); res_hostipmismatch++; failrp(rp); } else { snprintf(tempstring, sizeof(tempstring), "Resolver: Reverse authentication complete: %s == \"%s\".", strlongip( &(rp->ip) ),nonull(rp->hostname)); restell(tempstring); res_reversesuccess++; passrp(rp,ttl); return; } break; case T_PTR: case T_CNAME: *namestring = '\0'; r = dn_expand(s,s + l,c,namestring,MAXDNAME); if (r == -1) { restell("Resolver error: dn_expand() failed while expanding domain in rdata."); return; } if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Answered domain: \"%s\"",namestring); restell(tempstring); } if (r > HostnameLength) { restell("Resolver error: Domain name too long."); failrp(rp); return; } if (datatype == T_CNAME) { strcpy(stackstring,namestring); break; } if (!rp->hostname) { rp->hostname = (char *)statmalloc(strlen(namestring) + 1); if (!rp->hostname) { fprintf(stderr,"statmalloc() error: %s\n",strerror(errno)); exit(-1); } strcpy(rp->hostname,namestring); linkresolvehost(rp); passrp(rp,ttl); res_iplookupsuccess++; } break; default: snprintf(tempstring, sizeof(tempstring), "Resolver error: Received unimplemented data type: %u (%s)", datatype,datatype < ResourcetypeCount ? resourcetypes[datatype] : resourcetypes[ResourcetypeCount]); restell(tempstring); } } else { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Ignoring resource type %u. (%s)", datatype,datatype < ResourcetypeCount ? resourcetypes[datatype] : resourcetypes[ResourcetypeCount]); restell(tempstring); } } c+= rdatalength; } } else restell("Resolver error: No error returned but no answers given."); break; case NXDOMAIN: if (debug) restell("Resolver: Host not found."); res_nxdomain++; failrp(rp); break; default: snprintf(tempstring, sizeof(tempstring), "Resolver: Received error response %u. (%s)", getheader_rcode(hp),getheader_rcode(hp) < ResponsecodeCount ? responsecodes[getheader_rcode(hp)] : responsecodes[ResponsecodeCount]); restell(tempstring); res_nserror++; } } void dns_ack(void) { int r,i; r = recvfrom(resfd,(byte *)resrecvbuf,MaxPacketsize,0, from, &fromlen); if (r > 0) { /* Check to see if this server is actually one we sent to */ if ( addrcmp( (void *) &(from4->sin_addr), (void *) &localhost, (int) AF_INET ) == 0 ) { for (i = 0;i < myres.nscount;i++) if ( addrcmp( (void *) &(myres.nsaddr_list[i].sin_addr), (void *) &(from4->sin_addr), (int) AF_INET ) == 0 || addrcmp( (void *) &(myres.nsaddr_list[i].sin_addr), (void *) &unspec_addr, (int) AF_INET ) == 0 ) /* 0.0.0.0 replies as 127.0.0.1 */ break; } else for (i = 0;i < myres.nscount;i++) if ( addrcmp( (void *) &(myres.nsaddr_list[i].sin_addr), (void *) &(from4->sin_addr), AF_INET ) == 0 ) break; if (i == myres.nscount) { snprintf(tempstring, sizeof(tempstring), "Resolver error: Received reply from unknown source: %s", inet_ntoa(from4->sin_addr )); restell(tempstring); } else parserespacket((byte *)resrecvbuf,r); } else { snprintf(tempstring, sizeof(tempstring), "Resolver: Socket error: %s",strerror(errno)); restell(tempstring); } } #ifdef ENABLE_IPV6 void dns_ack6(void) { int r,i; static char addrstr[INET6_ADDRSTRLEN]; r = recvfrom(resfd6,(byte *)resrecvbuf,MaxPacketsize,0, from, &fromlen); if (r > 0) { /* Check to see if this server is actually one we sent to */ if ( addrcmp( (void *) &(from6->sin6_addr), (void *) &localhost6, (int) AF_INET6 ) == 0 ) { for (i = 0;i < NSCOUNT6;i++) { if (!NSSOCKADDR6(i)) continue; if ( addrcmp( (void *) &(NSSOCKADDR6(i)->sin6_addr), (void *) &(from6->sin6_addr), (int) AF_INET6 ) == 0 || addrcmp( (void *) &(NSSOCKADDR6(i)->sin6_addr), (void *) &unspec_addr, (int) AF_INET6 ) == 0 ) /* 0.0.0.0 replies as 127.0.0.1 */ break; } } else for (i = 0;i < NSCOUNT6;i++) { if (!NSSOCKADDR6(i)) continue; if ( addrcmp( (void *) &(NSSOCKADDR6(i)->sin6_addr), (void *) &(from6->sin6_addr), AF_INET6 ) == 0 ) break; } if (i == NSCOUNT6) { snprintf(tempstring, sizeof(tempstring), "Resolver error: Received reply from unknown source: %s", inet_ntop( AF_INET6, &(from6->sin6_addr), addrstr, sizeof addrstr )); restell(tempstring); } else parserespacket((byte *)resrecvbuf,r); } else { snprintf(tempstring, sizeof(tempstring), "Resolver: Socket error: %s",strerror(errno)); restell(tempstring); } } #endif int istime(double x,double *sinterval) { if (x) { if (x > sweeptime) { if (*sinterval > x - sweeptime) *sinterval = x - sweeptime; } else return 1; } return 0; } void dns_events(double *sinterval) { struct resolve *rp,*nextrp; for (rp = expireresolves;(rp) && (sweeptime >= rp->expiretime);rp = nextrp) { nextrp = rp->next; switch (rp->state) { case STATE_FINISHED: /* TTL has expired */ case STATE_FAILED: /* Fake TTL has expired */ if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Cache record for \"%s\" (%s) has expired. (state: %u) Marked for expire at: %g, time: %g.", nonull(rp->hostname), strlongip( &(rp->ip) ), rp->state, rp->expiretime, sweeptime); restell(tempstring); } unlinkresolve(rp); break; case STATE_PTRREQ1: /* First T_PTR send timed out */ resendrequest(rp,T_PTR); restell("Resolver: Send #2 for \"PTR\" query..."); rp->state++; rp->expiretime = sweeptime + ResRetryDelay2; (void)istime(rp->expiretime,sinterval); res_resend++; break; case STATE_PTRREQ2: /* Second T_PTR send timed out */ resendrequest(rp,T_PTR); restell("Resolver: Send #3 for \"PTR\" query..."); rp->state++; rp->expiretime = sweeptime + ResRetryDelay3; (void)istime(rp->expiretime,sinterval); res_resend++; break; case STATE_PTRREQ3: /* Third T_PTR timed out */ restell("Resolver: \"PTR\" query timed out."); failrp(rp); (void)istime(rp->expiretime,sinterval); res_timeout++; break; } } if (expireresolves) (void)istime(expireresolves->expiretime,sinterval); } char *dns_lookup2(ip_t * ip) { struct resolve *rp; if ((rp = findip(ip))) { if ((rp->state == STATE_FINISHED) || (rp->state == STATE_FAILED)) { if ((rp->state == STATE_FINISHED) && (rp->hostname)) { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Used cached record: %s == \"%s\".\n", strlongip(ip),rp->hostname); restell(tempstring); } return rp->hostname; } else { if (debug) { snprintf(tempstring, sizeof(tempstring), "Resolver: Used failed record: %s == ???\n", strlongip(ip)); restell(tempstring); } return NULL; } } return NULL; } if (debug) fprintf(stderr,"Resolver: Added to new record.\n"); rp = allocresolve(); rp->state = STATE_PTRREQ1; rp->expiretime = sweeptime + ResRetryDelay1; addrcpy( (void *) &(rp->ip), (void *) ip, af ); linkresolve(rp); addrcpy( (void *) &(rp->ip), (void *) ip, af ); linkresolveip(rp); sendrequest(rp,T_PTR); return NULL; } char *dns_lookup(ip_t * ip) { char *t; if (!dns) return NULL; t = dns_lookup2(ip); return (t && use_dns) ? t : NULL; } #ifdef ENABLE_IPV6 /* Returns an ip6.arpa character string. */ void addr2ip6arpa( ip_t * ip, char * buf ) { unsigned char * p = (unsigned char *) ip; char * b = buf; int i; for ( i = sizeof (struct in6_addr) - 1; i >= 0; i-- ) { sprintf( b, "%x.%x.", p[i] % 16, p[i] >> 4 ); b += 4; } sprintf( b, "ip6.arpa" ); return; } #endif /* Resolve an IP address to a hostname. */ struct hostent *addr2host( const char *addr, int af ) { int len = 0; switch ( af ) { case AF_INET: len = sizeof( struct in_addr ); break; #ifdef ENABLE_IPV6 case AF_INET6: len = sizeof( struct in6_addr ); break; #endif } return gethostbyaddr( addr, len, af ); } mtr-0.85/display.c0000664000175000017500000001040712144202516013076 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include "mtr.h" #include "display.h" #include "mtr-curses.h" #include "mtr-gtk.h" #include "report.h" #include "select.h" #include "raw.h" #include "dns.h" #ifndef NO_IPINFO #include #endif extern int DisplayMode; #ifdef NO_CURSES #define mtr_curses_open() #define mtr_curses_close() #define mtr_curses_redraw() #define mtr_curses_keyaction() #define mtr_curses_clear() #else #include "mtr-curses.h" #endif #ifdef NO_GTK #define gtk_open() #define gtk_close() #define gtk_redraw() #define gtk_keyaction() 0 #define gtk_loop() {fprintf (stderr, "No GTK support. Sorry.\n"); exit (1); } #else #include "mtr-gtk.h" #endif #ifdef NO_SPLIT #define split_open() #define split_close() #define split_redraw() #define split_keyaction() 0 #else #include "split.h" #endif void display_detect(int *argc, char ***argv) { DisplayMode = DisplayReport; #ifndef NO_CURSES DisplayMode = DisplayCurses; #endif #ifndef NO_GTK if(gtk_detect(argc, argv)) { DisplayMode = DisplayGTK; } #endif } void display_open(void) { switch(DisplayMode) { case DisplayReport: report_open(); break; case DisplayTXT: txt_open(); break; case DisplayXML: xml_open(); break; case DisplayCSV: csv_open(); break; case DisplayCurses: mtr_curses_open(); #ifndef NO_IPINFO if (ipinfo_no >= 0) asn_open(); #endif break; case DisplaySplit: split_open(); break; case DisplayGTK: gtk_open(); break; } } void display_close(time_t now) { switch(DisplayMode) { case DisplayReport: report_close(); break; case DisplayTXT: txt_close(); break; case DisplayXML: xml_close(); break; case DisplayCSV: csv_close(now); break; case DisplayCurses: #ifndef NO_IPINFO if (ipinfo_no >= 0) asn_close(); #endif mtr_curses_close(); break; case DisplaySplit: split_close(); break; case DisplayGTK: gtk_close(); break; } } void display_redraw(void) { switch(DisplayMode) { case DisplayCurses: mtr_curses_redraw(); break; case DisplaySplit: split_redraw(); break; case DisplayGTK: gtk_redraw(); break; } } int display_keyaction(void) { switch(DisplayMode) { case DisplayCurses: return mtr_curses_keyaction(); case DisplaySplit: return split_keyaction(); case DisplayGTK: return gtk_keyaction(); } return 0; } void display_rawping(int host, int msec) { switch(DisplayMode) { case DisplayReport: case DisplayTXT: case DisplayXML: case DisplayCSV: case DisplaySplit: case DisplayCurses: case DisplayGTK: break; case DisplayRaw: raw_rawping (host, msec); break; } } void display_rawhost(int host, ip_t *ip_addr) { switch(DisplayMode) { case DisplayReport: case DisplayTXT: case DisplayXML: case DisplayCSV: case DisplaySplit: case DisplayCurses: case DisplayGTK: break; case DisplayRaw: raw_rawhost (host, ip_addr); break; } } void display_loop(void) { switch(DisplayMode) { case DisplayReport: case DisplayTXT: case DisplayXML: case DisplayCSV: case DisplaySplit: case DisplayCurses: case DisplayRaw: select_loop(); break; case DisplayGTK: gtk_loop(); break; } } void display_clear(void) { switch(DisplayMode) { case DisplayCurses: mtr_curses_clear(); break; case DisplayReport: case DisplayTXT: case DisplayXML: case DisplayCSV: case DisplaySplit: case DisplayRaw: break; case DisplayGTK: break; } } mtr-0.85/getopt1.o0000664000175000017500000001051012162522233013024 0ustar wolffwolffELF>X@@ int^Ž^ƒÔBØbW#}#}#}#}# }#(}#0}#8}#@}#H}#P }#X" #`$¦#h&W#p*W#t,e#x04#€1I#‚2¬#ƒ6¼#ˆ?p#H{#˜I{# J{#¨K{#°LŠ#¸NW#ÀPÂ#Ä ´ º  » # ¼¦# ÀW#i• ƒ¼ Bb ƒÒ B¥¦¦¦¥¦¦¦% $ > $ > : ; I  I : ; : ;I8 : ;  : ;  : ; I8 I !I/ 4: ; I? < ¢œû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/includetypes.hstddef.hlibio.hstdio.h_IO_buf_end_old_offsetgetopt1.c_IO_save_endshort intsize_t_offset_IO_write_ptr_flags/home/wolff/mtr_IO_buf_base_markers_IO_read_end_locklong int_cur_column_pos_sbuf_IO_FILEunsigned charsigned charunsigned int_IO_marker_shortbuf__pad2_IO_write_base_unused2_IO_read_ptrshort unsigned intchar_next__pad1GNU C 4.6.1__pad3__pad4__pad5long unsigned int_IO_write_end__off64_t__off_t_chain_IO_backup_basestdin_flags2_mode_IO_read_base_vtable_offset_IO_save_base_filenostdout_IO_lock_tGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1.symtab.strtab.shstrtab.text.data.bss.rela.debug_info.debug_abbrev.debug_line.debug_str.comment.note.GNU-stack@!@'@1@,ð X =G±Kø¦W0žb0­+kØØ{Ø   à ñÿ  getopt1.c  L  ]!) 0 ¿7 '> ÙE mL ÍS /a –f —q † :‹ 9– ¶£ V² Á ƒÐ Êß î Hý   m * ç9 ¦H "W zf Ÿu õ„ ¼“  ¢ Ÿ² ØÂ ñÒ â @ò E û X" _2 fB ÄR c j æv ?„ °’ «Ó ¶à ýí ¶ú ýmtr-0.85/mtr-gtk.h0000664000175000017500000000161612104140215013016 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for gtk.c */ int gtk_detect(int *argc, char ***argv); void gtk_open(void); void gtk_close(void); void gtk_redraw(void); int gtk_keyaction(void); void gtk_loop(void); mtr-0.85/select.c0000664000175000017500000001264712137535115012726 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #include #include #include #include #include #include "mtr.h" #include "display.h" #include "dns.h" #include "net.h" #ifndef NO_IPINFO #include "asn.h" #endif extern int Interactive; extern int MaxPing; extern int ForceMaxPing; extern float WaitTime; double dnsinterval; extern int mtrtype; static struct timeval intervaltime; int display_offset = 0; void select_loop(void) { fd_set readfd; fd_set writefd; int anyset = 0; int maxfd = 0; int dnsfd, netfd; #ifdef ENABLE_IPV6 int dnsfd6; #endif int NumPing = 0; int paused = 0; struct timeval lasttime, thistime, selecttime; int dt; int rv; gettimeofday(&lasttime, NULL); while(1) { dt = calc_deltatime (WaitTime); intervaltime.tv_sec = dt / 1000000; intervaltime.tv_usec = dt % 1000000; FD_ZERO(&readfd); FD_ZERO(&writefd); maxfd = 0; if(Interactive) { FD_SET(0, &readfd); maxfd = 1; } #ifdef ENABLE_IPV6 if (dns) { dnsfd6 = dns_waitfd6(); FD_SET(dnsfd6, &readfd); if(dnsfd6 >= maxfd) maxfd = dnsfd6 + 1; } else dnsfd6 = 0; #endif if (dns) { dnsfd = dns_waitfd(); FD_SET(dnsfd, &readfd); if(dnsfd >= maxfd) maxfd = dnsfd + 1; } else dnsfd = 0; netfd = net_waitfd(); FD_SET(netfd, &readfd); if(netfd >= maxfd) maxfd = netfd + 1; if (mtrtype == IPPROTO_TCP) net_add_fds(&writefd, &maxfd); do { if(anyset || paused) { selecttime.tv_sec = 0; selecttime.tv_usec = 0; rv = select(maxfd, (void *)&readfd, &writefd, NULL, &selecttime); } else { if(Interactive) display_redraw(); gettimeofday(&thistime, NULL); if(thistime.tv_sec > lasttime.tv_sec + intervaltime.tv_sec || (thistime.tv_sec == lasttime.tv_sec + intervaltime.tv_sec && thistime.tv_usec >= lasttime.tv_usec + intervaltime.tv_usec)) { lasttime = thistime; if(NumPing >= MaxPing && (!Interactive || ForceMaxPing)) return; if (net_send_batch()) NumPing++; } selecttime.tv_usec = (thistime.tv_usec - lasttime.tv_usec); selecttime.tv_sec = (thistime.tv_sec - lasttime.tv_sec); if (selecttime.tv_usec < 0) { --selecttime.tv_sec; selecttime.tv_usec += 1000000; } selecttime.tv_usec = intervaltime.tv_usec - selecttime.tv_usec; selecttime.tv_sec = intervaltime.tv_sec - selecttime.tv_sec; if (selecttime.tv_usec < 0) { --selecttime.tv_sec; selecttime.tv_usec += 1000000; } if (dns) { if ((selecttime.tv_sec > (time_t)dnsinterval) || ((selecttime.tv_sec == (time_t)dnsinterval) && (selecttime.tv_usec > ((time_t)(dnsinterval * 1000000) % 1000000)))) { selecttime.tv_sec = (time_t)dnsinterval; selecttime.tv_usec = (time_t)(dnsinterval * 1000000) % 1000000; } } rv = select(maxfd, (void *)&readfd, NULL, NULL, &selecttime); } } while ((rv < 0) && (errno == EINTR)); if (rv < 0) { perror ("Select failed"); exit (1); } anyset = 0; /* Have we got new packets back? */ if(FD_ISSET(netfd, &readfd)) { net_process_return(); anyset = 1; } if (dns) { /* Handle any pending resolver events */ dnsinterval = WaitTime; dns_events(&dnsinterval); } /* Have we finished a nameservice lookup? */ #ifdef ENABLE_IPV6 if(dns && FD_ISSET(dnsfd6, &readfd)) { dns_ack6(); anyset = 1; } #endif if(dns && FD_ISSET(dnsfd, &readfd)) { dns_ack(); anyset = 1; } /* Has a key been pressed? */ if(FD_ISSET(0, &readfd)) { switch (display_keyaction()) { case ActionQuit: return; break; case ActionReset: net_reset(); break; case ActionDisplay: display_mode = (display_mode+1) % 3; break; case ActionClear: display_clear(); break; case ActionPause: paused=1; break; case ActionResume: paused=0; break; case ActionMPLS: enablempls = !enablempls; display_clear(); break; case ActionDNS: if (dns) { use_dns = !use_dns; display_clear(); } break; #ifndef NO_IPINFO case ActionII: if (ipinfo_no >= 0) { ipinfo_no++; if (ipinfo_no > ipinfo_max) ipinfo_no = 0; } break; case ActionAS: if (ipinfo_no >= 0) ipinfo_no = ipinfo_no?0:ipinfo_max; break; #endif case ActionScrollDown: display_offset += 5; break; case ActionScrollUp: display_offset -= 5; if (display_offset < 0) { display_offset = 0; } break; } anyset = 1; } /* Check for activity on open sockets */ if (mtrtype == IPPROTO_TCP) net_process_fds(&writefd); } return; } mtr-0.85/gtk.o0000664000175000017500000034124012162522442012237 0ustar wolffwolffELF>øä@@Hƒìè¸HƒÄÃffff.„SH‰óH‰ÎH‰×L‰ÂA¸ÿÿÿÿHƒì`dH‹%(H‰D$X1ÀHL$ èóD$ H|$¹º@¾¸ZÀèHT$1É1À¾H‰ßèH‹D$XdH3%(uHƒÄ`[Ãè€SH‰óH‰ÎH‰×L‰ÂA¸ÿÿÿÿHƒì`dH‹%(H‰D$X1ÀHL$ èóD$ H|$¹º@¾¸ZÀèHT$1É1À¾H‰ßèH‹D$XdH3%(uHƒÄ`[Ãè€H옾¹*H|$@óH¥èH‹=H‰ÆèHT$@H‰ÇA¹1ÀA¸¹H‰T$¾ºHÇD$8HÇD$0HÇD$(HÇD$ HÇD$HÇD$HÇ$è¸HĘÃf„Hƒìè1ÀHƒÄÃH‰l$ØL‰l$èE1íH‰\$ÐL‰d$àH‰õL‰t$ðL‰|$øHƒìhƒ>t+D‰èH‹\$8H‹l$@L‹d$HL‹l$PL‹t$XL‹|$`HƒÄhÃDƒ~4uÏòF òNòD,àò,ÙèH‹=H‰ÆI‰ÆèHL$(E1ÉE1ÀH‰ÇHÇ$D‰â‰Þè…ÀtH‹\$(H‹=L‰öè1Ò1ÉH‰ÞH‰Çèè¿I‰Æè¿H‰ÃèI‰ÄèL‰÷H‰ÆI‰ÅèH‰ÞH‰ÇèL‰îL‰÷èL‰æH‰ÇèH‹L$(H‰L$èH‰ßH‰ÆI‰ÇèH‹L$E1ÉE1Àº¾H‰ÇèH‹L$(L‰þL‰çH‰L$èH‹L$E1ÉE1Àº¾H‰ÇèH‰ßèL‰çè‹]L‰îL‰÷èE1ÉE1À1É1Ò1öH‰Ç‰$A½èé\þÿÿffffff.„USH‰ûHƒìèH‰ßH‰ÆH‰ÅèH‰ÇèH‰ÇèH…Àt/H‰ÇèèH‹=H‰Æè1öH‰ÇèHƒÄ1À[]ÃH‰îH‰ßèH‰ÇèH‰Çè‰D$ èH‹=H‰Æè¾H‰ÇèèH‰ßH‰ÆèHL$ H‰Çºÿÿÿÿ¾èHƒÄ1À[]ÃHƒìóè¿ÓMb‰Á¾÷ïÁù‰×1ÒÁÿ)Ïè‰HƒÄÃDHƒì‹…ÀuèÇHƒÄÃfffff.„Hƒì¿èH…À•ÀHƒÄ¶ÀÃ@SH‰ûèI‰Ø1É1Ò[H‰Æ1ÿéDAWAVAUATUH‰ý¿SHƒìèI‰ÅèH‰ïH‰ÆH‰ÃèE1À1É1ÒL‰îH‰ÇèèL‰ïH‰ÆI‰ÄèE1ÉE1À1ɺ¾H‰Çè¿èH‰ÞI‰ÅH‰ïèE1À1É1ÒL‰îH‰ÇèL‰ïL‰æèE1ÉE1À1ɺ¾H‰Çè¿èH‰ÞI‰ÅH‰ïè1É1ÒE1ÀL‰îH‰ÇèL‰ïL‰æèE1ɺE1À¾1ÉH‰Çè¿èH‰ÞI‰ÅH‰ïH‰èE1À1É1ÒH‰ÇL‰îèH‹=L‰æèE1ÉE1À1ɺ¾H‰Çèè…Àò uò ófWíò%ZÀòòèò¾H‰ÇI‰ÆèI‰ÅèL‰ïH‰Æè¾H‰ÇèH‰ÞH‰ïèE1À1É1ÒL‰îH‰ÇèL‰æL‰÷èE1ÉE1ÀL‰éº¾H‰Çè¿èH‰ÞI‰ÅH‰ïèE1À1É1ÒL‰îH‰ÇèèL‹5I‰ÇH‰èL‰ÿH‰ÆèL‰öH‰ÇèH‹=L‰æèE1ÉE1À1ɺ¾H‰ÇèL‹%H‰ÞH‰ïèE1À¹ºL‰æH‰ÇèH‹èL‰ïH‰ÆèHƒÄH‰ÞH‰Ç[]A\A]A^A_éf.„ATA¹A¸¹º8¾@U¿ 1ÀSHƒì0HÇD$ @HÇD$8HÇD$HÇD$HÇ$èH‰ÃH‰èH‰ßH‰ÆèH‰ÇèH‰ÃH‰èH‰ßH‰ÆèE1ÉE1À1ɺ¾H‰Çèè1ÉA¹ A¸ºH‰Æ¿1ÀHÇ$è¾H‰ÅH‰ÇèH‰ï¾èèH‹=H‰ÆH‰ÃèH‰îH‰Çèè¾PH‰ÇH‰Åèò1ÒH‰Ç¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾I‰ÄH‰ÇèE1À¹ºH‰îL‰çèH‹=H‰ÞèL‰æH‰Çèè¾PH‰ÇH‰Åèò1ÒH‰Ç¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾H‰ÇH‰ÅèH‹=H‰ÞèH‰îH‰Çèè¾PH‰ÇH‰Åèò1ÒH‰Ç¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾H‰ÇH‰ÅèH‹=H‰ÞèH‰îH‰Çèè¾PH‰ÇH‰Åèò1ÒH‰Ç¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾H‰ÇH‰ÅèH‹=H‰ÞèH‰îH‰Çèè¾PH‰ÇH‰Åèò1ÒH‰Ç¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾H‰ÇH‰ÅèH‹=H‰ÞèH‰îH‰Çèè¾PH‰ÇH‰ÅèòH‰Ç1Ò¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾H‰ÇH‰ÅèH‹=H‰ÞèH‰îH‰Çèè¾PH‰ÇH‰ÅèòH‰Ç1Ò¾¸èA¹ A¸¹ºH‰î¿1ÀHÇ$è¾I‰ÄH‰ÇèH‰îL‰çE1À¹ºèH‹=H‰ÞèHƒÄ0L‰æH‰Ç[]A\éAW¹AVAUATUH‰õS‰ûHìÈdH‹%(H‰„$¸1ÀH¼$¸HÇ„$°???L¤$°óH«‰ß苾H‰ÇI‰Åè…À…Ɖß躅À¸HDЉßH‰”$ˆè‰ß‰„$è‰ß‰„$˜è‰ßA‰Çè‰ßA‰Æè‰ßA‰Åè‰ß‰„$ è‰ß‰„$¨èD‹Œ$ò*Àò‹Œ$˜H‹”$ˆ¿ÓMbD‹„$ òA*É‹´$¨‰ÈÁùA¹H‰T$hD‰D$A¸÷ïD‰øAÁÿ‰4$H‰îÇD$pÿÿÿÿÇD$` ÇD$XÁúÇD$HÇD$8)ÊL‰áÇD$(ò^‰T$PÇD$÷ïD‰ðAÁþÇD$ÁúD)ú‰T$@÷ïD‰èAÁýÁúD)ò‰T$0÷ïH‹=¸Áúò^ÊD)ê‰T$ 1ÒfÀfÉfZÀfZÉÀÉZÀZÉèH‹„$¸dH3%(…HÄÈ[]A\A]A^A_ÃfDL‰ïèH…ÀI‰ÄtX‹…À„þÿÿL‰ïèH¼$°H‰$M‰áA¸¹º¾1ÀL¤$°èéÜýÿÿf.„L‰ïèI‰ÄéÂýÿÿèff.„AUATUSHƒì(è‰Åè‰ÃèH‹=H‰ÆI‰ÅèH‰æH‰ÇèfD…Àt39Ý~x‰ßH‰æDcèH‹=L‰îD‰ãèH‰æH‰Çè…ÀuÍ9ÝDë+fDD‰ãH‹=H‰æDcèH‰æ‰ßèA9ìuÛHƒÄ([]A\A]ÄH‹=H‰æèélÿÿÿfff.„Hƒìèè¸HƒÄÄHƒìèè¸HƒÄÄHƒìèèè‹=èè¸HƒÄÃSH‰óèH‰ßH‰ÆèH‰ÇèfÀ‹=fZÀóèèè1À[Ãff.„Hƒì‹ …Éu2‹=è‹1À…Ò”À‰è1ÀHƒÄÄèëÒf„Hƒìèè1ÀHƒÄÃff.„H‰\$ÐH‰l$ØH‰ûL‰d$àL‰l$èL‰t$ðL‰|$øHƒì8èH‰ßH‰ÆH‰Åè¾H‰ÇèH‰îH‰ß躾ŠH‰ÇèèH‰ßH‰ÆI‰Äè¾ H‰Çè1ÿ¾ è¾ 1ÿI‰ÅèH‰ÇH‰ÅèèL‰ïH‰ÆI‰ÆèE1À1É1ÒH‰îH‰Çèè1ö1ÿèH‰ÅèH‰ïH‰ÆI‰ÇèºH‰Ç¾èL‰þH‰ïè¾H‰ÇèL‹=L‰æH‰ïèH‰ÇL‰þèL‰öL‰ïèH‰îH‰ÇE1À¹ºèL‰æH‰ßèL‰îH‹\$H‹l$L‹d$L‹l$ H‰ÇL‹t$(L‹|$0HƒÄ8éffff.„SHƒì Ht$H$H|$ÇD$HÇ$H‰D$HÇD$è¿èH‰Çè1ÿè¿H‰èH‹=èèH‹=H‰ÆH‰ÃèE1ÉE1À1ɺ¾H‰ÇèH‹=H‰ÞèE1ÉE1À1ɺ¾H‰ÇèH‹=èHƒÄ [ÄóÃfffff.„1ÀÃffff.„Hƒìèè‰Çè1ɺ¾H‰Çèè‰Çè1ɺ¾H‰Çèè‰Çè1ɺ¾H‰ÇèHƒÄéfffff.„USH‰ûHƒì8HÇD$(èH‹=H‰ÆH‰ÅèH‰ÚH‰æH‰Çè…Àt)H‹=H‰îèHL$(H‰ÇA¸ÿÿÿÿ1ÒH‰æ1ÀèH‰ßèH‹D$(HƒÄ8[]ÄSH‰÷èH…ÀH‰Ãt<¿EèºÿÿÿÿH‰ÞH‰Çè¿èºÿÿÿÿH‰ÇH‰ÞèH‰ßè¸[Ãfff.„SH‰÷èH…ÀH‰Ãt5èH‹=H‰ÆèH‰ÞH‰ÇèH‹=1öèH‰ßè¸[Ã%.1f%%text%.2fwebsitecopyright0.85versionlicensecommentsauthorshttp://www.bitwizard.nl/mtr/Juha TakalaDavid Sward David Stone Andrew StesinGreg Stark Aaron Scarisbrick,Davin Milun Anand KumriaSimon KirbyChristophe KaltRob Foehl Mircea DamianCougar Brian CaseyCopy to clipboardSet as new destinationactivate: not foundDISPLAYgtk-quitclickedgtk-about_Restart_Pausevalue_changed_Hostname:button_press_eventforegroundHostnamexalignLossSntLastAvgBestWorstStDevblackred%s (%s)My traceroutedelete_eventdestroy48 48 131 2 c #000000. c #020204+ c #3E7E3C@ c #62BA64# c #4E9E4C$ c #628664% c #6EDA6C& c #7A9E7C* c #468E44= c #6ACA6C- c #224224; c #56AE54> c #326234, c #567E54' c #7ABA7C) c #3A723C! c #629E64~ c #428644{ c #6E926C] c #7AEA7C^ c #4A964C/ c #62C264( c #52A654_ c #4A7E4C: c #82AE84< c #366A34[ c #5AB65C} c #4A764C| c #6AD26C1 c #8EC68C2 c #7A9A7C3 c #7AE27C4 c #82A6845 c #568E546 c #5686547 c #3E7A3C8 c #6AC26C9 c #3E6A3C0 c #468244a c #56A254b c #4E8E4Cc c #5EAE5Cd c #86C684e c #427244f c #62A664g c #769A74h c #82F284i c #5A9A5Cj c #5AA65Ck c #428244l c #66BE64m c #6A8E6Cn c #76DA74o c #7E9E7Cp c #2A522Cq c #5E825Cr c #82BE84s c #669E64t c #6E966Cu c #529A54v c #62C664w c #4A824Cx c #366E34y c #72D674z c #427E3CA c #5EBE5CB c #52A254C c #628A64D c #4A924CE c #6ACE6CF c #5AB25CG c #326634H c #568254I c #7ABE7CJ c #3A763CK c #468A44L c #7EEE7CM c #4E9A4CN c #56AA54O c #86B684P c #62B664Q c #162A14R c #529E54S c #72DA74T c #76A274U c #4A8E4CV c #264A24W c #5AAE5CX c #5EA25CY c #468644Z c #729274` c #7EEA7C . c #4E964C.. c #66C264+. c #56A654@. c #4E7E4C#. c #8AB28C$. c #3A6A3C%. c #5EB65C&. c #527A54*. c #6ED26C=. c #92C694-. c #7E9A7C;. c #7AE67C>. c #86AA84,. c #5E865C'. c #6AC66C). c #3E6E3C!. c #5AA25C~. c #4E924C{. c #5EB25C]. c #467244^. c #86F284/. c #5AAA5C(. c #76DE74_. c #829E84:. c #325E34<. c #66A264[. c #729674}. c #66C664|. c #4E824C1. c #3A6E3C2. c #76D6743. c #427E444. c #62BE645. c #668A646. c #6ECE6C7. c #3666348. c #5A825C9. c #7EBE7C0. c #3E763CCopyright © 1997,1998 Matt KimballThis program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details.The 'traceroute' and 'ping' programs in a single network diagnostic tool.Matt Kimball Roger Wolff Bohdan Vlasyuk Evgeniy Tretyak John Thacker Robert Sparks Mike Simons Craig Milo Rogers Antonio Querubin Russell Nelson Josh Martin Alexander V. Lukyanov Charles Levert Bertrand Leconte Olav Kvittem Adam Kramer Philip Kizer Steve Kann Brett Johnson Roland Illig Damian Gryski Travis Cross Andrew Brown Bill Bogstad Marc Bejarano Moritz Barsnick Thomas Klausner G 7.G G G G G 7.G < z . .* k 1.G G G G G G 0.K x 7.7.7.7.7.< J Y D M D ) 7.7.7.7.7.7.< 7.7.7.7.7.G 7.> > > 7.G ) D M K 7 < > > > > > > > > + * < G G G G G G 7.G x k * M K x G G G G G G G G G G G 7.G > > < ~ M D + G > > G > > 7.7.7.7.> 7 D x 7.7.7.7.7.G 7.7.G < ) ~ D M 7 7.7.7.7.7.7.7.7.7.7.G > 7.< * M ~ x > G > G > > 7.> > > > G 7 * 1.G G G G G 7.G G 7.G G G J * M ~ < G G G G G G > G G > x D M k < G > G > > G > > G G G > 7.7 * x 7.7.7.7.G 7.7.G 7.7.7.7.G x ~ # Y < 7.7.7.7.7.G > > x ^ .0.G G G 7.> > > > > G > > > 7.> 7 U 1.G G G G 7.G G 7.G G G G 7.G < k # K < G G G G G G < .^ J G G 7.G 7.> G > > > > 7.7.> 7.7.7 * x 7.7.7.G 7.7.G 7.7.7.7.G 7.G G 7.+ B ~ < 7.7.7.> < D M 7 G > > > G > G > > G > 7.> > G > > + U 1.G G G 7.G G 7.G G G G 7.G 7.7.G < k B + < G G G k # k < 7.7.G > G > > G > > > > G x k .R F A N R U 7 x 7.G 7.7.7.7.G 7.G G 7.G G < K # J $.8.) ( K < > > G G 7.G G > > > G G + M +.B M D B W ^ ^ # ( +.^ ) G G G G 7.G 7.7.G 7.7.7.x u ! & o ^ .x > > > > G 7.7.G > > > 0. .+.M K + ) < + D ) < J k * R +.D x 7.G 7.G G 7.G G G 7.e T =.& H +.+ < G G G 7.G > G G > G ~ ( B ~ ) G > G > 7 U < 7.7.G < J * B B 7 7.G 7.7.G 7.7.9 5.o Z s a ) D x > > > > > G > G G < K ( D 0.> G 7.> G 7.+ * < G 7.7.G G < + # ( + G G 7.G $.,.2 [.$ ).0.( k 7 7.G G G G 7.G G > 7.K +.K x > G > > G > > 7 D < 7.G G 7.7.G 7.) M +.7 7.< &.[.2 C &.7.7.7.* B x 7.> > > > > 7.7.G k +.* < > > > G > 7.G G 7 * < 7.7.G G 7.G G G ) M B &.[.o m &.7.G 7.G 7.) %.7.G 7.7.7.G 7.G G x B ^ ) > G > 7.> 7.> > > + D 7.G G 7.7.G 7.7.7.< w r #.{ , 9 7.7.7.G 7.G < ( > G G > 7.G > 7.7.* ( 7 G > > > > > G 7.1.z B F D 7 < G 7.G G G $.q o : I _ < > G G 7.G 7.G 7.~ 7.7.> G > 7.7.> x +.* 7.> > G > G G < k # # +.[ B N ( k G 7.$.&.2 2 C |.B D < 7.7.7.G 7.G 7.G < > 7.> G > G G > ~ +.+ > > > > > > < K R K + K M 3.K B W K } Z -.m &.< < Y W ) G G 7.G 7.G 7.G 7.> G G > > > 7.G # ^ ) > G > G > 7.~ # + < > 7 * < G J j d 4 { , $.G 7.G 7 F + 7.7.G 7.G 7.G 7.G > > > G G > 7.7.N * 7.> > > > > J D Y > G 7.3.D < ).$ 4 1 ' e 7.7.G G G ) # D < G G 7.G 7.G 7.7.> 7.G > > G > x +.Y G > G > G > Y ~.x G > > 7 ~.8.-.2 5.i A 7 G G 7.7.7.< D # x 7.7.G 7.G 7.G G < < x x < x x + ; * x x x x x ) ^ .1.) 1.) 5 r o t 6 0.K A D J ) ) ) J 7 .F k 7 7 7 7 J 0.0.x D D * * D U U # A ( * * * K * * N W U U * K X 9.<.D K K R ..N U * * * * U ( A D K K K K U * K ) 7 z z 7 7 z 7 K {.M 7 7 7 0.0.7 # B J 7 7 7 U R 0.7 7 7 D / D 0.0.7 0.J 7 .F + 0.J 0.J 0.J 0.< G > > > G > G < N K 7.> > G G > ~ D 1.G > > 3.U G G G G * A J G G G G 7.x D # x G 7.G 7.G 7.G G G G G > G > G < ( * 7.> > > > > J ^ K G G > + D 7.7.7.7 N ( < 7.7.7.G G ) B * < G 7.G 7.G 7.7.G G G > > > 7.G G # .) G > > G > > k u 0 7.G z U G G 7 ( F + < G G G 7.7.7 W + < 7.G 7.G 7.G G 7.> 7.G 7.> > > 7.~ B + > > > G G > x ~ # .+ ~ .7 D ; ; k G 7.7.7.G G G K W x G 7.G 7.G 7.7.G 7.7.G 7.> G 7.7.G < ( D < G > > > > > < z D # %.A +.B .7 < K = G G 7.7.J B D < 7.G 7.G 7.G G 7.x G G G > > > > G G K ( 7 > > > > > G > G 1.+ R N K 7 x G ` (./.7.G G < K ; J G 7.G 7.G 7.7.G 7.Y 7.G G > > G G G G x B M ) > > G G > G G > > + D G G 7.7.;.E 4.G 7.7.7 N K < 7.G 7.G 7.G G 7.< ; 1.> G G > > > ` ] %.+ L 3 (.S S +.> /.L ;.(.S y 7.G 6.3 6.= = y ;...B # ` ] @ *.;.S B 7.G G J A z G > > G 7.7.% = '.n ~.K %.= = = y *.u .4.= = {.7.c /.= = ..u M M B J y = E 6.!.b z G 7.< D W M ) G > > G G y = ..7.. . +.@ '.= @ V . . 1.}.= {.. G 7.6.= B . . . . 7.y = ..> . . . . G ) [ D [ + G G G > 7.S = a . . . . 4.E = z . . . G y = @ . . G (.6.a . . . . G y = .. . . . . < ^ W J N B ) G G G 7.y = .. . . 7.}.6.'.0.. . . G (.= %.. . ~ y = B . . . 7.G *.'.0 . . . G 7.7 [ K < + [ D < > > G % = R . . > > }.6.}.0.. . +.+.3 = {.. . B (.E W . . G G 7.y = K . . G 7.x +.( J G < D {.Y 7.> 7.y = u . . > > ..6.'.0.. . K U (.= %.. . + y = +.. . 7.G 7.y }.Y . . G < ^ F z 7.7.> x B ; + G > y = ( . . G > }.6.}.0.. . > G (.= {.. . G (.= {.. . G 7.G y = k . . < * [ U < G G > G J +.N + G S '.R . . > G }.6.}.0.. . G G (.= [ . . G *.= }.J . G 7.G *.= ~ . . ~ %.^ x 7.7.7.G > G 7 +.N z y E B . . G > ..6.'.0.. . > > 3 = {.. . 7.'.= = = (.3 p 7.y '.0 . . {.# ) 7.G G G G > G G 7 ( ; @ N ~.. . > > 4.W +.1.. . G 7.= /.B . . G > {.l 4.%.R G 7.@ /.+ . . M ) G 7.7.7.7.> 7.> > G 0.# %.^ . . . > > > > > . . > > > + D . . . 7.7.7.- - Q . . G < . . . . ) G 7.G G G G G G 7.> 7.7.) ^ F . . < G > > > G . . 7.G > 3.D 7.. G G G 7.7.. . . . x D F . . < 7.G 7.7.7.7.7.> 7.G G > G G < ~ ( [ B + < > G > > > > > 7.+ U G 7.7.7.7.G G 7.G x K W [ R + < G G 7.G G G G G > > > G > > > > 7.J D +.[ ; K x G 7.G 7.> 7.) z G G G G 7.7.< 0. .F F B ~ 1.G 7.7.G 7.7.7.7.7.7.G 7.7.> > G 7.G > 7.< M E | +.7 > > > > G > x ) 7.> 7.7.G G < k F % / ~ G G 7.G G 7.G G G G G G {®Gáz„?ð?$@R¸…ë?@à?@@ôBÔ8intiŽiŽØbb#ˆ#ˆ#ˆ#ˆ# ˆ#(ˆ#0ˆ#8ˆ#@ˆ#Hˆ#P ˆ#X" #`$¦#h&b#p*b#t,p#x0F#€1T#‚2¬#ƒ6¼#ˆ?{#H†#˜I†# J†#¨K†#°L-#¸Nb#ÀPÂ#Ä ´ º  » # ¼¦# Àb#i• ޼ 8b ŽÒ 8ØŽb&T'?([)F.M4i58B8/Ž1i2b3f788M:;IN†XÅËׯÝP&í * ,#len-‡#P¯ & +8  -o /"# 0f# 1#u}- &Ž  (Å *¯# +Å# ,Å#ƒ MÖÜ &íùq ¯& (= *¯# +=# 'N7_ `–" ™¯# šì# œò# ‡# Ÿø# ¡f#( ¢‡#, £‡#0 ¥=#8 §þ#@ ¨þ#H ªˆ#P ¬#X8-D> ¯uref±Å# ²Å#get³+#s€ 0Áá ÃW# Åm# Æ# ÉŸ# Ìá# Í1#(ˆó3uCT"%¯þ%á ¿oqQþQf<qmþ]qþá¯sŸþ“=(» 7òstr9#len:># ;>#+ý pl4 of# pŠ # r# sË# tË# u#( v‡#0 x>#8 y #@ z #H { #P |– #X€‡#\‡#\‚‡ #\ƒ‡ #\„‡ #\…‡ #\ ‡¯#` ˆ¯#h,? @޼ Ö # • # š% # ž@ #  [ # ¢m #( £ #0 ¦£ #8HÝ M¼ P Tè W;  ^ a jF 4 ° P¦ 8òÝ Ð ¦ >Ð w>¬ Ý ¦ ×>Ð wÜ Ý % ¦ ( w Ý @ ¦ w+ þ[ ¦ ; F m ¦ a Ý ¦  ws  £ ¦ “ NU ()ûýÛÝ=,€‚ƒ„…†‡ˆ‰Š‹ŒŽâ>…z l£ ob # |x #ˆ¯ ™Ì œb #ŠØ £õ ¦õ #£ n  n rx sft‡u[v|w(x3y’z¤{¯ ˆ 8Ó   À€€€€€xLÞ ”¿—Q#˜Q#™Q#šQ #›Q#œQ#Q#ŸQ#¡Q#¢Q# ¤&# ª¯# ¬V#MÊ †ó ˆ¯# ‰þ#Xoa  ¯ Ó ,Q û ‡ ¯¯‡¿w— À€’¬•—¸Â òù ôÌ # ÷Q# øU #ºÂˆâ¼ -B>" UJEl È­xÊf#yËf# Ìf# Íf# P¸¾fÏ . 0#red1# 2# 3#g 8Dr G·# Jf# Kˆ# NŽ#( P¯#0i} 1´ 3# 4f# 5f#j¿ 0!½  !¿·# !Áf# !Âf# !Ãf# !Äf#$ !Æ`#(l+m< P"M "O·# "Q¹# "Rf# "Sã# "Tf#$ "Uf#( "W#, "Xf#0 "Yf#4 "[#8 "\f#< "]f#@ "_#D "`f#H "af#L #56 #7·#qrtW0$.Î $0·#$2‡# $4'# $5'#  $6'#  $8=#  $9I#¨wãzÎ} À€€€€€€ €€€ €€€À€€€€€€€€ÿ¿€à™îÄ1A%-¥ %UÎ %W‡# %X}#%.Ù %[use%]1#min%^¤#max%_¤#%/ H%b¦ %d·# %g# %hÇ# %ií#$ %jq#( %lf#, %m<#0 %of#8 %pB#@%;Ç%@¦%Cí%GÒ%J1%SøÎš&4SP&9&;#&<”#&=ñ#&>#x&?¤#y&@¤# &A#(&B‡#0&C‡#4&D#8&E¤#@&E¤#H&t      !"#$%&œ ¤L 77 8´'¬Nr6C , /l"8¹"?Œ(2à(†(Í(Ý4(à)· )qñ )s‡# )t}#)u‡#)?ü )»3key)½¬# )¾ # )¿"#@ñ*1J +ks +mù# +t#,0~ P,3í ,5?# ,7¤# ,8¤#( ,9¤#0 ,:¤#8 ,;¤#@ ,<¤#Hs-6þØ-I -K·#fg-O©#bg-P©#T -Q©# -R©#Ìmid-S©#ˆ -T©#Ä -U©#€ -V©#¼ -XÄ#ø -YÄ#„ -ZD# -\f#˜ -]f#œ -_¹#  -`¹#È -a¹#ð -b¹#˜ -c¹#À -d¹#è -e¹# -f¹#¸ -g7#à -h7#è -jÉ#ð -nf#˜ -pf#œ -q`#  -rT#¨ -sD#° -vÙ#¸ -x=#À -y #È -z=#Ð-9€.<ú .>·# .B# .C# .DD#H .F'#Pfg.G©#dbg.H©#  .I©#Ü .J©#˜ .Lf#Ô .Mf#Ø .P #à .S=#è .U=#ð.W‡#ø-E`/©/?#/!# /&ü#"/.ü##/6#(/?ß#0/C7#8/G"#@/M”#P/Qå#X Ĺ 8 7É 8 ZÙ 8óú.5 .:ë ' 8 7 8/ÞC/o/ f#/ f#/ã{/å ð06"bin08¸"# 0:#x 0;#€ 0<#ˆ 0=# 0?å#˜ 0@å#  0A1##¨ 0B7##° 0C”#¸ 0D=##À 0F#È0G‡#È0H‡#È0I‡ #È0P‡ #È0Q‡ #È0R‡#È0S‡#È0T‡#È0U‡#È0W‡#È0X‡#È0Z‡#Ì0]‡#Ì0^‡#Ì0_‡#Ì0`‡#Ì0b‡#Ì0e‡#Ì0g‡#Ì0h‡#Ì 0j‡#Ð 0k‡#Ô 0l‡#Ø 0m‡#Ü 0o‡#à 0q}#ä 0r!#è/òaH13:" p16¸" 18ú# 1:å#`1<‡#h1?‡#h1@‡ #h1A‡ #h1B‡ #h20Ã" x23ì" 25/"# 27å#p02÷"03# 0š1# 0œ·# 0ž=#ì"ý"30N# p33¡# 35ú# 37’#` 38’#d 3:#h 3;#j40¬# ˜43Ž$ 45/"# 47Å#p 48å#x 49å#€ 4;‡#ˆ 4<#Œ4>‡#4?‡#4@‡#4A‡#4B‡#4C‡#4D‡#51™$(5¡## 5@å#˜ 5Aå#  5C3#¨ 5D#° 5Eq&#¸ 5F¯#À 5H‡#È 5Må#Ð 5Oå#Ø 5På#à 5Qå#è 5Rí#ð 5T”#ø 5U”#€ 5Wf#ˆ 5Xf#Œ 5Yf# 5Z‡#” 5_#˜ 5`‡# 5b‡#¤5c‡#¤5g‡#¤5i‡#¤5k‡#¤5l‡#¤5m‡#¤5n‡#¤54|&‚&¢&¢&QQ¨&¯Ž$q61¹& ¸66( 68C## 6;#p6<‡#x6=‡#x6>‡#x6?‡#x6@‡#x6A‡#x6B‡#x6C‡#x6D‡#x6E‡#x6F‡#x 6H‡#| 6J#€ 6K%(#ˆ 6L%(# 6N[#˜ 6På#  6Q1##¨ 6S+(#°64(3(71<( €74„( 76/"# 79Å#p 7:#x7;‡#x80( 83x)bin85¸"# 87”#x 89#€ 8;‡#ˆ8=‡#Œ8>‡#Œ8?‡#Œ8@‡#Œ8A‡#Œ8B‡#Œ8C‡#Œ8D‡#Œ8E‡#Œ9%ƒ)x):7š) 8::€* :’# :?’#$ :Af#( :Bf#, :D#0 :E#2:G‡#4:H‡#4:I‡#4:J‡#4:K‡#4:L‡#4:M‡#4);+‘* ;9Ö* ;;f# ;<¯# ;=¯# ;>¯#;,á*;.ò*ç*Ö*†*<0++f:+ø*++¯=.U+=2:+=4k+ ¸=>- =@?# =Bå# =Cå#( =Då#0 =Eå#8 =Få#@ =G”#H =H‰)#P =I’#X =J‡#\ =Kf#` =OU+#d =Pf#h =Qf#l =Rf#p =Sf#t =Tf#x =Uf#| =Vf#€ =Yf#„ =Zf#ˆ =\# =]Å#˜ =`‡#  =a‡#¤ =bf#¨ =c4#¬=f‡#°=g‡#°=h‡#°=i‡#°=j‡#°=k‡#°=l‡#°=m‡#°=n‡#°`+>0®- ˜>3ÿ- >5„(#>7‡#>8‡#>9‡#o?/.@*!. @-<. @/·#.A*M. xA-!/ A/·# A2f#seqA3¯# A4¯#( A5Å#0 A6f#8 A7f#< A84#@ A9!/#H A:f#P A; +#X A<¯#` A=º#hA>‡#pb B?2/ ÐBBÞ1 BDú# BF#`BH‡#hBI‡#hBJ‡#hBK‡#h BN#j BO#l BR”#p BS<.#x BTå#€ BVf#ˆ BWf#Œ BY[#B[‡#˜B\‡#˜B]‡#˜B^‡#˜B_‡#˜B`‡#˜Ba‡#˜Bb‡#˜Bc‡#˜Bd‡#˜Be‡#˜Bf‡#˜Bg‡#˜ Bi‡#œ Bj‡#  Bk‡#¤ Blf#¨ Bmf#¬ Bnf#° Bp#´ Bq#¶ Bs#¸ Bt#º Bvf#¼ Bxf#À Byf#Ä B{¥#È B}f#ÌC7é1 xC=2 C?/"# CA#2#pC922D442 D7ç2 D9¸"# D<å#x D=å#€D@‡#ˆDA‡#ˆDB‡#ˆDC‡#ˆDD‡#ˆDE‡#ˆ DG#ŠE6ü2E9ç2EG3EK*4 EM'/# EOí#Ð EQ”#Ø ES#à EU¤#è EV¤#ð EXü2#øEZ‡#üE[‡#üE\‡#üE]‡#üE^‡#üE_‡ #üE`‡ #üEa‡ #üEb‡ #üF854 GÆP4 GÏq4#H1?H2FH4MGÈ›4GÊ›4GÌ«4GÍ»4 P4«4 8 [4»4 8 f4Ë4 8 Ie5 Igˆ# Ih# Iib# Ijb# Ik#Mb[5 Žk5 8ÿ&·5  ¤q6!¤å!¤)""¦å"§å"¨å"©þ*# b>6$__s ˆ% Ò&'Òf6%Òå%Ò¯(Ô6)*posÝbË4#>b»6$__s>ˆ$__n>-%>Ò&+Jq7,J¦ ,J; ,J¯-IÒ7,I-,J€*,Kø*,L+,M¯.fO’‘œ/PÒ7‘ 06R116 Ÿ1&6‘ Ÿ Pâ7 8?-<¢8,<-,=€*,>ø*,?+,@¯.fB’‘œ/CÒ7‘ 06E116 Ÿ1&6‘ Ÿ2|fõ83|å3|¯4~õ8‘ } 9 8)2\fI93\å3\¯5·5ê96Ê56Ö57â57î57ú5768·5¤6Ö59:â5:î5:ú5:6;Ê55>6z:6P66[6:f6<>6Ò6P697f6;[69=r6‘\>:ª:?dtCÿ:3CÝ3Cÿ:4Eb 2ObI;3OÝ3Oÿ:2æZ~;3æ>îÜ;3îå@ðå@ñå@òí-V<AX€*AY--ÁÆ<BrowÁb,Á+AÃÆ<.strÄ[5‘°}AĈ8…6Ê6®66£66˜6*4-â/=Cmaxäb/æ†*‘°CrowçbAèq+Xq†=,X¦ ,X; ,X¯+QqÝ=,Q¦ ,Q; ,Q¯+?f>,?¯2ÇfX>DAdjÇí3Çå2mf±>3må3m¯4ob 2dfõ>3då3d¯-ûX?,ûåAýåAþåAÿå-¸?Af/b‘l/¸?‘P/‘` ˆÈ? 8E4wF9bw-aI@Ac¦ Ac¦ +—Ÿ@,—þ*/™†*‘°/š‘X+‚q(A,‚å,‚¯A„A…þ*9A‰ÿ-+sqA,så,s¯AuAvþ*GJ¥¦GJ¦¦GF?bGK~*4 ˆÓA 8³4LÃA G2ˆG3Haf4bItag5b 46å 47å 48å /#å /$ŽB B.GJ¥¦GJ¦¦GF?bJK~*4 G2ˆG3Haf4b% : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ &I' I : ; I8 ' < ' I : ; I 8  : ; ( : ;I : ;  : ; I5I : ;  : ;I8  : ; : ;  .? : ;' I !: ;I"4: ;I#.? : ; ' I 4 $: ; I%: ; I&'.? : ; ' I (4: ; I) *4: ; I+.? : ;' I@,: ;I-.? : ;' @.4: ;I /4: ;I 01RUX Y11 2.? : ; ' I@3: ; I44: ; I 5.1@6174181X Y9 :41;1<1X Y =41 >.? : ; ' @?4: ; I@4: ; IA4: ;IB: ;IC4: ;ID: ; IE.? : ;' @ F.? : ;' I@ G4: ; I? < H4: ; I? < I4: ; I J4: ; I?  wwwUTQ !w!7w7¢wð¢£w£¤w¤©wð *U 'T'£S¤©S -Q-PU LRLPT 3X3PQ°±w±ÇwÇ2wð23w34w49wð°ºU°·T·3S49S°½Q½àU°ÜRÜàT°ÃXÃàQ@GwGæw æçw@VU@LTðôwôÿwÿwðøUðøT(w(RwðRXwXÑwð-USuU-T-:VSuTuÑV^uTuÑVÜàPàÑ^éíPí¤SñõPõÑ\-S‘¸¬Ñ‘¸àáwáâwâéwé;w0;>w>?w?@w@«w0«®w®¯w¯°wàíUí>S@®SàíT P@JP@®S°´w´êwêëwÈÏPÏÒRðôwôwwðUðT $w$8w8<w )U -T@AwAQwQ[w@HUHQSQZX`bwbdwdfwfhw hiw(irw0rvw8vQwÀQXw8XYw0Y[w([]w ]_w_awafw`qUqYV~‚P‚à]àçPç/]/6P6~](,P,˜]˜ŸPŸ]] $P$¾^prwrŽwŽ–w–šw šp wÐp w w w x wx z wz  w& C PC O TŸ £ P£ ? V? C PC ˜ VÇ Ë PË VO S PS ¨ V× Û PÛ 0 V_ c Pc ¸ Vç ë Pë x VX _ P_ Ÿ Võ ü Pü ˜ \˜ œ Pœ Ç V $ P$ O V¨ ¬ P¬ × V0 4 P4 _ V¸ ¼ P¼ ç V= D PD z \z ~ T€ ‚ w‚ ‰ w‰ ‹ w‹ w Ž w(Ž ’ w0’ › w8› §w€§¨w8¨©w0©«w(«­w ­¯w¯±w±¸w¸5w€€ ¶ U¶ ¨S²5S€ Ó TÓ ©V²5Vå é Pé M]²0]Í «\²Æ\ÆÎPÎ \ Y\'P'+\+0P05\Þ ŸÞ ŸÞæ‘°}ŸæU\@BwBDwDEwEFw FJw(JñwÐñòw(òów óõwõ÷w÷wwÐQUPUóVøVX\P\‘S‘·\·ÂSÂË\ËÞSÞí\øS€•P³ÂPøPP $w$7w78w (U (T (Q@DwDWwWXw@HU@HT@HQ`dwdŒwŒw`hU‘w‘ÔwÔÕw˜U˜T˜ÔSàäwäw w 'wàôU$UàøT$T04w4DwDEw08U08TPuwuÞwÀÞãwPyUy¾SèìPìÍ]ÍâTó÷P÷.V.2P2ÃVðñwñõwõÆw0ÆÇwÇÈw07Pðôwô]w]bwP%8PEXPpqwqrwrywyåwÐåæwæçwçèwp†U†æSðñwñCwCDwðôUðøTÿ P CS P%4PPQwQœwœwPTUPXT_ePeœS,WpsxçK ëû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/lib/x86_64-linux-gnu/glib-2.0/include/usr/include/glib-2.0/glib/usr/include/glib-2.0/gobject/usr/include/cairo/usr/include/pango-1.0/pango/usr/include/gtk-2.0/gdk/usr/include/gdk-pixbuf-2.0/gdk-pixbuf/usr/include/gtk-2.0/gtk/usr/include/netinetimg/usr/include/arpagtk.cstdio2.hstddef.htypes.hlibio.hglibconfig.hgtypes.hgarray.hgquark.hgerror.hglist.hgconvert.hgdataset.hgslist.hgmain.hgunicode.hgstring.hgiochannel.hgscanner.hgtype.hgvalue.hgparam.hgclosure.hgsignal.hgobject.hcairo.hpango-font.hpango-attributes.hpango-layout.hgdktypes.h gdkcolor.h gdkfont.h gdkgc.h gdkvisual.h gdkdrawable.h gdkscreen.h gdkinput.h gdkevents.h gdk-pixbuf-core.h gtkenums.h gtkaccelgroup.h gtktypeutils.h gtkobject.h gtkadjustment.h gtkstyle.h gtkrc.h gtkwidget.h gtkwindow.h gtkcontainer.h gtkbin.h gtkmisc.h gtkmenushell.h gtkmenu.h gtklabel.h gtkbox.h gtkbutton.h gtkcelleditable.h gtkcellrenderer.h gtktreemodel.h gtktreesortable.h gtktreeviewcolumn.h gtktogglebutton.h gtkeditable.h gtkimcontext.h gtkliststore.h gtkentry.h gtktreeview.h gtkscrolledwindow.h gtkspinbutton.h mtr.hin.h stdint.hnetdb.hstdio.hnet.hmtr_icon.xpm nameser.h ÊKZ€~fËcJõŸÐ}f°‚Ð}<±XYm"ËcJõŸÝ}f£‚Ý}<¤XY¶~"u- @T\TM¡XK[Ät¥y<¤Xb+iN#ZV>YW=„ÉZ:2ƒ„æd|‚“#Y…Ðz×ó'Ø~MÉW/É¢MŸZ 2K¢jF@ŽX =½ë¿S]ƒ%-Ÿ;=‘%Ÿ;=‘%Ÿ;=;ug)W<,íAƒ¾»&Ÿ;=’YsŸŸ)*gIg7ä2š$p\ ;"*Y*SAƒÉ"Y=ó-SAƒu’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-SAƒuæHhHk0V<0ØuÕ=Èst òãÕÕ/;W/;yX5y<0 Öw‚ Ju‚ ¬uXiH KuJ’ JwJ JuJh/ó×÷|‚Š&ö|‚Œ<òõŸww(KK×=ïR;ŸIYœ\y.èäKYZu KYZj KYYY­Z}È =­e»YY[ŸäM¡®/[xäsòKY[’ %å»å¼r>Y;=Y%Y»%u»#×;=Õ% XUMT„Z‘ZŸ„vVvZ¼1)»Úö&òMZ»>»>»?I(.’’))„b<$ƒ;=1ŸôŸô†_.$ƒ;=/××…in_drag_filenofocus_widgetGDK_SELECTION_CLEAR_GtkMenuG_IO_STATUS_AGAINtree_viewG_SIGNAL_RUN_CLEANUPGdkGCsize_tGDK_DESTROY_GArrayGTK_RC_BASEGDK_MOD3_MASKuse_markupblue_shiftgdoublegrabsG_PARAM_PRIVATEGtkMenuShellcellred_maskGSListCOL_LOSSG_SIGNAL_DETAILEDtorn_offGTK_TREE_VIEW_COLUMN_FIXEDhscrollbarmin_widthG_IO_FLAG_IS_SEEKABLEparent_menu_itemG_TOKEN_EOFGtkIMContextalignmentN_COLSis_writeablekeyvalGdkScreen_IO_save_endpathis_activeG_PARAM_STATIC_NICKhomogeneoustree_modeltearoff_adjustmentGDK_PROXIMITY_OUTG_IO_FLAG_SET_MASKdigitsrendererGDK_AXIS_YTILTGDK_SHIFT_MASKGdkPixmapgreen_precReportTreeView_clickedNewDestination_activateGDK_GRAB_BROKENselection_boundwindowGDK_SELECTION_NOTIFYGdkByteOrderGtkCellRenderer_IO_write_baseG_SIGNAL_NO_HOOKSio_readGDK_LEAVE_NOTIFYfont_descGError_GtkBoxstateGIConvpriv_accelsG_IO_FLAG_APPENDis_invalid_GtkTreeIterts_y_originGDK_RELEASE_MASKproperty_cacheHostnametext_areaGDK_VISIBILITY_NOTIFY_GtkCellEditableGDK_SOURCE_PEN_shortbuftypeG_IO_FLAG_GET_MASKbutton_request_GtkStyleactivates_defaultscreen_IO_save_basecondupper_arrow_prelightrequested_widthlightcolormapnet_iochannelhas_frameGDK_SUPER_MASKstick_initiallyGdkAxisUsev_uint64COL_RCVallocated_lencopy_itemGdkDeviceGTypeGDK_HYPER_MASKpriv_cur_columnmax_widthgtk_net_dataG_PARAM_WRITABLEGDK_MOD2_MASKWindowbase_gcblink_timeoutts_x_originheightmain_windownumericdispatchactive_menu_item_GdkDevicewidth_charsGTK_TREE_VIEW_COLUMN_GROW_ONLYgtk_redrawG_PARAM_STATIC_NAMEGtkRequisition_GSourceCallbackFuncsmodal_GdkRectangletext_aa_gcToolbar_fill_GTypeClassicon_factoriesGSourceDummyMarshal_nextproperty_changed_signalsubwindow_gcsGDK_LSB_FIRSTlong int_GtkAccelGroupGDK_FONT_FONTSET_GtkTreeView_GtkBinhave_grabns_s_nsG_IO_STATUS_EOFv_longGCallbackcursor_visibleG_SEEK_SETmenu_flag_IO_markerG_TOKEN_FLOATgunicharaccel_modsGTK_RC_TEXTg_type_instanceclosure_callbackclipboardcolorsderivative_flagdomainreorderableGDK_AXIS_XGDK_AXIS_Yvscrollbarhostentdo_encodeGtkTreeIterCompareFuncGtkObjectwmclass_nameread_cdgtk.cG_TOKEN_IDENTIFIER_NULLGtkBoxbin_windowGtkBin__u6_addr16GDK_MODIFIER_MASK_GSourcescroll_offsetGDK_META_MASK_GtkMiscglongGDK_CONTROL_MASKdestroy_with_parentsigned charattach_countuint8_tmaximize_initiallymnemonic_widgetg_class_IO_FILEGtkClipboardGDK_AXIS_XTILTframe_rightdns_iochanneltearoff_windowcontextGTK_SHADOW_NONEblueG_TOKEN_LASTcolumnGDK_KEY_RELEASEns_s_prupperneed_timerguint32unsigned chartoggle_sizegtk_load_pixmaph_aliasesguint16constructedref_countGArraysnprintfrc_stylegtk_loopsource_funcsGDK_ENTER_NOTIFYtransient_parent_GdkFontGDK_VISUAL_PSEUDO_COLORis_expanded_GtkIMContextclip_y_originns_s_qd_GListPangoAttrList_GObjectin_childis_expandermodifiersGtkAdjustmentcached_layoutgint8lowervalueG_IO_PRIhas_focusparent_instancegtk_dns_dataGtkTreeIterGDK_BUTTON3_MASKGtkCellEditablecharuse_bufferellipsizeTreeViewCreateread_bufupdate_tree_rowGtkSpinButtonythickness_GdkColormappreedit_cursorG_PARAM_DEPRECATEDGtkTreeModelnamecolumn_typehscrollbar_visibledepressedwrite_bufmnemonic_modifierbutton_downaccel_keyauthors_IO_lock_tGDK_DRAG_LEAVEgravitytimerGSourceGtkMenuGtkMiscGdkRegiongtk_do_initsourceCOL_AVGblue_maskcolor_flagsnextgtk_opengtk_detectflagsh_addr_list_GdkGCgtk_dns_data6ypad_IO_read_ptradjustment_GtkWindowGeometryInfohas_user_ref_countGDK_MODE_DISABLEDascentselect_infoattrsview_windowGdkDeviceKeyinconsistentG_TOKEN_HEX_posstdinGtkAccelKeyGDataG_TOKEN_RIGHT_PARENposition_func_dataGtkLabelSelectionInfoupdate_policyGTK_SHADOW_ETCHED_OUTguint64GDK_WINDOW_STATEhscrollbar_policytextGDK_BUTTON2_MASKtext_max_lengthmodifier_maskGIOConditionCOL_HOSTNAMEGTK_WINDOW_POPUP_GtkWindowGDK_VISUAL_STATIC_GRAY_GtkContainerv_pointer_markersscroll__fmtfuncsprivate_flagstimeout_idGdkFontGDK_2BUTTON_PRESSGDK_VISUAL_DIRECT_COLORclickable_GSListdnd_position_GtkSpinButtonGDK_NO_EXPOSEG_SIGNAL_MUST_COLLECTGObjectsnap_to_ticksguint8position_funcobjectin_buttonGDK_SOURCE_MOUSEencodingGTypeClassin_inotifyeventcell_listGDK_MSB_FIRSTfg_gcdefault_widgetGDK_DROP_STARTGtkSortTypeparentG_SIGNAL_RUN_FIRST_GdkVisualdepress_on_activateGDK_UNMAPupper_arrow_visiblegetSelectedHostns_s_udpercent_formatteraccel_path_quark_offset_GdkPixbufG_TOKEN_STRINGGTK_UPDATE_ALWAYSaccel_pathG_TOKEN_LEFT_PARENG_IO_NVALreallocate_redrawsGdkColorG_PARAM_CONSTRUCTcell_background_sethostnamemaybe_reordereddataencoded_read_bufGQuarkmnemonic_keyvalexpandReportStoreh_namey_rootpaused_GSourcePrivateGDK_BUTTON1_MASKG_PARAM_LAX_VALIDATIONclosureGDK_CLIENT_EVENTstylesGDK_MOTION_NOTIFYdark_gcallow_growexposure_gcsGtkEntryunspec_addrpixmaplong unsigned intfinalizemiscGDK_MODE_SCREEN_lockblackbuf_sizeGDK_AXIS_LASTCOL_COLORv_int_flags2line_term_lenh_lengthg_type_GtkEntryis_cell_renderer_IO_read_baseeditablens_s_maxGdkColormapred_shift_gtk_reserved1GMainContextactiveneed_default_positionlower_arrow_visibleGtkWindow_unused2editable_widgetblue_prechas_cursoruser_data2user_data3io_create_watchGDK_MODE_WINDOWlock_countnavigation_timeoutchannelxthicknesssprintfGtkScrolledWindown_guardstree_columnGDK_MOD1_MASKGNU C 4.6.1groupGtkButtonargc_GtkToggleButtonediting_canceled_old_offsetresized_widthG_IO_STATUS_NORMALpoll_fdsfixed_widthG_SEEK_ENDargsargvGDK_AXIS_PRESSURE_GSourceFuncsv_floatsingle_line_modeh_addrtypeorderGdkVisualdefault_sort_func_GtkAdjustmentGDK_SELECTION_REQUESTGSourcePrivateG_TOKEN_CHARkeysGClosureNotifyDatais_seekablelong long intdescentWindow_fillGDK_BUTTON5_MASKred_precdrag_start_xdrag_start_ywidthstampVBoxv_uintG_TOKEN_COMMENT_MULTIG_IO_FLAG_IS_WRITEABLEWindow_destroyGDK_DAMAGExaligngtk_keyactionrc_propertiesGDK_SOURCE_CURSORresize_modehave_transformchildim_context_IO_write_endmarshalin_marshaldepthgbooleanlayoutframeframe_bottomnewdestination_itemCOL_STDEV_GdkDeviceKeyx_n_bytesaccel_flagsclosedcairo_font_options_t_GdkScreenG_SIGNAL_ACTIONdrag_xdrag_yguintGDK_EVENT_LASTfloatGtkRcFlagswm_rolesensitiveGDestroyNotifyGDK_SETTINGns_s_znGDK_BUTTON_PRESSn_columnsuse_stockentryprivate_font_desc_GtkMenuShelliconify_initially_IO_buf_basedecorated_GtkWidget_GdkDeviceAxiskeyboard_modeGDK_OWNER_CHANGEunsigned intPangoFontDescriptiondefault_sort_destroyline_termGtkRcStylenormal_gcsmnemonic_windowstep_incrementGDK_MOD5_MASKnum_axesGDK_SCROLLG_IO_STATUS_ERRORG_TOKEN_BINARYclose_on_unrefGTK_WINDOW_TOPLEVELPause_Buttonpositionrecompute_idlev_ulongmouse_cursor_obscuredG_IO_HUP__pad1__pad2__pad3__pad4__pad5GDK_KEY_PRESSbuttonfloat_formatterGTK_SORT_DESCENDING_sbufpartial_write_bufvscrollbar_policyG_TOKEN_RIGHT_BRACE_GtkObjectGtkWindowGroupyalignv_int64draw_indicatorToolbar_cairo_font_optionstearoff_activeGTK_TREE_VIEW_COLUMN_AUTOSIZElight_gcn_accelsbits_per_rgbneed_resize_GtkRequisitionGTK_SORT_ASCENDINGconfigure_notify_receivedtrack_linksGdkPixbufmid_gcshow_ips_flagsWaitTimedoneGdkRectanglepage_size_GValueclip_x_origin_modeGTK_POLICY_AUTOMATICaxesGDK_EXPOSEG_TOKEN_COMMApopup_menuGDK_DELETE_GDataGDK_SOURCE_ERASERin6_addractivate_timetearoff_hboxvscrollbar_visibleEntryGInitiallyUnownedsend_eventwidgetGDK_MOD4_MASKuse_resized_widthtruncate_multilineallow_shrinkgtk_add_ping_timeoutparent_menu_shellG_IO_FLAG_NONBLOCKGDK_CONFIGUREdefault_sort_dataButtonPause_clickedGtkTreePathGDK_MAPgpointerlong doublearrowG_TOKEN_LEFT_BRACEstyle_PangoAttrList_GMainContextio_writeGtkMenuPositionFuncGTK_RC_FGio_get_flagsGClosureNotifyCOL_WORSTGtkWidgetGDK_BUTTON_RELEASEhas_focus_chainCOL_SNTGTK_SHADOW_OUTwrite_cdgtk_close_GIOChannelacceleratablesG_TOKEN_RIGHT_CURLYGtkAllocationneed_im_resetGTK_SHADOW_ETCHED_INGtkWindowGeometryInfoio_close_GtkScrolledWindowresolved_dirtext_lengthAdjustmentnotifyaccel_groupdevicesizecache_includes_preeditselect_linesG_IO_FLAG_IS_READABLEGTK_SHADOW_INgtk_pingGdkModifierTypeGtkLabellengthuint16_tneeds_destruction_ref_countframe_top__off_tsort_column_idGSeekType_chaincolormap_sizetimer_stepwrapio_seekeffective_attrsio_set_flagswhitesaved_state_GtkLabelG_TOKEN_OCTALbg_pixmapborder_width/home/wolff/mtrprepare_GtkButtonGDK_DROP_FINISHEDinvisible_charns_s_anns_s_arG_SEEK_CURGTypeInstancegeometry_infotext_aaG_PARAM_STATIC_BLURBGtkEditableGTK_POLICY_NEVERGDK_VISUAL_STATIC_COLORG_TOKEN_LEFT_CURLYsource_id_GtkClipboardneed_default_sizecallback_funcsgint16icon_IO_backup_basepanel_GtkEditableGtkStyleGDK_AXIS_IGNOREwindowing_databg_pixmap_namelower_arrow_prelight_GdkAtomsort_clicked_signalmtr_iconio_freesort_orderuse_underlineunrefwindow_placementcolumn_headersGDK_3BUTTON_PRESStime__off64_tignore_enterG_TOKEN_SYMBOLcontainerwhite_gccodeGTK_RC_BGGtkTreeViewColumnGDK_DRAG_STATUSx_text_sizeCOL_LASTPangoLayoutGIOStatusGtkTreeViewColumnSizingGSourceFunc_GtkListStoreGIOFlagsx_rootnum_keyssort_list_GdkColorselect_wordsGDK_AXIS_WHEEL_IO_buf_endscroll_stepprivate_font_GtkTreeViewColumnrc_style_listsresizableGdkEventButtonGdkInputSourcev_doubleGtkContainergfloatxpadtimer_callspixel_GTypeInstanceclimb_ratevisible_GStringcheckG_TOKEN_INTn_inotifiersWaitTime_changedshort intgcharreliefeditingGIOFuncsGClosuremodepriorityG_TOKEN_IDENTIFIERshow_sort_indicatoroverwrite_moderesolutionfloatingGValueTreesort_column_changed_signalGtkAccelGroupEntryGtkTreeViewPrivatewrap_mode_GtkAccelKey_GIOFuncs_GClosure_vtable_offsetgreen_shiftGtkTreeViewGtkListStoreip_tcallback_dataG_SIGNAL_NO_RECURSEiter__u6_addr8_GErrorreserved1reserved2_GIConvjtypespacingGdkAtomold_active_menu_itemscroll_fastignore_leave_GdkDrawableHost_activateclosure_marshalG_IO_FLAG_MASKGDK_PROPERTY_NOTIFY_GdkEventButtonvalid_GdkRegionGdkVisualTypepage_incrementGTK_POLICY_ALWAYSgreen_maskGStringRestart_clickedGdkFontTypetype_hintpattern_setG_TOKEN_NONEGDK_BUTTON4_MASKbyte_ordermeta_marshal_IO_read_endcurrent_posGDK_NOTHINGGDK_VISUAL_TRUE_COLORGtkAccelGroupAbout_clickedmenu_shellReportTreeViewactivate_timeoutdoublefocus_outG_TOKEN_COMMENT_SINGLElong long unsigned intgulongallocationG_CONNECT_AFTERaddrevent_windowuint32_tG_TOKEN_ERRORsaved_scroll_offsetGDK_LOCK_MASKengine_specifiedn_fnotifiersGDK_DRAG_ENTERGdkDeviceAxisLabelgint64_GtkWindowGroup_GtkTreeViewPrivateshadow_typenotifiersclick_childhave_xgrabGTK_UPDATE_IF_VALIDgsizedarkgintgreenchildrenrequisition__ns_sectG_TOKEN_EQUAL_SIGNGSourceCallbackFuncsG_IO_ERRtitleshort unsigned intstdout_GClosureNotifyDatavisualG_PARAM_CONSTRUCT_ONLYtext_gcGDK_VISUAL_GRAYSCALEbasemessagewmclass_classGSourceFuncsfocus_on_clickuser_data_IO_write_ptrblack_gcG_PARAM_READABLEtoplevelkeys_changed_handlerconfigure_request_count_GtkAccelGroupEntrylabelGList_PangoFontDescriptionGIOChannel_GtkLabelSelectionInfodirtyGdkEventTypeCopy_activatecolumns_dirtyCOL_BEST_GtkCellRenderer_GtkTreeModelGdkWindow__u6_addr32GDK_DRAG_MOTIONGtkToggleButtonlabel_texttearoff_scrollbarGDK_FONT_FONT_PangoLayoutG_IO_IN_GtkTreePathGDK_PROXIMITY_INis_readableqdatahas_toplevel_focusfocus_childin_clickframe_leftprevnavigation_regionpreedit_lengthbg_gcG_CONNECT_SWAPPEDG_IO_OUTGdkInputMode_GtkRcStyleG_SIGNAL_RUN_LASTGDK_FOCUS_CHANGEfont_optionsGtkSpinButtonUpdatePolicy__in6_uGConnectFlagsGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx DN 4‰AƒVpk AA X‰AƒVpk AA |§G Ÿ˜DK$°ÑM†[pŽŒƒj F 4ØÐA†AƒG0R CAA kCA;Dv("D]@DTXAƒPHtBBŽB B(ŒA0†I8ƒD@Û8G0A(B BBB0ÀBŒ\†H ƒDPÖ GABLôµBGŽB B(ŒA0†D8ƒI€  8A0A(B BBBG 8DÔBBŒA †A(ƒDP§ (A ABBI €DS˜DS°-DhÈEAƒCäGDs I DP$“M†ƒX@ŽŒi@ØAƒD0ÑA`tˆrDi$ xA†AƒGPlAAÈTAƒRäMAƒK.symtab.strtab.shstrtab.rela.text.rela.data.bss.rodata.str1.1.rodata.str1.8.rela.rodata.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @pp)+à  &à1à1€862€E E2È%Yà?P TÀBØa0A0s`AøBn˜Fðx X„÷’Oˆ¬ˆ¿¢û§0 ¿0±+¨`Ä‹¨O ¿пÐ0Ú±ë-Û0Åß+äðßùðßô迸ðã8ì(" `ý ñÿ0"/3> D(P]    f l r x ~ „ (Š—ª ‰¼ÏÝêû°‰ @§-H^ðm{Ñ’©Çàí 2FðTTjPM‚’¡àЯÂÕáì$+AZ°;ox‡`-žð"ª³ ¾Å@Õí` :K\y0‰­àG»ÂÕéE/K^luˆ›¹pÈÛó+Tt—³Û€ µëô÷òÿ &.7@IV_r}†Ÿ@Ôª²ºØñ +4@AIXhx’œP“¨½Ùð  ) A ^ } ¡ ³ ðؼ Ù õ   / Ð9 àG ðrP [ q € Œ —   px° È Û í  gtk.cmain_windowReportTreeViewPause_Buttontagdone.49413EntryReportStorepaused.49430mtr_icon.LC62.LC61.LC68.LC69.LC71.LC88gtk_net_datanet_process_returnpercent_formattergtk_tree_model_get__sprintf_chkg_object_set__stack_chk_failfloat_formatterAbout_clickedgtk_window_get_typeg_type_check_instance_castgtk_show_about_dialogWindow_destroygtk_main_quitReportTreeView_clickedgtk_tree_view_get_typegtk_tree_view_get_path_at_posgtk_tree_view_set_cursorgtk_menu_newgtk_menu_item_new_with_labelgtk_menu_get_typegtk_menu_shell_appendgtk_object_get_typeCopy_activateg_signal_connect_dataNewDestination_activategtk_widget_showgtk_menu_popupHost_activategtk_entry_get_typegtk_entry_get_textdns_forwardnet_reopengtk_toggle_button_get_typegtk_toggle_button_set_activestrlengtk_editable_get_typegtk_editable_insert_textgtk_add_ping_timeoutWaitTimecalc_deltatimegtk_pingg_timeout_addgtk_do_initgtk_initgtk_detectgetenvgtk_load_pixmapgdk_colormap_get_systemgdk_pixmap_colormap_create_from_xpm_dToolbar_fillgtk_button_new_from_stockgtk_box_get_typegtk_box_pack_endgtk_button_new_with_mnemonicRestart_clickedgtk_toggle_button_new_with_mnemonicPause_clickedgetuidgtk_adjustment_newgtk_spin_button_newgtk_spin_button_get_typegtk_spin_button_set_numericWaitTime_changedgtk_label_new_with_mnemonicgtk_box_pack_startgtk_entry_newHostnamegtk_entry_set_textgtk_label_get_typegtk_label_set_mnemonic_widgetTreeViewCreategtk_list_store_newgtk_tree_model_get_typegtk_tree_view_new_with_modelgtk_cell_renderer_text_newgtk_tree_view_column_new_with_attributesgtk_tree_view_column_set_expandgtk_tree_view_column_set_resizablegtk_tree_view_append_columngtk_tree_view_column_set_cell_data_funcupdate_tree_rownet_addrafunspec_addraddrcmpnet_upnet_stdevnet_worstnet_avgnet_bestnet_lastnet_xmitnet_returnednet_lossgtk_list_store_setdns_lookupshow_ipsstrlongip__snprintf_chkgtk_redrawnet_maxnet_mingtk_tree_model_get_iter_firstgtk_tree_model_iter_nextgtk_list_store_appendgtk_list_store_removegtk_dns_data6dns_ack6gtk_dns_datadns_acknet_send_batchnet_harvest_fdsg_source_removegtk_spin_button_get_valuenet_resetWindow_fillgtk_window_set_titlegtk_window_set_default_sizegtk_container_get_typegtk_container_set_border_widthgtk_vbox_newgtk_hbox_newgtk_scrolled_window_newgtk_scrolled_window_get_typegtk_scrolled_window_set_policygtk_scrolled_window_set_shadow_typegtk_container_addgtk_opengdk_pixbuf_new_from_xpm_datagtk_window_set_default_icongtk_window_newg_set_application_namegtk_widget_show_allgtk_closegtk_keyactiongtk_loopnet_waitfdg_io_channel_unix_newg_io_add_watchdns_waitfd6dns_waitfdgtk_maingetSelectedHostgtk_tree_model_get_itergtk_tree_path_freegtk_clipboard_getgtk_clipboard_set_textg_free#üÿÿÿÿÿÿÿM%üÿÿÿÿÿÿÿ] t&üÿÿÿÿÿÿÿ‚ Š'üÿÿÿÿÿÿÿ¥(üÿÿÿÿÿÿÿÝ%üÿÿÿÿÿÿÿí  &üÿÿÿÿÿÿÿ 'üÿÿÿÿÿÿÿ5(üÿÿÿÿÿÿÿH Z+üÿÿÿÿÿÿÿa i,üÿÿÿÿÿÿÿw  „ Ž (“ #¥ (® 0· ÈÀ 8É AÑ IÖ-üÿÿÿÿÿÿÿõ/üÿÿÿÿÿÿÿr1üÿÿÿÿÿÿÿy,„,üÿÿÿÿÿÿÿ¤2üÿÿÿÿÿÿÿ´,¼,üÿÿÿÿÿÿÿË3üÿÿÿÿÿÿÿÐ4üÿÿÿÿÿÿÿÕ Ý5üÿÿÿÿÿÿÿâ “ê5üÿÿÿÿÿÿÿò6üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ 7üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ!7üÿÿÿÿÿÿÿ08üÿÿÿÿÿÿÿ>,üÿÿÿÿÿÿÿN 9S ª[:üÿÿÿÿÿÿÿp,üÿÿÿÿÿÿÿ€ ;… ª:üÿÿÿÿÿÿÿ•<üÿÿÿÿÿÿÿ<üÿÿÿÿÿÿÿ«,üÿÿÿÿÿÿÿÈ=üÿÿÿÿÿÿÿê?üÿÿÿÿÿÿÿø,üÿÿÿÿÿÿÿ@üÿÿÿÿÿÿÿAüÿÿÿÿÿÿÿBüÿÿÿÿÿÿÿCüÿÿÿÿÿÿÿ!),üÿÿÿÿÿÿÿ3DüÿÿÿÿÿÿÿG,üÿÿÿÿÿÿÿO@üÿÿÿÿÿÿÿWEüÿÿÿÿÿÿÿ`Cüÿÿÿÿÿÿÿgo,üÿÿÿÿÿÿÿ|DüÿÿÿÿÿÿÿFüÿÿÿÿÿÿÿŒ,üÿÿÿÿÿÿÿž ³£Güÿÿÿÿÿÿÿ¸Iüÿÿÿÿÿÿÿ½JüÿÿÿÿÿÿÿÉ KÜLüÿÿÿÿÿÿÿâüÿÿÿÿÿÿÿöÿNüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ% ¿*PüÿÿÿÿÿÿÿERüÿÿÿÿÿÿÿm ÇwUüÿÿÿÿÿÿÿVüÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿŸWüÿÿÿÿÿÿÿ¤8üÿÿÿÿÿÿÿ²,üÿÿÿÿÿÿÿ¿ .Ä ÐÌ:üÿÿÿÿÿÿÿÑ ØÖUüÿÿÿÿÿÿÿä,üÿÿÿÿÿÿÿöWüÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ * Ð:üÿÿÿÿÿÿÿ  â%Xüÿÿÿÿÿÿÿ3,üÿÿÿÿÿÿÿEWüÿÿÿÿÿÿÿP,üÿÿÿÿÿÿÿX Y` Ðj:üÿÿÿÿÿÿÿo ëtZüÿÿÿÿÿÿÿ„‰,üÿÿÿÿÿÿÿ›Wüÿÿÿÿÿÿÿ¢ª,üÿÿÿÿÿÿÿ· [¼ ÐÄ:üÿÿÿÿÿÿÿÉ\üÿÿÿÿÿÿÿÓüÿÿÿÿÿÿÿÝüÿÿÿÿÿÿÿåIüÿÿÿÿÿÿÿñüÿÿÿÿÿÿÿüüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ ]üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ!^üÿÿÿÿÿÿÿ)_üÿÿÿÿÿÿÿ4,üÿÿÿÿÿÿÿA`üÿÿÿÿÿÿÿL,üÿÿÿÿÿÿÿ^Wüÿÿÿÿÿÿÿi,üÿÿÿÿÿÿÿw a| ò„:üÿÿÿÿÿÿÿ‰ Žbüÿÿÿÿÿÿÿœ,üÿÿÿÿÿÿÿ®cüÿÿÿÿÿÿÿ³düÿÿÿÿÿÿÿºeüÿÿÿÿÿÿÿÄÉ?üÿÿÿÿÿÿÿÔ,üÿÿÿÿÿÿÿßfüÿÿÿÿÿÿÿæî,üÿÿÿÿÿÿÿû > ª:üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ2cüÿÿÿÿÿÿÿ9>güÿÿÿÿÿÿÿI,üÿÿÿÿÿÿÿÇjüÿÿÿÿÿÿÿÑ$Öküÿÿÿÿÿÿÿá,üÿÿÿÿÿÿÿélüÿÿÿÿÿÿÿó,ø8üÿÿÿÿÿÿÿ ,üÿÿÿÿÿÿÿ 0   :üÿÿÿÿÿÿÿ" müÿÿÿÿÿÿÿ0 5 = )L nüÿÿÿÿÿÿÿ\ oüÿÿÿÿÿÿÿi püÿÿÿÿÿÿÿn 1üÿÿÿÿÿÿÿu ,€ ,üÿÿÿÿÿÿÿ‹ qüÿÿÿÿÿÿÿ müÿÿÿÿÿÿÿ  ,üÿÿÿÿÿÿÿ¨ üÿÿÿÿÿÿÿ² 2¼ 'üÿÿÿÿÿÿÿÈ Ò Ú 9é nüÿÿÿÿÿÿÿù püÿÿÿÿÿÿÿ $ rüÿÿÿÿÿÿÿ , ,üÿÿÿÿÿÿÿ+ qüÿÿÿÿÿÿÿ0 müÿÿÿÿÿÿÿ@ ,üÿÿÿÿÿÿÿH üÿÿÿÿÿÿÿR 2\ 'üÿÿÿÿÿÿÿh r z >‰ nüÿÿÿÿÿÿÿ™ püÿÿÿÿÿÿÿ  ,¨ ,üÿÿÿÿÿÿÿ³ qüÿÿÿÿÿÿÿ¸ müÿÿÿÿÿÿÿÈ ,üÿÿÿÿÿÿÿÐ üÿÿÿÿÿÿÿÚ 2ä 'üÿÿÿÿÿÿÿð ú  B nüÿÿÿÿÿÿÿ! püÿÿÿÿÿÿÿ( ,0 ,üÿÿÿÿÿÿÿ; qüÿÿÿÿÿÿÿ@ müÿÿÿÿÿÿÿP ,üÿÿÿÿÿÿÿX üÿÿÿÿÿÿÿb 2l 'üÿÿÿÿÿÿÿx ‚ Š G™ nüÿÿÿÿÿÿÿ© püÿÿÿÿÿÿÿ° ,¸ ,üÿÿÿÿÿÿÿà qüÿÿÿÿÿÿÿÈ müÿÿÿÿÿÿÿØ ,üÿÿÿÿÿÿÿà üÿÿÿÿÿÿÿê 2ô 'üÿÿÿÿÿÿÿ   K! nüÿÿÿÿÿÿÿ1 püÿÿÿÿÿÿÿ8 ,@ ,üÿÿÿÿÿÿÿK qüÿÿÿÿÿÿÿP müÿÿÿÿÿÿÿ` ,üÿÿÿÿÿÿÿh üÿÿÿÿÿÿÿr 2| 'üÿÿÿÿÿÿÿˆ ’ š P© nüÿÿÿÿÿÿÿ¹ püÿÿÿÿÿÿÿÀ ,È ,üÿÿÿÿÿÿÿÓ qüÿÿÿÿÿÿÿØ müÿÿÿÿÿÿÿè ,üÿÿÿÿÿÿÿð üÿÿÿÿÿÿÿú 2 'üÿÿÿÿÿÿÿ  " V1 nüÿÿÿÿÿÿÿA püÿÿÿÿÿÿÿT )Y rüÿÿÿÿÿÿÿ` ,h ,üÿÿÿÿÿÿÿÐ tüÿÿÿÿÿÿÿÖ uüÿÿÿÿÿÿÿÛ væ wüÿÿÿÿÿÿÿõ xüÿÿÿÿÿÿÿú \ byüÿÿÿÿÿÿÿ"züÿÿÿÿÿÿÿ0{üÿÿÿÿÿÿÿ:|üÿÿÿÿÿÿÿD}üÿÿÿÿÿÿÿN~üÿÿÿÿÿÿÿ\üÿÿÿÿÿÿÿj€üÿÿÿÿÿÿÿ~ üÿÿÿÿÿÿÿO$…üÿÿÿÿÿÿÿ¼‚üÿÿÿÿÿÿÿʃüÿÿÿÿÿÿÿÚ„üÿÿÿÿÿÿÿï f …üÿÿÿÿÿÿÿ$„üÿÿÿÿÿÿÿ1(üÿÿÿÿÿÿÿK‡üÿÿÿÿÿÿÿRˆüÿÿÿÿÿÿÿYküÿÿÿÿÿÿÿ`$k,üÿÿÿÿÿÿÿv‰üÿÿÿÿÿÿÿ’süÿÿÿÿÿÿÿ™$¤,üÿÿÿÿÿÿÿ¯ŠüÿÿÿÿÿÿÿÎ$Ú‹üÿÿÿÿÿÿÿäsüÿÿÿÿÿÿÿ$ Œüÿÿÿÿÿÿÿ%Žüÿÿÿÿÿÿÿ*†üÿÿÿÿÿÿÿEüÿÿÿÿÿÿÿJ†üÿÿÿÿÿÿÿe†üÿÿÿÿÿÿÿj‘üÿÿÿÿÿÿÿo’üÿÿÿÿÿÿÿuüÿÿÿÿÿÿÿz“üÿÿÿÿÿÿÿHüÿÿÿÿÿÿÿ•_üÿÿÿÿÿÿÿ ,üÿÿÿÿÿÿÿ¨”üÿÿÿÿÿÿÿ²üÿÿÿÿÿÿÿ¾IüÿÿÿÿÿÿÿÓüÿÿÿÿÿÿÿÈHüÿÿÿÿÿÿÿ͆üÿÿÿÿÿÿÿæðüÿÿÿÿÿÿÿõ“üÿÿÿÿÿÿÿû †üÿÿÿÿÿÿÿ!Hüÿÿÿÿÿÿÿ5•üÿÿÿÿÿÿÿ:†üÿÿÿÿÿÿÿv+üÿÿÿÿÿÿÿ„,üÿÿÿÿÿÿÿ‰ n‘—üÿÿÿÿÿÿÿœ,üÿÿÿÿÿÿÿ®˜üÿÿÿÿÿÿÿ³™üÿÿÿÿÿÿÿÁ,üÿÿÿÿÿÿÿΚüÿÿÿÿÿÿÿÚ›üÿÿÿÿÿÿÿéœüÿÿÿÿÿÿÿôTüÿÿÿÿÿÿÿùVüÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿcüÿÿÿÿÿÿÿiüÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿ/žüÿÿÿÿÿÿÿ=,üÿÿÿÿÿÿÿOŸüÿÿÿÿÿÿÿZ,üÿÿÿÿÿÿÿg üÿÿÿÿÿÿÿn,y,üÿÿÿÿÿÿÿ„¡üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ§cüÿÿÿÿÿÿÿ²,üÿÿÿÿÿÿÿ |"Müÿÿÿÿÿÿÿ' ,£üÿÿÿÿÿÿÿ4¤üÿÿÿÿÿÿÿ;¥üÿÿÿÿÿÿÿ@ nG L¦üÿÿÿÿÿÿÿS X–üÿÿÿÿÿÿÿ]8üÿÿÿÿÿÿÿd o,üÿÿÿÿÿÿÿ| . }‰:üÿÿÿÿÿÿÿ ˜,üÿÿÿÿÿÿÿ¥ .ª в:üÿÿÿÿÿÿÿ¹ ¾§üÿÿÿÿÿÿÿõHüÿÿÿÿÿÿÿú«üÿÿÿÿÿÿÿ¬üÿÿÿÿÿÿÿ "­üÿÿÿÿÿÿÿ®üÿÿÿÿÿÿÿ!¬üÿÿÿÿÿÿÿ( 5­üÿÿÿÿÿÿÿ:¯üÿÿÿÿÿÿÿA¬üÿÿÿÿÿÿÿH U­üÿÿÿÿÿÿÿƒküÿÿÿÿÿÿÿŠ$•,üÿÿÿÿÿÿÿ£²üÿÿÿÿÿÿÿ®$¶,üÿÿÿÿÿÿÿÐ%üÿÿÿÿÿÿÿسüÿÿÿÿÿÿÿõ±üÿÿÿÿÿÿÿ´üÿÿÿÿÿÿÿµüÿÿÿÿÿÿÿ!´üÿÿÿÿÿÿÿ1µüÿÿÿÿÿÿÿ9¶üÿÿÿÿÿÿÿU±üÿÿÿÿÿÿÿb?üÿÿÿÿÿÿÿiq,üÿÿÿÿÿÿÿ|füÿÿÿÿÿÿÿƒŠ>üÿÿÿÿÿÿÿ’¶üÿÿÿÿÿÿÿWSüÿÿÿÿÿÿÿbhüÿÿÿÿÿÿÿ{ qüÿÿÿÿÿÿÿß¡üÿÿÿÿÿÿÿ^°üÿÿÿÿÿÿÿ’ž«¸ Å(Ò0ß8ì@ùHPX `-h:pGxT€aˆn{˜ˆ •¨¢°¯¸¼ÀÉÈÖÐãØðàýè ðø$1>KX e(r08Œ@™H¦P³XÀ`ÍhÚpçxô€ˆ˜( 5¨B°O¸\ÀiÈvЃØàèªð·øÄÑÞëø (08,@9HFPSX``mhzp‡x”€¡ˆ®»˜È Õ¨â°ï¸üÀ ÈÐ#Ø0à=èJðWødq~‹˜ ¥(²0¿8Ì@ÙHæPóX` hp'x4€AˆN[˜h u¨‚°¸œÀ©È¶ÐÃØÐàÝèêð÷ø   + 8 ˆ(ð0X8À@(HPøX` `È h0 p˜ x €h ˆÐ 8 ˜    ¨p °Ø ¸@À¨ÈÐxØààHè°ðø€èP¸  ˆ(ð0X8À@(HPøX``Èh0p˜x€hˆÐ8˜ @h˜ ¸(f0r8@­H»PàX`Øh8p`xˆ€ëˆ°à˜ @¨°p¸˜ÀÀÈÐ Øèàè@ðhø0M[u ¸(à088@`  8 x A!!) . q; 5B " I ›*P ŒW & ^ g%l ìq • | Y#‘ Þ – r £ ]²  Á T(Ð Ùß  î E+ý ³  < i$* g9 f"H ¿W ~f ¶ u „ ˜“ {¢ =² h&Â Ò eâ ƒò ´ » Â" É2 ÐB ŸR fc Ý j v ²„ ’ <æ í þ(ò o ý M Z" V   ) Ã)4 º? /*L Ö(Q q%\ ûg :*r Ú} )ˆ „“ î$  ™¥ ¼° +» ¼ã t î „ú :# P. M9 Ó&E üS ’#a  +„ ½+  › :© X · +-Ì bÝ ï&ã Sî î  õ ï! :/ X D O nU  ` Íl ¡&z K"ˆ – – j ¤ À ² %À q Î !"Ü ¨ê +-ø X  u  8# ]. 4 w*? AY #v + ä Q!› 7%© ÷ GÅ ÊÓ V'â $2 ž¦ š± ä'¼ .%ä ó Ù+þ    j  ”& „4 pB  P Ã^  l qz  ˆ ?– £ ¤ ² ã à 8Ô Eå æ,ö ¡ ‘ Û&& å&5 †%@ T&L *Z |h Û v –„ ª’ û"  ó ® £Å $Ë •Ñ <× :Þ ä#ñ •!÷ lý ½ ¬  À, i-#  ) Œ*/ «5 Õ< O uU Ï[  a !g Pm f's "y +€  $² w¸ ¾ YÄ "Ë ;Ò FÙ :à d*æ Êì (ó R)ú l 6 ! =% 0 Œ$ –+ p#2 ¦%9 ~@ ç(G  N Ý ^ 4c #o ð%{ ‰‡ ·• :¤ ° ƒ½ ·Í  !Ù  %æ j  ’ + L6 A oL ðW òb Ø$m t‘ \+— ` û£ Ð*© °¯ µ Ê» Û Ä!É U Ô %ß ^&ë j ü G(   “)/ I%@ ˜Q ç%b ìs É„ †• Á£ :± ú)À ~Ë µ*× :å Öô Sÿ °e øk ‹-q Vw ¯&} ƒ f‰  !  ')¦ W-­ Ý-¸ 7à + Ï ºÝ j ë ò,ú D F Ž# ™. Ã+4  ? _K Ø#V ³,b rm ]‘ óŸ ¨® '¿ Õ"Å òÐ C$Ü %ø ?* Ø  ù  9 , ” : ðH åV É*d ¢"s ³~ Å Š ˜ ñ ¦ «µ kÀ ƒ Ì ” Ú ‘è  ö œ ž ¥!  , Ÿ'2 =  I ” W e Ôs <( ½  á ì« ¹ ÐÇ Ù'Õ w&ã vñ B ÿ ±   ;'( ” 7 lB R,M µX [e ” s ?„ Ø’  ¡ а ®-¿ Ü%× ÞÝ ³ä ì÷ ]ý t)   * q ˜ h" ) Ÿ0 ê7 ½ > +(E ¿L ÆU )_ äi ªs »~ F › ¦ ² ®À I Ï ¯)Ú ^  Ý( ” 6 u D 3 R ˜%` ‰n | ºŠ 0$˜ y¯ sµ » õÁ uÈ É$Û ß á Uç ºî r- ’"    Ò ˆ  N% Z$+ z2 åI º$T ‰'a p Ð VŽ T#· ºÆ \Õ åä éó )$  m(  ã& x, ¿2 ç8 ß> »D B#J ÓP ×V ñ \ £ b 2h -n ât #z *€ u'† Œ G’ ט Õ,ž ¤  )ª è ° h,¶ ³#¼ Ö d!È ÏÎ ÝÔ Ú à Âæ Ëì {ò °ø Gþ Š ,D CO ‹u ¥,{ ‚ ü'• O› ï*¡ ö!§ Î ­ y(³ ͺ ª'Î Ç'Ô ¥Ú å!ê È ð / ö þü k ¤ T 3(  . ü5 åA (L õX ñf Êt  ‚ , Øž i­ G¸ G&Ä Ë Ò £à 3ò &ý £+ Ç% r@ YK NW ” e q t S  8‹ ” ™ u §  µ { à óÑ ¸'ß ô ‰"ÿ D  ” 4 ŸC 5*a åp + ¼!Ž k !¬ C» ðÊ . Ù Áè Q-÷ Ï ù M$ ç*3 †B kQ S+` ‰#o *!~ 2  Ôœ ¥« $º  É „ Ø àç »ö  Í - ” , u : ±"H CV L  åŽ + ð¬ . » gÊ ¡$Ù è ‚)û É S b" š1 \@ !O u ^ Ym N*| )‹ К ñô ™ú —# ® Œ  Ÿ8 2D úQ ó` ¨p { | +"‚ \Ž D¨ •*¶ cÅ +Ô ªã ò Ç ´  ®! ê. D= ‹+L ›^ p ‚ 2” 9"¦ u¸ Ê Ì Ü Š î W!  ! ¼$! *6! ÕH! G Z! Il! (~! ÷ ! Ñ¢! ø,´!  -Ã! ‹ Ò! — á! ðð! v+ÿ! ­ " `" O0" á$;" fG" aU"  -c" 4!t" î…" ‡–" ß§" æ¹" ¨Ä" "Ð" #Þ" ¢í" €ø" µ þ" Y # Ê)# ” ## ÄD#  O# ò[# ai# Rw# h…# õ$“# ˜ ¢# Ú­# ¹# #Ç# E*Õ# Ìã# ½ò# å$ $ +"$ *4$ *F$ .'X$ wj$ c#|$ m$  š$ 1§$ «(µ$ fÄ$  'Ó$ Ýâ$ ·ñ$ T% m% 0 % m+-% ± <% K% “,Z% i%  x% ‡% Ö–% `)¥% u$´% ¨Ã% 0-Ò% Õá% o ó% & ¢& "')& 4;& HM& z_& À"r& …¯& V º& !Æ& PÔ& ·+â& ÷&ó& Ö ' #' ¦&' î 7' úH' “Y' -j' =&{' (Œ' 7' W«' åº' É' ã Ø' ãç' Z ö' ã( ø ( € ( ä+2( –=( TI( #W( E*e( ý&s( ï…( J( Y!ª( <)¸( ˆ,Ç( Å(Ö( ^ è( iú( ¿ ) w%) #0) úB) ™ T) f) ,+y) Î „) ó) ù›) 3,§) ñµ) RÃ) hÑ) óß) ¨í) õ$û) ˜ * ˜%* &%+* = <* æ M*  ^* ²o* ~%‡* ± ’* ‘ž* ù¬* ;+º* ”È* Ÿ×* â* È,è* h ó* D, + BC+ ôI+ ±O+  V+ î#a+ ¡#l+ Ž$x+ ñ†+ L”+ å¢+ ¢°+ @¾+ Ì+ ÐÚ+ oè+ Rö+ ¸, ý&, z , ., 5<, ‡J, óX, ±f, Ft, Iƒ, v’, }¡, •*°, ©¿, Þ"Î, ü%Ý,  ì, #û, &% - °$- å1- û+C- ¹%U- *g- y- v‹- g¤- x,¯- Y»- åÉ- +Û- wí- #. Ù!. |". ƒ". ò .. ” C. &N. $Z. ñh. ù„. ’. 9$ . ð®.  ¼. Ê. 3#Ø. _ æ. &ô. ð/ ®/ ,(/ 3/ ¾?/ aM/ å[/ çl/ &%}/ Í%Ž/ Ÿ/ ¿­/ û»/ ÓÉ/ ¨×/ Øæ/ a(õ/ À0 a 0 õ%0 ]70 ¼I0 N[0 ]m0 -0 È‘0 j£0 •µ0 M$Ç0  Ù0 ²ë0 ˆý0 å 1 Ž1 ~*1 Ö91 ñ H1 «W1 Ã#f1 )u1 B-„1 F “1 ÷¢1 Ù±1 æÀ1 v!Ï1 èß1 ƒ&ê1 ö1 ñ2 82 *&2 Ú)*2 52 ŸA2 #O2 ;]2 %l2 Ó~2 (2 † ¢2 +´2 "#Æ2 Ý(Ø2 î)ð2 ¥ö2 *ý2 »-3  3  3 .3 ª =3 v"L3 ÿ [3 %j3 Ë y3 –ˆ3 4 š3 *¬3 å¾3  Ð3 ú$â3 >ô3 »4 Ö 4 ?+4 œ&64 B4 Õ-Q4 ? \4 f g4 I)z4 È&…4 ¯4 \,Ì4 0Ø4 zæ4 L ô4  5 ®5 w 5 Z*+5  15 ×75 …!=5  C5 4I5 XO5 !U5 ðu5 &{5 ü5 ù‡5 ö5 Ï#“5 *,™5 : Ÿ5 ¿¥5 «5 ˆ±5 š¹5 Ë5 ÷%×5 £ã5 Øï5 û5 ý6 Ì6 û26 Ž@6 H'Q6 >\6 :g6 7)‡6 { ¯6 ޽6 SÉ6Ñ6Ù6 â6 èí6 Lò6 uý6 o7 : 7 ’7 `7 $7©,7 µ57 @7 ?E7 çP7 bU7 û`7 «e7 Ã&p7 áu7 :€7 “7 å§7W¯7 ½7ä7 ìì7°ô79ü7 M8 8 ×8 ç 8 ú%8 û08 C58 Ã&@8 yE8 :P8 ¯c8 åw8ç8 08 ¤8 (¯8@·8ç¿8 åÈ8 Ò8 2×8 :á8 Uæ8 Õ 9 89ð9"9 x+9 59 Ä:9 :D9 çN9V9Ñ^9  k9 lt9 ¢‘9^™9Ñ©9 þ®9^¶9ÑÃ9 4Ì9 jÕ9  Þ9 Öï9à÷9°ÿ9  : ü: E: h':@/:§>: žC:@K:§^:@f:§|: ¨ƒ:°‹:ë“: Á¥:  ¬: ' ³:ð»:Ã: C Ì: TÖ:  Û: Íå: ² ê: mö:; f ; ;<"; Õ +; T5; ! :; ÍD; D K; < V;@^;[f; g o; .y; ³ €; v‡;`;f—; ü  ; †ª; 9 ¯; ¹; o ¾; ½)È;  Í; Ë×; M Þ; ø æ;pî; ö; ƒ ÿ; E < H< ê < ˆ!<  )<€ 1<59< ÛM< -R< Ã&]< vb< 7)m< ¿‚< u < –<Þž< ®< Ö·< À< (Î< Ö<@Þ<æ< tú< vÿ< Ã&= ¿= ™'*= g1= Š == E=8M= ÃV= èa= f= uq= 2v= := Uˆ= ¤ ”=@œ=X¤= x­= è¸= Ľ= uÈ= çÍ= :Ø=  ß= = ë=`ó=û= -> :> y> V%!>)>Õ1> œD> èI> S>  Z>  e>àm>'u> A~> ˆ> ¡> :—> ל> ˆ¨>³> ì'¾>0Æ>EÎ>  ×> á> Yæ> :ð> |÷> ³ÿ>P?ã? Ÿ? #? ì(? ÿ3? "8? †C? kH? ‡S? ¡Z? ] b?ðj?Èr? ×{? a"†? K‹? Tš? È©? ÍÊ? Ò?ÐÚ?Òç? Yó?àû?ã@  @ð@b @ n)@ ®4@ º9@ £ D@ ÝK@ HW@p_@èg@ p@ Ì{@ °€@ Ã&@ u ¡@ ,­@ðµ@D½@ æÆ@ aÑ@ 2Ö@ :á@ Uæ@ !ñ@ xö@ ÌA UAA=A Û"A ®*A ˜6AP>AFA äOA aZA 0_A :jA SoA !zA vA ÌŠA SA AA ®*ªA T·A "ÔA ò"àAéA ÊöA dB$B h0B9B >EB NB ¯ZBcB ¶(pB0yB n†B(•B A¢B ®*¯B T¼B "ÉBvÒB ÊßB déf ø 8 \°€@œð´Üà°,ðD \@x`Äpø€ H@„ œ@´`Ìèà0PDðdÐxàŒð¤pÌðèPmtr-0.85/Makefile.dist0000664000175000017500000000040412104140215013654 0ustar wolffwolff # # This is an attempt on simplifying the compilation of mtr to a simple "make". # firstrule: ./configure $(MAKE) clean: rm -f *.o *~ core distclean: clean rm -f mtr config.cache config.status config.log \ stamp-h stamp-h[0-9]* TAGS ID mtr-0.85/Makefile0000664000175000017500000007626112162522230012735 0ustar wolffwolff# Makefile.in generated by automake 1.11.1 from Makefile.am. # Makefile. Generated from Makefile.in by configure. # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009 Free Software Foundation, # Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. pkgdatadir = $(datadir)/mtr pkgincludedir = $(includedir)/mtr pkglibdir = $(libdir)/mtr pkglibexecdir = $(libexecdir)/mtr am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : sbin_PROGRAMS = mtr$(EXEEXT) am__append_1 = asn.c asn.h subdir = . DIST_COMMON = README $(am__configure_deps) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in $(srcdir)/config.h.in \ $(srcdir)/version.h.in $(top_srcdir)/configure AUTHORS COPYING \ NEWS TODO depcomp install-sh missing ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \ configure.lineno config.status.lineno mkinstalldirs = $(install_sh) -d CONFIG_HEADER = config.h CONFIG_CLEAN_FILES = version.h.tmp CONFIG_CLEAN_VPATH_FILES = am__installdirs = "$(DESTDIR)$(sbindir)" "$(DESTDIR)$(man8dir)" PROGRAMS = $(sbin_PROGRAMS) am__mtr_SOURCES_DIST = mtr.c net.c net.h dns.c dns.h raw.c raw.h \ split.c split.h display.c display.h report.c report.h getopt.c \ getopt1.c getopt.h select.c select.h mtr-curses.h mtr-gtk.h \ asn.c asn.h am__objects_1 = asn.$(OBJEXT) am_mtr_OBJECTS = mtr.$(OBJEXT) net.$(OBJEXT) dns.$(OBJEXT) \ raw.$(OBJEXT) split.$(OBJEXT) display.$(OBJEXT) \ report.$(OBJEXT) getopt.$(OBJEXT) getopt1.$(OBJEXT) \ select.$(OBJEXT) $(am__objects_1) nodist_mtr_OBJECTS = mtr_OBJECTS = $(am_mtr_OBJECTS) $(nodist_mtr_OBJECTS) am__DEPENDENCIES_1 = mtr_LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(mtr_LDFLAGS) $(LDFLAGS) -o \ $@ depcomp = $(SHELL) $(top_srcdir)/depcomp am__depfiles_maybe = depfiles am__mv = mv -f COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \ $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(AM_LDFLAGS) $(LDFLAGS) -o $@ SOURCES = $(mtr_SOURCES) $(EXTRA_mtr_SOURCES) $(nodist_mtr_SOURCES) DIST_SOURCES = $(am__mtr_SOURCES_DIST) $(EXTRA_mtr_SOURCES) RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-dvi-recursive install-exec-recursive \ install-html-recursive install-info-recursive \ install-pdf-recursive install-ps-recursive install-recursive \ installcheck-recursive installdirs-recursive pdf-recursive \ ps-recursive uninstall-recursive am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' man8dir = $(mandir)/man8 NROFF = nroff MANS = $(man_MANS) RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive \ distclean-recursive maintainer-clean-recursive AM_RECURSIVE_TARGETS = $(RECURSIVE_TARGETS:-recursive=) \ $(RECURSIVE_CLEAN_TARGETS:-recursive=) tags TAGS ctags CTAGS \ distdir dist dist-all distcheck ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) am__remove_distdir = \ { test ! -d "$(distdir)" \ || { find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \ && rm -fr "$(distdir)"; }; } am__relativize = \ dir0=`pwd`; \ sed_first='s,^\([^/]*\)/.*$$,\1,'; \ sed_rest='s,^[^/]*/*,,'; \ sed_last='s,^.*/\([^/]*\)$$,\1,'; \ sed_butlast='s,/*[^/]*$$,,'; \ while test -n "$$dir1"; do \ first=`echo "$$dir1" | sed -e "$$sed_first"`; \ if test "$$first" != "."; then \ if test "$$first" = ".."; then \ dir2=`echo "$$dir0" | sed -e "$$sed_last"`/"$$dir2"; \ dir0=`echo "$$dir0" | sed -e "$$sed_butlast"`; \ else \ first2=`echo "$$dir2" | sed -e "$$sed_first"`; \ if test "$$first2" = "$$first"; then \ dir2=`echo "$$dir2" | sed -e "$$sed_rest"`; \ else \ dir2="../$$dir2"; \ fi; \ dir0="$$dir0"/"$$first"; \ fi; \ fi; \ dir1=`echo "$$dir1" | sed -e "$$sed_rest"`; \ done; \ reldir="$$dir2" DIST_ARCHIVES = $(distdir).tar.gz GZIP_ENV = --best distuninstallcheck_listfiles = find . -type f -print distcleancheck_listfiles = find . -type f -print ACLOCAL = ${SHELL} /home/wolff/mtr/missing --run aclocal-1.11 AMTAR = ${SHELL} /home/wolff/mtr/missing --run tar AUTOCONF = ${SHELL} /home/wolff/mtr/missing --run autoconf AUTOHEADER = ${SHELL} /home/wolff/mtr/missing --run autoheader AUTOMAKE = ${SHELL} /home/wolff/mtr/missing --run automake-1.11 AWK = gawk CC = gcc CCDEPMODE = depmode=gcc3 CFLAGS = -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 -Wall -Wno-pointer-sign CPP = gcc -E CPPFLAGS = CURSES_OBJ = curses.o CYGPATH_W = echo DEFS = -DHAVE_CONFIG_H DEPDIR = .deps ECHO_C = ECHO_N = -n ECHO_T = EGREP = /bin/grep -E EXEEXT = GLIB_CFLAGS = GLIB_LIBS = GREP = /bin/grep GTK_CFLAGS = -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 GTK_LIBS = -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 GTK_OBJ = gtk.o INSTALL = /usr/bin/install -c INSTALL_DATA = ${INSTALL} -m 644 INSTALL_PROGRAM = ${INSTALL} INSTALL_SCRIPT = ${INSTALL} INSTALL_STRIP_PROGRAM = $(install_sh) -c -s LDFLAGS = LIBOBJS = LIBS = -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm LTLIBOBJS = MAKEINFO = ${SHELL} /home/wolff/mtr/missing --run makeinfo MKDIR_P = /bin/mkdir -p OBJEXT = o PACKAGE = mtr PACKAGE_BUGREPORT = PACKAGE_NAME = mtr PACKAGE_STRING = mtr 0.85 PACKAGE_TARNAME = mtr PACKAGE_URL = PACKAGE_VERSION = 0.85 PATH_SEPARATOR = : PKG_CONFIG = /usr/bin/pkg-config PKG_CONFIG_LIBDIR = PKG_CONFIG_PATH = RESOLV_LIBS = -lresolv SET_MAKE = SHELL = /bin/bash STRIP = VERSION = 0.85 abs_builddir = /home/wolff/mtr abs_srcdir = /home/wolff/mtr abs_top_builddir = /home/wolff/mtr abs_top_srcdir = /home/wolff/mtr ac_ct_CC = gcc am__include = include am__leading_dot = . am__quote = am__tar = ${AMTAR} chof - "$$tardir" am__untar = ${AMTAR} xf - bindir = ${exec_prefix}/bin build_alias = builddir = . datadir = ${datarootdir} datarootdir = ${prefix}/share docdir = ${datarootdir}/doc/${PACKAGE_TARNAME} dvidir = ${docdir} exec_prefix = ${prefix} host_alias = htmldir = ${docdir} includedir = ${prefix}/include infodir = ${datarootdir}/info install_sh = ${SHELL} /home/wolff/mtr/install-sh libdir = ${exec_prefix}/lib libexecdir = ${exec_prefix}/libexec localedir = ${datarootdir}/locale localstatedir = ${prefix}/var mandir = ${datarootdir}/man mkdir_p = /bin/mkdir -p oldincludedir = /usr/include pdfdir = ${docdir} prefix = /usr/local program_transform_name = s,x,x, psdir = ${docdir} sbindir = ${exec_prefix}/sbin sharedstatedir = ${prefix}/com srcdir = . sysconfdir = ${prefix}/etc target_alias = top_build_prefix = top_builddir = . top_srcdir = . SUBDIRS = img man_MANS = mtr.8 mtr_SOURCES = mtr.c net.c net.h dns.c dns.h raw.c raw.h split.c \ split.h display.c display.h report.c report.h getopt.c \ getopt1.c getopt.h select.c select.h mtr-curses.h mtr-gtk.h \ $(am__append_1) nodist_mtr_SOURCES = version.h EXTRA_mtr_SOURCES = curses.c \ gtk.c DEFAULT_INCLUDES = $(GLIB_CFLAGS) -I. mtr_DEPENDENCIES = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDFLAGS = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDADD = $(GLIB_LIBS) $(RESOLV_LIBS) CLEANFILES = version.h BUILT_SOURCES = version.h EXTRA_DIST = SECURITY mtr.8 Makefile Makefile.dist DISTCLEANFILES = *~ all: $(BUILT_SOURCES) config.h $(MAKE) $(AM_MAKEFLAGS) all-recursive .SUFFIXES: .SUFFIXES: .c .o .obj am--refresh: @: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ echo ' cd $(srcdir) && $(AUTOMAKE) --foreign'; \ $(am__cd) $(srcdir) && $(AUTOMAKE) --foreign \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --foreign Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ echo ' $(SHELL) ./config.status'; \ $(SHELL) ./config.status;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(top_srcdir)/configure: $(am__configure_deps) $(am__cd) $(srcdir) && $(AUTOCONF) $(ACLOCAL_M4): $(am__aclocal_m4_deps) $(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS) $(am__aclocal_m4_deps): config.h: stamp-h1 @if test ! -f $@; then \ rm -f stamp-h1; \ $(MAKE) $(AM_MAKEFLAGS) stamp-h1; \ else :; fi stamp-h1: $(srcdir)/config.h.in $(top_builddir)/config.status @rm -f stamp-h1 cd $(top_builddir) && $(SHELL) ./config.status config.h $(srcdir)/config.h.in: $(am__configure_deps) ($(am__cd) $(top_srcdir) && $(AUTOHEADER)) rm -f stamp-h1 touch $@ distclean-hdr: -rm -f config.h stamp-h1 version.h.tmp: $(top_builddir)/config.status $(srcdir)/version.h.in cd $(top_builddir) && $(SHELL) ./config.status $@ install-sbinPROGRAMS: $(sbin_PROGRAMS) @$(NORMAL_INSTALL) test -z "$(sbindir)" || $(MKDIR_P) "$(DESTDIR)$(sbindir)" @list='$(sbin_PROGRAMS)'; test -n "$(sbindir)" || list=; \ for p in $$list; do echo "$$p $$p"; done | \ sed 's/$(EXEEXT)$$//' | \ while read p p1; do if test -f $$p; \ then echo "$$p"; echo "$$p"; else :; fi; \ done | \ sed -e 'p;s,.*/,,;n;h' -e 's|.*|.|' \ -e 'p;x;s,.*/,,;s/$(EXEEXT)$$//;$(transform);s/$$/$(EXEEXT)/' | \ sed 'N;N;N;s,\n, ,g' | \ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1 } \ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \ if ($$2 == $$4) files[d] = files[d] " " $$1; \ else { print "f", $$3 "/" $$4, $$1; } } \ END { for (d in files) print "f", d, files[d] }' | \ while read type dir files; do \ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \ test -z "$$files" || { \ echo " $(INSTALL_PROGRAM_ENV) $(INSTALL_PROGRAM) $$files '$(DESTDIR)$(sbindir)$$dir'"; \ $(INSTALL_PROGRAM_ENV) $(INSTALL_PROGRAM) $$files "$(DESTDIR)$(sbindir)$$dir" || exit $$?; \ } \ ; done uninstall-sbinPROGRAMS: @$(NORMAL_UNINSTALL) @list='$(sbin_PROGRAMS)'; test -n "$(sbindir)" || list=; \ files=`for p in $$list; do echo "$$p"; done | \ sed -e 'h;s,^.*/,,;s/$(EXEEXT)$$//;$(transform)' \ -e 's/$$/$(EXEEXT)/' `; \ test -n "$$list" || exit 0; \ echo " ( cd '$(DESTDIR)$(sbindir)' && rm -f" $$files ")"; \ cd "$(DESTDIR)$(sbindir)" && rm -f $$files clean-sbinPROGRAMS: -test -z "$(sbin_PROGRAMS)" || rm -f $(sbin_PROGRAMS) mtr$(EXEEXT): $(mtr_OBJECTS) $(mtr_DEPENDENCIES) @rm -f mtr$(EXEEXT) $(mtr_LINK) $(mtr_OBJECTS) $(mtr_LDADD) $(LIBS) mostlyclean-compile: -rm -f *.$(OBJEXT) distclean-compile: -rm -f *.tab.c include ./$(DEPDIR)/asn.Po include ./$(DEPDIR)/curses.Po include ./$(DEPDIR)/display.Po include ./$(DEPDIR)/dns.Po include ./$(DEPDIR)/getopt.Po include ./$(DEPDIR)/getopt1.Po include ./$(DEPDIR)/gtk.Po include ./$(DEPDIR)/mtr.Po include ./$(DEPDIR)/net.Po include ./$(DEPDIR)/raw.Po include ./$(DEPDIR)/report.Po include ./$(DEPDIR)/select.Po include ./$(DEPDIR)/split.Po .c.o: $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ $< $(am__mv) $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po # source='$<' object='$@' libtool=no \ # DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) \ # $(COMPILE) -c $< .c.obj: $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ `$(CYGPATH_W) '$<'` $(am__mv) $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po # source='$<' object='$@' libtool=no \ # DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) \ # $(COMPILE) -c `$(CYGPATH_W) '$<'` install-man8: $(man_MANS) @$(NORMAL_INSTALL) test -z "$(man8dir)" || $(MKDIR_P) "$(DESTDIR)$(man8dir)" @list=''; test -n "$(man8dir)" || exit 0; \ { for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.8[a-z]*$$/p'; \ } | while read p; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; echo "$$p"; \ done | \ sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^8][0-9a-z]*$$,8,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \ sed 'N;N;s,\n, ,g' | { \ list=; while read file base inst; do \ if test "$$base" = "$$inst"; then list="$$list $$file"; else \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man8dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man8dir)/$$inst" || exit $$?; \ fi; \ done; \ for i in $$list; do echo "$$i"; done | $(am__base_list) | \ while read files; do \ test -z "$$files" || { \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man8dir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(man8dir)" || exit $$?; }; \ done; } uninstall-man8: @$(NORMAL_UNINSTALL) @list=''; test -n "$(man8dir)" || exit 0; \ files=`{ for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.8[a-z]*$$/p'; \ } | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^8][0-9a-z]*$$,8,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \ test -z "$$files" || { \ echo " ( cd '$(DESTDIR)$(man8dir)' && rm -f" $$files ")"; \ cd "$(DESTDIR)$(man8dir)" && rm -f $$files; } # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" $(RECURSIVE_CLEAN_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) set x; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ set "$$@" "$$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ shift; \ if test -z "$(ETAGS_ARGS)$$*$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ if test $$# -gt 0; then \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ "$$@" $$unique; \ else \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$unique; \ fi; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && $(am__cd) $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) "$$here" distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @list='$(MANS)'; if test -n "$$list"; then \ list=`for p in $$list; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \ if test -n "$$list" && \ grep 'ab help2man is required to generate this page' $$list >/dev/null; then \ echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \ grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/ /' >&2; \ echo " to fix them, install help2man, remove and regenerate the man pages;" >&2; \ echo " typically \`make maintainer-clean' will remove them" >&2; \ exit 1; \ else :; fi; \ else :; fi $(am__remove_distdir) test -d "$(distdir)" || mkdir "$(distdir)" @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ dir1=$$subdir; dir2="$(distdir)/$$subdir"; \ $(am__relativize); \ new_distdir=$$reldir; \ dir1=$$subdir; dir2="$(top_distdir)"; \ $(am__relativize); \ new_top_distdir=$$reldir; \ echo " (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir="$$new_top_distdir" distdir="$$new_distdir" \\"; \ echo " am__remove_distdir=: am__skip_length_check=: am__skip_mode_fix=: distdir)"; \ ($(am__cd) $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$new_top_distdir" \ distdir="$$new_distdir" \ am__remove_distdir=: \ am__skip_length_check=: \ am__skip_mode_fix=: \ distdir) \ || exit 1; \ fi; \ done -test -n "$(am__skip_mode_fix)" \ || find "$(distdir)" -type d ! -perm -755 \ -exec chmod u+rwx,go+rx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r "$(distdir)" dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-lzma: distdir tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma $(am__remove_distdir) dist-xz: distdir tardir=$(distdir) && $(am__tar) | xz -c >$(distdir).tar.xz $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.lzma*) \ lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\ *.tar.xz*) \ xz -dc $(distdir).tar.xz | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod a+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) test -d $(distdir)/_build || exit 0; \ dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && am__cwd=`pwd` \ && $(am__cd) $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \ && cd "$$am__cwd" \ || exit 1 $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x' distuninstallcheck: @$(am__cd) '$(distuninstallcheck_dir)' \ && test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) check-recursive all-am: Makefile $(PROGRAMS) $(MANS) config.h installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(sbindir)" "$(DESTDIR)$(man8dir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: -test -z "$(CLEANFILES)" || rm -f $(CLEANFILES) distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(BUILT_SOURCES)" || rm -f $(BUILT_SOURCES) clean: clean-recursive clean-am: clean-generic clean-sbinPROGRAMS mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf ./$(DEPDIR) -rm -f Makefile distclean-am: clean-am distclean-compile distclean-generic \ distclean-hdr distclean-local distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive html-am: info: info-recursive info-am: install-data-am: install-man install-dvi: install-dvi-recursive install-dvi-am: install-exec-am: install-sbinPROGRAMS @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-exec-hook install-html: install-html-recursive install-html-am: install-info: install-info-recursive install-info-am: install-man: install-man8 install-pdf: install-pdf-recursive install-pdf-am: install-ps: install-ps-recursive install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -rf ./$(DEPDIR) -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-compile mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-man uninstall-sbinPROGRAMS uninstall-man: uninstall-man8 .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) all check \ ctags-recursive install install-am install-exec-am \ install-strip tags-recursive .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am am--refresh check check-am clean clean-generic \ clean-sbinPROGRAMS ctags ctags-recursive dist dist-all \ dist-bzip2 dist-gzip dist-lzma dist-shar dist-tarZ dist-xz \ dist-zip distcheck distclean distclean-compile \ distclean-generic distclean-hdr distclean-local distclean-tags \ distcleancheck distdir distuninstallcheck dvi dvi-am html \ html-am info info-am install install-am install-data \ install-data-am install-dvi install-dvi-am install-exec \ install-exec-am install-exec-hook install-html install-html-am \ install-info install-info-am install-man install-man8 \ install-pdf install-pdf-am install-ps install-ps-am \ install-sbinPROGRAMS install-strip installcheck \ installcheck-am installdirs installdirs-am maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-compile \ mostlyclean-generic pdf pdf-am ps ps-am tags tags-recursive \ uninstall uninstall-am uninstall-man uninstall-man8 \ uninstall-sbinPROGRAMS install-exec-hook: chmod u+s $(DESTDIR)$(sbindir)/mtr version.h: version.h.tmp Makefile $(mtr_SOURCES) @cat version.h.tmp > $@; \ if [ -d .git ] && [ -n "$$(which git)" ]; then \ xver="+git:$$(git rev-list -n1 --abbrev=8 --abbrev-commit HEAD)"; \ sed \ -e "/#define *MTR_VERSION */{s/\"\([^\"]*\)\"/\"\1$$xver\"/;}" \ version.h.tmp > $@; \ fi; distclean-local: (sleep 3; cp Makefile.dist Makefile) & rm -f *.orig # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: mtr-0.85/dns.o0000664000175000017500000031766012162522232012244 0ustar wolffwolffELF> ä@@H=SH‰ûHèH…Àt H‰HƒÀ[Ãè‹8èH‹=I‰À‰Ùº¾1ÀèƒÏÿèffff.„HƒìH…ÿt'H‹GøH…Àt#H= w;H)HƒïHƒÄéfHƒÄÃH‹ º&¾¿èèH‹ º)¾¿èèff.„H‰ñL‰l$øI‰ýHÁù?H‰\$àH‰l$èH‰ÏL‰d$ðHƒì(H1÷H)Ï„ÇH‰øI¹‰ˆˆˆˆˆˆˆI¼«ªªªªªªªI÷áH‰ÓI‰ÐHÁëIÁèH‰ØHŸHÁàH)ÃL‰ÀI÷áH‰ÕH‰×HÁíHÁïH‰èI,¨HÁàH)ÅH‰øI÷äI‰ÔHºW)QΠÈEIÁìKdI‰üHÁàI)ÄH‰ðH÷êHÁú H)Ê…ßAÆEM…ä…¡H…íulH…Ûu7L‰èH‹\$H‹l$L‹d$L‹l$ HƒÄ(ÃfAÇE0sAÆEëÓf.„L‰ïèI|I‰Ø¹HÇÂÿÿÿÿ¾1ÀèëŸfDL‰ïèI|I‰è¹HÇÂÿÿÿÿ¾1ÀèégÿÿÿL‰ïèI|M‰à¹HÇÂÿÿÿÿ¾1Àèé2ÿÿÿI‰Ð¹HÇÂÿÿÿÿ¾L‰ï1Àèéÿÿÿffff.„F?…öIÆÁøHcЉðÁøÁè ƒá?)ÁH‹×HÓøƒàÀV?…ö‰ðIÖÁøÁèÁú HcÒƒá?)Á¸HÓàH ×ÃDV?…ö‰ðIÖÁøÁèÁú HcÒƒá?)ÁHÇÀþÿÿÿHÓÀH!×ù1ÀüóH«Ã@H‰þ‹=¹.ºé„H‰ø‰×H‰òH‰Æééff.„‹Ãf„‹Ãf„USHƒì‹…ÒuHƒÄ[]Ãf„¿è‹…À„)1Ò¾¿H Àèƒøÿ‰Ã‰„!1Ò¾¿ èƒøÿ‰Ã‰„-‹=HL$ A¸º¾ÇD$ è…À…‹=HL$ A¸º¾è…À…º¾¿躾¿ è1ÿè1ÿH‰ÃèH‰ÅHÁåèH1ÝH˜H1Å1ÀH‰-HÇ€HÇ€HƒÀH=uÞHƒÄ[]ÃH‹ ¿º¾è¿ÿÿÿÿèè‹8èºH‰ÁH‹=¾1Àè‰ßèè‹8èºH‰ÁëÐè‹8èºH‰ÁH‹=¾1Àè¿ÿÿÿÿèè‹8èºH‰ÁëÍffffff.„Hƒì¿hèH…ÀH‰Æ„¿¨H‰Çºh…†@öÇ…”@öÇu^‰Ñ1ÀÁéöÂóH«u7öÂu"ƒâu H‰ðHƒÄÃDÆH‰ðHƒÄÃDfÇHƒÇƒâtÕëàÇHƒÇöÂt¿ë߀ǃêHƒÇë“f„HxƲg@öÇ„qÿÿÿDfǃêHƒÇé[ÿÿÿè‹8èH‹=H‰Áº¾1ÀèƒÏÿè„H‰ø%ÿÀ‹1Àƒêƒúw=D‹ •E…É~01ɶ4HƒÁH¾Ö@ÐþH1ÂH¾öI‰ÐHòIÑèA9ÉJØ%ÿóö1À„Ét1€H¾ÑÐùHƒÇH1ÂH¾ÉH‰ÖHʶHÑîH2„ÉuÛ%ÿóÃ@·O`H‰ÎæÿH‹õH…Àué‡f;J`v#H‰ÐH‹PH…ÒuîH‹PH…ÒtDf;J`s H‰ÐH‹PH…Òuîf;H`w(H‰WH‹PH‰GH…ÒtH‰zH‰xH‰<õÃfDH‹PH‰GH‰WH‹PH…ÒtH‰zH‰xH‰<õÃHÇGHÇGH‰<õ÷G`%ÿH9<Åt%H‹GH…ÀtH‹WH‰PH‹WH…ÒtH‰BóÃDH‹WH…ÒtH‰ÅëÈDH‹Wëëf.„AVE1öAUI‰ýATUSL‹gHA¶$„Òt0L‰áfH¾ÂHƒÁÐúL1ðL¾ò¶H‰ÆIÆHÑîIö„ÒuÜAæÿJ‹õH…Ûué¢H‹uHL‰çè…Ày+H‰ëH‹k0H…íuäH‹k8H…ítH‹uHL‰çè…À~ H‰ëH‹k8H…íuäH‹sHL‰çè…Àx,I‰m8H‹C8I‰]0H…ÀtL‰h0L‰k8[]A\N‰,õA]A^ÃfH‹C0I‰]8I‰E0H‹C0H…ÀtL‰h8L‰k0ëÎIÇE8IÇE0ë¼ffffff.„I‰ùH‹H1ö¶H‰ù„Òt0DH¾ÂÐúHƒÁH1ðH¾ÒI‰ÀHжIÑèJ4„ÒuÛæÿL9 õt#I‹A0H…ÀtI‹Q8H‰P8I‹Q8H…ÒtH‰B0éI‹A8H…ÀtH‰õI‹yHëÆI‹A0ëìAUATI‰üUHoPSH‰ïHƒìèH‹ÅI‰ÅH…Ûu!éÃf‹HƒÆPH‰ïè…À~4H‹[ H‹s H…öuÝH‹s(H…öt'@‹HƒÆPH‰ïè…Ày H‹[(H‹s(H…öuÝ‹H{PH‰îè…Àx7H‹C(I‰\$ I‰D$(H‹C(H…ÀtL‰` L‰c(N‰$íHƒÄ[]A\A]ÃDH‹C I‰\$(I‰D$ H‹C H…ÀtL‰`(L‰c ëÇIÇD$(IÇD$ ë³ff.„SH‰ûHPèH9Åt)H‹C H…ÀtH‹S(H‰P(H‹S(H…ÒtH‰B [Ãf„H‹S(H…ÒtH‰ÅëÄDH‹S ëëfH‹H…ÀttóG@ëD.@@r2H‰ÐH‹H…Òuï.@@r!HÇH‰GH‰8H‰=HƒÃH‹PH‰H‰WH‹PH…ÒtH‰:H‰xHƒÃH‰=ëêHÇHÇGH‰=H‰=HƒÃf.„H‹H…À„ óO@ëf„.Áv(H‰ÐH‹Pó@@H…ÒuêH‹H…Òtf.Èr;óB@H‰ÐH‹H…Òuë.Èr&HÇH‰GH‰8H‰=HƒÃ„H‹PH‰H‰WH‹PH…ÒtH‰:H‰xHƒÃH‰=ëêHÇHÇGH‰=H‰=HƒÃf.„H‹GH‹H…Àt4H‰H‹H…ÒtH‰BHƒ-Ã@H‰Hƒ-ÄH‰ëÉ€SH‰ûèH‰ßèH‰ßèHƒ{HtH‰ß[é€[Ãfffff.„H‰ùáÿH‹ÍH…ÀuëS„f;z`r#H‰ÐH‹PH…ÒuîH‹PH…ÒtDf;z`w H‰ÐH‹PH…Òuîf9x`uH‰ÍÀ1ÀÃóÃAUE1íATI‰üUSHƒì¶„Òt5H‰ùE1íH¾ÂÐúHƒÁL1èH¾ÒH‰ÆHжHÑîL,0„ÒuÛAåÿMcíJ‹íH…ÛuëbfH‹uHL‰çè…Àx/H‰ëH‹k0H…íuäH‹k8H…ít#H‹C0L‰çH‹pHè…À H‰ëH‹k8H…íuàH‹sHL‰çè…ÀuJ‰íHƒÄH‰Ø[]A\A]Ã1Ûëîfffff.„ATUH‰ýSèH‹ÅI‰ÄH…Ûuësf‹HƒÆPH‰ïè…Àx4H‹[ H‹s H…öuÝH‹s(H…öt'@‹HƒÆPH‰ïè…À H‹[(H‹s(H…öuÝ‹HsPH‰ïè…ÀuJ‰åH‰Ø[]A\Ã1ÛëôHƒìH‹5èH‹5¿ HƒÄéff.„AVA‰ðE1É1ö¹AUATUS‰ÓH‰ú¿Hì0Ll$ ÇD$HÇD$dH‹%(H‰„$(1ÀL‰l$Ç$èƒøÿA‰Ä„äfƒ=f‰\$ t/»1íLcðL‹M…Àt fAƒ8 „˜·ƒÅHƒÃ9èÛ‹ …É~'½1ÛMcôfƒ}Lct7CHƒÅ9L‰ããH‹„$(dH3%(uqHÄ0[]A\A]A^ÃfL‰à‹=A¹HÁà1ÉL‰òL€L‰îèë €‹=A¹1ÉL‰òL‰îèéJÿÿÿf¿èé|ÿÿÿèfff.„Hƒì€buHƒÄÃÆGbè‹5…ötç¿HƒÄéffffff.„òH*ÆSÆGbH‰ûòXfÀfZÀóG@è‹=…ÿu[ÃDL‹KH¿A¸¹@º¾@1Àè[¿é„f.{6ò f.Ávò\Áòf.Èv"ò1ÀøÃf.„uÈ1ÀÃ1ÀfDÃffffff.„AUI‰õATLf@UH‰õSH_Hƒì„D¶H‰ï¹HÇÂÿÿÿÿ¾HƒÅHƒëD‰ÀAƒàÀèA‰Á1ÀAƒáèL9åuÃI¸ip6.arpaM‰E@ÆEHƒÄ[]A\A]ÃfDH‰\$ÐH‰l$ØH‰ûL‰d$àL‰l$è‰õL‰t$ðL‰|$øH옃þ ¿ŽØƒþ „·;èH…ÀI‰Ä„«€xb†B¶{·C·S·KfÁÈfÁÊfÁÉ·s A‰Àf‰CfÁÎ@öÇf‰Sf‰Kf‰s …P@„ÿ‰7ƒçx…®D¶KAƒá…‡f…Ò„¶D‹ E…É…¶fAƒø¿…&Hcí¿L,+Hk I9í‚ A¶D$bƒè<w(‹ƒø„*ƒø uI|$P¾èDH‰êH‰ßA¸¹L‰îÆèƒøÿA‰Æº¿„¢‹ HƒÂÿþþþ÷Ñ!È%€€€€té‰Á¾¿Áé©€€DÁHJHDÑÀHƒÚHêÆ‚è…À„D‹E…À„Ì¿A¹A¸¹@º¾@1ÀHÇ$è¿€H‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘéDAƒù„¾AƒùH‹ IcÁH‹ÅH‰$A¸¹@º¾@¿1Àè¿èHƒH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘÿé6ÿÿÿfD¿é&ÿÿÿfD¿éÿÿÿfDHƒë—fDD‹ E…ÉuTHƒL‰çH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘéfD¿é¦þÿÿfD¿èë @¿é†þÿÿfD·ö·É·ÒD·ÈA¸‰t$‰L$‰$¹@º¾@¿1Àè¿èD·Céýüÿÿ‹=…ÿ…Mcö¿LõLuM9õ‚ þÿÿ¶E¶UÁà ¶E¶mf‰T$FÁàf‰l$Df D$Dfƒ|$DtOfƒ|$DH‹D·L$Dw IcÁH‹ÅH‰$¿A¸¹@º¾@1Àè¿èfƒ|$F „“fƒ|$FH‹D·L$Fw IcÁH‹ÅH‰$¿A¸¹@º¾@1Àè¿è·CfCfC f‰D$B„®ýÿÿM9õ‚ÉID$PL‰d$PH‰\$8H‰D$Xé«¶ÒÁà@¶öÁâ¶É ЋÁá ð ÈH˜…ÒH‰D$H…E…Òuifƒû„ùfƒû „ïfƒû„BfƒûH‹D·Ëw IcÁH‹ÅH‰$A¸¿¹@º¾@1Àè¿èfƒl$B„áüÿÿH‹|$8A¸¹L‰òL‰îÆèƒøÿ‰Ã„º‹ HƒÂÿþþþ÷Ñ!È%€€€€té‰Á¾¿Áé©€€DÁHJHDÑÀHƒÚHêÆ‚è‹ A‰Â…Ét;A¹A¸¹@º¾@¿1ÀD‰T$(è¿èD‹T$(HcÛIÞIn I9í‚A¶FE¶FA¶A¶~A¶VA¶NA¶vE¶~ ÁàA ÀfD9D$DA¶F…9E„ÿ„E¶÷IîM9õ‚ÜÁã@¶ÿ ûfƒûA”ÄE„äE‰ã…þÿÿf9\$F„ýýÿÿD‹E…Ò„‰þÿÿfƒûH‹D·Ëw IcÁH‹ÅH‰$A¸é9þÿÿH‰Æ¿D‰T$(Dˆ\$0èA¸I‰Á¹@º¾@¿1Àè¿èD¶\$0D‹T$(é›ýÿÿA€ÿ…æ‹H‹|$XH‰îè…À…6H‹|$XèA¸I‰Á¹@º¾@¿1Àè‹H‰î¿è¿èº@H‰Æ¿è¿èH‹|$PHƒèéfýÿÿH‹|$8A¸¹H‰êL‰îDˆ\$0Æèƒøÿ‰ÃD¶\$0„D‹-…í…*ûÿRE„ä…0H‹D$PHƒxH…ûüÿÿ¿HƒÉÿD‰Øò®H÷ÑH‰ÏèH‹T$PH…ÀH‰BH„ð¾H‰ÇèH‹|$PèH‹t$HH‹|$PèHƒéüÿÿf„A¶D$bƒè<†«ûÿÿ‹5¿…ö„˜ûÿÿéÇøÿÿA¶D$PE¶L$R¹E¶D$Sº¾¿‰D$A¶D$Q‰$1Àèé°÷ÿÿA¹A¸¹@º¾@¿1Àè¿èé-úÿÿA¹A¸¹@º¾@¿1ÀDˆ\$0è¿èD¶\$0é•þÿÿ¿éøÿÿ¿éý÷ÿÿfƒ|$DE‰ÆH‹D·L$Dw IcÁH‹ÅH‰$A¸¹@º¾@¿1Àè¿èfAƒþH‹E·Îw IcÁH‹ÅH‰$A¸¹@º¾@¿1Àè¿è¿éU÷ÿÿ¿éK÷ÿÿ¿éA÷ÿÿ¿é7÷ÿÿº¾¿èéÂúÿÿ¿L‹d$PèéøÿÿL‹d$PH‹|$X¸I‹\$HH…ÛHDØè¾@I‰ÁA¸¹@º¿1ÀH‰$è¿èH‹t$HHƒL‰çH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘé¿E¶ÏA¸¹@º¾@1Àè¿éFöÿÿ¿é<öÿÿè‹8èH‹=H‰Áº¾1ÀèƒÏÿèffff.„ATL‹1É‹=A¹ºU¾Sè…ÀA‰ÄŽ-H‹=º ¾HƒÇè…À…‹fƒ=„ѽ1Ûë1@H‹}º ¾HƒÇè…Àt3·ƒÃHƒÅ9Ø~(H‹5H‹}º HƒÆHƒÇè…Àu²·9Ãtk[]D‰æ¿A\éfD1Ûfƒ=½tC€H‹}H…ÿtH‹5HƒÇº HƒÆè…Àt ·ƒÃHƒÅ9ØÈ9Ãu•H‹5¹.º¿ HƒÆèA¸I‰Áëfè‹8èA¸I‰Á¿¹@º¾@1Àè[]A\¿éfATL‹1É‹=A¹ºU¾Sè…ÀA‰ÄŽíH‹=º¾»HƒÇè…À‹u|…À+ëYfDº¾H‰ïè…Àt7‹ƒÃ9Ø~0H‹5HcëºHÁåHÅHƒÆH‰ïè…Àu³‹9Ä[]D‰æ¿A\é@…ÀëÝf‹ƒÃ9Ø~ÎH‹5HcûºHÁçHÇHƒÆè…ÀuÌëŸf.„è‹8èA¸I‰Á¿¹@º¾@1Àè[]A\¿éfH‹‹xèA¸I‰Áë»fDSH‰ûHƒìƒþ„ƒþ t HƒÄ[Ã@‹ƒø„¡ƒø t\·S`¾ ¿èD‹E…ÒtÃH{PèA¸I‰Á¿¹@º¾@1ÀèHƒÄ¿[éHP¾èë”·W`H‹HèD‹E…Û„YÿÿÿL‹KHA¸ëœ€¶GPD¶OR¹D¶GSº@¾‰D$¶GQ¿‰$1Àèé+ÿÿÿ€AVAUATI‰üUSHƒì0H‹H…Û„áóS@ò A½ZÒf.Êf(‚ÕDD¶sbH‹+A€þw`A¶Æÿ$Å€¾ H‰ßè¿è€CbòòXL‰çfÀfZÀóC@ÀZÀèHƒH…ítEóU@ò ZÒf.Êr/H‰ëéoÿÿÿ€‹…À…¢H‰ßèH…íuÀDH‹H…À„ðó@@ZÀHƒÄ0L‰ç[]A\A]A^é@¾ H‰ßè¿è€Cbòé3ÿÿÿ„¿èH‰ßèóC@L‰çZÀèHƒé'ÿÿÿH{PòL$ E¶öòT$èL‹KHA¸¹@òT$H‰$òL$ ºM…Éf(ÂMD;@¿¸D‰t$è¿èéîþÿÿHƒÄ0[]A\A]A^ÃATA‰ôUSH‰ûfDH‹-1ÿèH‹HíH èHH¸¶R´úH1×H1úH‰=f‰{`·ÿH‰èH…Àu²H‰ßèH‰ßD‰æ[]A\éff.„H‰\$èL‰d$øI‰üH‰l$ðHƒì(èH…ÀH‰Ã„Ù¶@b1í<w„Àu;H‹kHH…ít2‹…Àup„H‰èH‹\$H‹l$L‹d$ HƒÄ(Ãf„‹1í…ÀtÔL‰çèA¸I‰Á¹@º¾@¿1Àè¿èëœ@L‰çèA¸I‰Á¹@º¾@¿1ÀH‰,$è¿èH‹kHéUÿÿÿD‹…ÀusèòHhP‹H‰ÃÆ@bòXL‰æH‰ïfÀfZÀó@@èH‰ßè‹L‰æH‰ï1íèH‰ßè¾ H‰ßèéÓþÿÿH‹ º¾¿èémÿÿÿHƒì‹ 1À…ÉtèH…Àt‹…ÒºHDÂHƒÄÉò1öBþƒøw‹4…é€ï¾­Þmalloc() of %u bytes failed: %s ERROR: Attempt to free pointer twice. ERROR: Corrupted free() buffer. (header) Unable to allocate IPv4 socket for nameserver communication: %s Unable to allocate IPv6 socket for nameserver communication: %s Unable to setsockopt() on IPv4 nameserver communication socket: %s Unable to setsockopt() on IPv6 nameserver communication socket: %s Resolver error: Query too large.Resolver: Lookup successful: %s Resolver error: Packet smaller than standard header size.Resolver error: Packet has empty body.Resolver error: Nameserver packet truncated.Resolver error: Query packet received on nameserver communication socket.Resolver error: Invalid opcode in response packet.Resolver: Received nameserver reply. (qd:%u an:%u ns:%u ar:%u)Resolver error: Reply does not contain one query.Resolver error: Reply too short.Resolver error: dn_expand() failed while expanding query domain.Resolver: Unknown query packet dropped. ("%s" does not match "%s")Resolver: Queried domain name: "%s"Resolver error: Query resource record truncated.Resolver error: Received unsupported query class: %u (%s)Resolver warning: Ignoring response with unexpected query type "PTR".Resolver error: Received unimplemented query type: %u (%s)Resolver error: Packet does not contain all specified resouce records.Resolver error: dn_expand() failed while expanding answer domain.Resolver: answered domain query: "%s"Resolver error: Resource record truncated.Resolver error: Answered class does not match queried class.Resolver error: Zero size rdata.Resolver error: Specified rdata length exceeds packet size.Resolver error: Unsupported rdata format for "A" type. (%u bytes)Resolver: Reverse authentication failed: %s != Resolver: Reverse authentication complete: %s == "%s".Resolver error: dn_expand() failed while expanding domain in rdata.Resolver: Answered domain: "%s"Resolver error: Domain name too long.Resolver error: Received unimplemented data type: %u (%s)Resolver: Ignoring resource type %u. (%s)Resolver error: No error returned but no answers given.Resolver: Received error response %u. (%s)Resolver error: Received reply from unknown source: %sResolver: Sent reverse authentication request for "%s".Resolver: Sent domain lookup request for "%s".Resolver: Cache record for "%s" (%s) has expired. (state: %u) Marked for expire at: %g, time: %g.Resolver: Send #2 for "PTR" query...Resolver: Send #3 for "PTR" query...Resolver: "PTR" query timed out.Resolver: Used cached record: %s == "%s". Resolver: Used failed record: %s == ??? Resolver: Added to new record. MD: mail destination (OBSOLETE)MB: mailbox domain name (EXPERIMENTAL)MG: mail group member (EXPERIMENTAL)MR: mail rename domain name (EXPERIMENTAL)WKS: well known service descriptionMINFO: mailbox or mail list informationqueried domain name does not existrequested query type not implemented%lid%luh%lum%lusNo nameservers defined. 127.0.0.1::1statmalloc() failed: %s Resolver: Lookup failed. %x.%x.%u.%u.%u.%u.in-addr.arpaquery class: %u (%s)rr class: %u (%s)Resolver: TTL: %sstatmalloc() error: %s Resolver: Host not found.Resolver: Socket error: %sUnknownQueryAnswerAuthority referenceResource referenceunknown classIN: the InternetCS: CSNET (OBSOLETE)CH: CHAOSHS: Hesoid [Dyer 87]unknown typeA: host addressNS: authoritative name serverMF: mail forwarder (OBSOLETE)CNAME: name aliasSOA: authority recordNULL: NULL RR (EXPERIMENTAL)PTR: domain name pointerHINFO: host informationMX: mail exchangeTXT: text stringno errorformat error in queryserver failurerefused by name serverunknown errorstandard queryinverse queryserver status requestunknown@@@Š18 J!\"nintŠŽŠ´ŠºÀ\"-#?$Q%cn©ÔnÊJË\7Š€CFKF# $V nN/ #Á  (À       €€ € J  ²ô ´À# µô# º n € ¿; ÁÀ# Ân# Ã;# ºK no 18 2J 4\ aV a  Ž w# ÈÇ ÊÇ Ì× Íç K× n Vç n a÷ n  Æ Ï#  áW ãÀ# äl# å‚# èW# 8g n  ïº ñÀ# òl# óa# ô÷# õa#  b÷      ýÌ ºn  ±D       ¾±            8 8Ènÿ  ü                           ! " # $ % & ' ( ) * ù ú û ü ý þ ÿ € €€ AY     þ ÿ €€´ e²g´#hY#iƒ#jƒ#kY#Ë1ÃØƒ#´#´#´#´# ´#(´#0´#8´#@´#H´#P ´#X"Î#`$Ô#h&ƒ#p*ƒ#t,‘#x0J#€1u#‚2Ú#ƒ6ê#ˆ?œ#H§#˜I§# J§#¨K§#°L#¸Nƒ#ÀPð#Ä´ ºÎ»Î#¼Ô#Àƒ#—à ºê n º n ºG2    H JH N 2 w w ˆ Ž ” ƒŽ } ‚ ÷ƒÌQ¥ « 2 Ô Ô ÷ƒ” ƒŽ Ú y z‚#{#8†o ‡#ˆo #‰ #Š#‹#Œ #‘¥ #0  n ƒ n Ÿ Ÿ ng \µ n8„Ô pad…Ô “ ºä n38h! iƒ#jƒ#kí#lƒ#n! #idp×#Dr1 #HsA #€tí#€u\#ˆv\#ˆw\#ˆx\#ˆ|Q #Œ~= #àš #考#ðƒ#ô‚â#ø_u”µ #€ 1 n ´A n ºQ nÿ ß a n 384J5n8÷ hfN gN #hN #iN #jN #kN # lN #(mN #0nN #8oT #@p´#Hipq‚ #Pidrl #`sa #b  ÁÅ idÂl #Ãa #Êa #Ðl #Ñl #Òl #Ól # Ô[ ù÷    `ƒ"`"` ¸ a§^!a"pc§#d ƒ‰$__s ´  Þƒ¾%sÞ´%dstÞ¾%afÞƒ‚ M§ùM§MƒM Cw %idCl aw D!a´#cw &ã_%rpãN >ƒ•$__s>´$__n>> &î¼%rpîN %ttlîŠ Wƒæ%xWæ!WíæŽ´Ž´Ž g´Gg´g &út%sút%lúƒ"rpüN "hpýz"eobþt"cÿt"ttlŠ"rƒ#ƒ"rrl #l #l #l #l #a '"__vJ"__xJ';"__vJ"__xJ'Y"__vJ"__xJ("__vJ"__xJa Å AøÖAƒA§$__nAAƒB²BÖo&¶%rp¶N !¶ƒ)(¢*;+G+Q,(a-;S./G/Q0÷ k- Ÿ1 2}Ó3p}§4Ÿ´!3dŸ´5ŸŠ6¡w 6¢w 6¢w 6¢w 6£Š7^³’*|*q8^±Á*|*q8^¯ð*|*q,^«-| Ÿ-q]9ºƒwb:setºbU:fdºƒTV;Àw¥:setÀbU:fdÀƒT;Æwâ:setÆbU:fdƃT;Ìw>3setÌb.#΃#΃9Ò´w‰3ipÒ¾<Õ‰  º™ n-=‰wÑ*œ*¦*²9èw5è #ê_>óƒw>øƒw2ÿ¯6ƒ"iƒ8‰)Ï*²*¦*œ8‰+*²*¦*œ8÷  2*1 7÷ Y*1 8÷ „*1 0÷ #- Ÿ1 45N ?rp7N ,÷ ;- Ÿ1 =ùw7- U9Iw w¨3ipI¾?pK´?iLƒ?lenLƒ6Mw =w×*++7;mwF@mN U?rpoN <pw T,ùr- uà;Œw¥:rpŒN U<Žw P,ù- uà2š 5šN ?rpœN #w 0Ÿ*+A+7;¹wŠ3rp¹N #»w 0½*+A+72ÈÜ5ÈN ?rpÊN 6Ëw 2ë3rpëN 6íw ;ùw]:rpùN U?irpûN ;wœ:rpN U?irpN ;6wË:rp6N U2Dý3rpDN 9NN wU3idNl ?rpPN <Qƒu ÿŸ4dN Ø5d´?rpfN 6gƒ0i*+A+74{N -3ip{¾?rp}N 6~w 2“^3s“´2šé3sš´5šƒ3idšl ?hpœz?rƒ?iƒBbufž·‘À{)D.*S0Dã*S)•Ç*¤*¯0•î*¤A1¯,_ô-ˆ ŸC}@-r Ÿ=¼w*Ï-ÙU0¼W*Ù*Ï2õ3ipþ3bufô?pı?bÅ´?iƃ0^É-| Ÿ*q)GW%*V*`/j/u/€/Œ/–/¢/¬/¸/Ã/Ï/Û/ç/ó0Gú*`*VA+j+u+€+Œ+–+¢+¬+¸+Ã+Ï+Û+ç/óDÝ ++Dù +"+.D!+@+LD1!+Z+f8_Ui!*ˆ*}*r8_¡!*ˆ*}*r7_-Õ!*ˆ*}*r8_g "*ˆ*}*r8_uE"*ˆ*}*r8_ê}"*ˆ*}*r7_ñ±"*ˆ*}*r8_‹é"*ˆ*}*r7_«#*ˆ*}*r7_¸Q#*ˆ*}*r8ó»€#**7^?«#*|*q8_\ã#*ˆ*}*r8_Ñ$*ˆ*}*r8_˜S$*ˆ*}*r8_›‹$*ˆ*}*r8Úº$*;*07_Àî$*ˆ*}*r8_²&%*ˆ*}*r,÷ à1 - Ÿ2-`&?r/ƒ?i/ƒ<0‰ 7€2&-Ê Ÿ*¿E´C©-ž Ÿ*“8_H;&*ˆ*}*r0_P1ˆ1}1r2 _'?rƒ?iƒ7€ö&-Ê Ÿ*¿E´C©-ž Ÿ*“7_('1ˆ1}1r,_"-ˆ ŸC}@-r Ÿ)ÜK(*ë*ö7ܶ(*ö*ë7_Ðà'1ˆ1}1r0^Â-| Ÿ-q Ÿ,_»*ˆ*}*r2dÍ(5dí?rpfN 6fN 0_n*ˆ*}*r2×)3rp×N 5׃4’´¸)3ip’¾?rp”N 7_¡‡)*ˆ*}*r0_š*ˆ*}*r4¸´ü)3ip¸¾?tº´9ÒwQ*5Ò 3afÒƒ?lenÓƒF¥ÔF¦ÔF§ÔGdns>ƒF@ƒF~‚ GafOƒF„1  ´È* nF¸* ´å* nF¥Õ* w + n€Hò* N !+nÿH+H+H+HN H N IH ‚ H‚ H‚ HæHƒJmemw Hw Hw Hw H w H!w H"w H#w H$w H&w H(ŠH)ŠH,H-Ÿ H2‚ H3²H5ƒH7ƒH9o ºÎ,n@H;½,H<H=H>H@ÚHHä F¥ÔF¦ÔF§ÔGdns>ƒKBƒ L~‚  GafOƒ ´Ÿ- nL|- L„1  L¸* L¥Õ*  ´. nL®÷- Kò* K+ K+ K+ KN  K N  K ¾. g+K ¾. K ‚  K‚  K‚  Kæ Kƒ Mmemw  Kw  Kw  Kw  K w  K!w  K"w  K#w  K$w  K&w  K(Š K)Š K, K-Ÿ  K2‚  K3² K5ƒ K7ƒ K9o K;½, K< K= K> K@Ú KHä  % : ; I$ > $ >   I : ;  : ; I8 I !I/  : ;  (  : ;  : ;  : ; I&I!I/ : ; : ; : ;I8 : ;  : ; ' II : ; I : ;  : ; I8  : ; I 8 .? : ; ' I 4 : ; I .? : ;' I !: ;I"4: ;I#4: ;I$: ; I%: ;I&.? : ;' ' ( ).1@*1+41,1X Y-1 . /4101RUX Y112.? : ;' @3: ;I4.? : ;' I@5: ;I64: ;I71RUX Y81X Y9.? : ;' I@ :: ;I ;.? : ;' @ <4: ;I =.1@ >.? : ;' I@ ?4: ;I@: ;I A UB4: ;I C1D UE1 F4: ; I? < G4: ; I? < H4: ;I? < I< J4: ;I? < K4: ;I?  L4: ; I?  M4: ;I?  w!w!"w"SwU !S"SSP pŸ &PuŸ!sŸ"SsŸ`dwd‰w‰w”w”•w•Õw`…U…uŸŽ«UµËUàwÔw0ÔØwØ£w0àüUüÐ]ÐÕPÕ£]à¦TÕæT}”T urŸ GUGiXÕæUG¹Sæ£Si¹Væ£V޹\æ£\˜›qrŸ›¦Q}QXø Ÿø}p"ŸU(M Ÿ(C}p"ŸCGUX} ŸXs}p"ŸswU@KUPYUYgTpuUuPp{T{QpxQxU€„U°±w±²w²¶w¶Äw0ÄÅwÅÆwÆÐwÐw0wwwÁw0Z‘\zÁ‘\2Ÿ Ÿ Ÿ£:Ÿ£ Ÿ£ ŸBJ Ÿpz Ÿ†Ž ŸÐÔwÔ*w*0w0:w:@w@ØwäP­TðU?UðU0Ÿð0Ÿq2$"=Yð0Ÿ",Q,/X6=P@ZUZquŸq|U@I0Ÿ]gQgmTqzP•Ÿt3$"Ÿ&P&?t3$" ¢w¢§w§¬w¬­w ­®w(®n w0n o w(o q w q { w{ } w} € w€ ± w0 »U¾ýUý{ ]{ } ~3$"~ ± ]óý~3$"ýn S~ ± S²¾uȾÈRÈàrŸàëR²¾0ŸÍàPàë^À Ç UÇ / Y0 M YÏ Ó yÈÓ â Râ ù rŸù / R0 M RÏ Ó 0Ÿå ï Pï õ Xù  TP R wR T wT X wX ] w ] d w(d  w0  w(  w   w  w w U w0P ` U`  \  }3$" U \t ~ p3$"~  S U St ~ P~  ] U ]` a wa – w–   w  ¾ w` h Uh – S— ¾ Sm { P— ¾ PÓ = P‡  P  ¡ w¡ Ä wÄ Ð wÐ Ñ wÑ Ò w  ¨ U¨ Ä SÄ È UÉ Ñ Sà ö Uø MUñ ø r3$"ø JPKMr3$"PRwRWwW[w[\w \`w(`w0w(w www"w0P®U®\"\§®}3$"®S Sœ]"]PmUmzRz‘rŸ‘œRPm0Ÿ}‡P‡T‘œ]02w23w37w7Åw ÅÆwÆÈwÈÉwÉÍw 0;U;ÆVÉÍVGNp3$"NÁSÉËSGNPNÈ\ÉÍ\ÐÔwÔðwðõwÐßUwwww w(&w0&õwàõöw0ö÷w(÷ùw ùûwûýwýwdwàU_Q T _XQlÛ]þN]f…P…¾\¾Û^þ)^)_\y…0Ÿ¢ªVª¾0ŸÌÛPptwt~w~€w€œwœ¡wpzUˆUˆU°¶w¶âwâèwèww°ÖUÖâSãS°ÖTãS <aMea8MUeqU8<a€‚w‚‡w‡ŒwŒw ˜w(˜ów0óôw(ôõw õ÷w÷ùwùúw€˜U€˜T˜ù]€˜T˜¼V¼×Uרv|ŸØõV€˜?Ÿ¤¼V¼×U×õv|Ÿ*w*>w >HwHÏw ÏÐwÐUw U`w`–w –›w›w 2U2 SC¡SÐ$SZS‘˜¾S¾Å‘˜ÅÏSÏ‘˜HTHúVC¡VÐÚTÚ$VZÝVAHTHúVC¡VÚ$VZÝVA SC¡SÚ$SZS‘˜¾S¾Å‘˜ÅÏSÏ‘˜OgPg \C¡\Ú$\Z\‘°¾\¾Å‘°ÅÏ\Ï‘°²ú v $ &s"ŸC¡ v $ &s"Ÿ $ v $ &s"ŸjÝ v $ &s"Ÿ² s ŸC¡s Ÿ $s Ÿjös ŸöVvŸ~~Ÿ´V´À^œ^œ¯~Ÿ¯É~ŸÉÔ~ŸÔŒVI¾s Ÿÿ V»V»ÅvvŸÏÙVrV›ÔV0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿç64p8$8%H$q8$8%@$!v|”8$8%8$!v}”8$8%! $ &Ÿÿ 0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿ#0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &ŸÏÙ0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿ^nPn ^Ýú^çòPòªSz”P”Sˆ¾^¾àPàÿS P»ÅSÙSÊÔPÔSJpp $0)Ÿpyz $0)Ÿäèps ”"ŸèP´‘¢´À‘¢”1ŸÀ‘¢¾‘¢Fvv”8$8%8$u!Ÿ¯ç~”8$8%8$~”8$8%!Ÿçlvv”8$8%8$vw”8$8%!Ÿÿs8$8%8$u8$8%!Ÿ s8$8%8$~”8$8%!ŸTs8$8%8$u8$8%!ŸTZs8$8%8$vw”8$8%!ŸÏÔs8$8%8$u8$8%!ŸÔÙs8$8%8$vw”8$8%!ŸFXÉQXVlXÿ X@X@»^ÏÙXkQkI‘¦¾‘¦*I‘¤¾‘¤‚ÚPC]P]tXtŽsÚúP PZyP|ÄPÄÈs_ÚsCŽsÚús sZys|Ès†ÚQC~Q~ŽsÚúQ QZyQ|™Q™Ès†ÚsCŽsÚús sZys|Ès’ÚRCyRyŽsÚúR RZyR|–R–Ès’ÚsCŽsÚús sZys|Ès–ÚTCƒTƒŽs ÚúT TZyT|“T“Ès –Ús CŽs Úús s Zys |Ès Õ  ŸÕ  @ŸÕ  Ÿj¡ Ÿj¡ @Ÿj¡ ŸÝ ŸÝ @ŸÝ ŸR ŸR @ŸR Ÿ­Ü Ÿ­Ü @Ÿ­Ü Ÿ… Ÿ… @Ÿ… ŸGV ŸGV @ŸGV ŸN‰ ŸN‰ @ŸN‰ Ÿv« Ÿv« @Ÿv« ŸãN ŸãN @ŸãN Ÿ,PN ŸIˆ ŸIˆ Ÿˆ¾ Ÿˆ¾ @Ÿˆ¾ Ÿ¾ÿ Ÿ¾ÿ @Ÿ¾ÿ Ÿ6» Ÿ6» @Ÿ6» Ÿ‚» Ÿ‚» @Ÿ‚» ŸÙò ŸÙò Ÿ.› Ÿ.› @Ÿ.› Ÿ›Ê Ÿ›Ê @Ÿ›Ê Ÿw-w-3w3Úw ÚÛwÛåwåðwð¡ w ¡ ¢ w¢ ¤ w¤ ® w=\P\å\åéTê¤ \e|0Ÿ¥­SÕÚSê 0Ÿ8 D S7 7 l n Ÿl n  @Ÿl n Ÿ° ² w² Í wÍ Ó wÓ t!w t!u!wu!!w!ˆ!wˆ!"w ""w""w""w"*"w Ý !P!!\!ƒ!T„!"\"*"\ !!0Ÿ7!;!Sk!t!S„!Ž!0Ÿ™!!S"*"S° × ° × 0"1"w1"8"w8"J"w J"K"wK"P"wP"´"w ´"º"wº"À"wÀ"9#w 0"A"UA"K"SL"º"S¿"9#S0"F"TL"d"T¿"É"TÐ"Ü"Tù"#TL"•"<Ÿ¿"Ð"<Ÿù"9#<ŸL"•"S¿"Ð"Sù"9#Sí"ù" Ÿí"ù" @Ÿí"ù" Ÿ@#B#wB#D#wD#F#wF#J#w J#K#w(K#O#w0O#\$wà\$`$w0`$a$w(a$c$w c$e$we$g$wg$p$wp$D%wàD%E%w0E%F%w(F%H%w H%J%wJ%L%wL%M%w@#ƒ#Uƒ#c$\c$k$Ul$H%\V#ƒ# ƒ#ö#Sö#$V$6$S6$X$Vl$@%S#´#s´#X$Vl$@%Vé$@% Ÿé$@% @Ÿé$@% ŸP%R%wR%V%wV%W%wW%½%w ½%¾%w¾%À%wÀ%Å%wP%Z%UZ%½%S½%Ä%UP%Z%TZ%À%\À%Ä%TÐ%æ%wæ%6&w06&@&w@&m'w0Ð%ê%Uê%2&\7&m'\ñ%û%Pû%(&S7&ô&Sô&'P'm'S]&„& Ÿ]&„& @Ÿ]&„& Ÿ™&Ë& Ÿ™&Ë& @Ÿ™&Ë& Ÿp't'wt'Ÿ'wŸ' 'wp'„'U…'›'P '·'U '¤'T¤'·'Q '³'0Ÿ,¸'.58KØðý J]pzŽ¡·Á¢¥²ë¢¥²ëÇ Ì Ï  Ç Ì Ï  RU`œRU`œ€˜œ¡è è 8Phj¤¸ÃÇÍØAH¡à'Uh–AH¡à'Uh–cgos‚gkswkow{{†Š™£®ÉªGVmsv‘ÚàãþUZ`o|ˆ&+.N,-238| ‚ …   ² Ì Í Ò Ó Ø Ü!â!å!"P"°"´"¹"º"Ð"#9#Œ"’"•"°" ####%#*#-#9#í$ %%1%T&Z&]&x&&–&™&¸&ã û /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arpadns.cstdio2.hstring3.hsocket2.htypes.htypes.hstddef.hselect.hsocket.hsockaddr.hstdint.hin.hnameser.hnetdb.hstdio.hlibio.hresolv.hmtr.hnet.h áp ALY\ H.]@óK,K=œ>rJ]jSJ.ƒ­f<’Öf<’mLIKYKNƒrtIKK‘K Jƒóƒ2¸Ì ‘ƒ‘¨ä òJ.6<”FJ×IL-=H>¸;¬ƒÉò<’ºò<’ùLIKYKOIƒrtIKK‘K fø?¨JØX¨<‘K,K=œ>rÙž ‘ƒ‘KSÖ †F$8NY>¼gIMG”ÉgIMG”_KWZ‘KNƒròIYY‘K fÜ ?‘ ‘ƒ‘K§ä ‚vf<ƒguK=tƒrJK;L‘?Qƒw ¾uƒØƒ°æX<מX‚ƒYuK=tƒrK;L‘?Qƒw ¾uƒØƒ°K;YiYMƒVuƒz ò =Yƒƒu=»öåf<’Öf<’gƒ„1j€~.€<€~¬óK,K=œ>r…¬­‘ò<’º<<’õ‡yÖ  xY>’LH“ÉLH“Yˆ{K»»I÷]™‡}yS3;=m€Z”9„©(žv;i¬tjf<2%z0väŸX0KlbKYŸYIAV!I>KY¢Êxt¶%ã Ÿ×× í5aˆâò¼:ÙtJ¨ <Ùt<§ JÙtf¦ ¬ÚtX¬  ­| *=Wj—ƒ;=j¤FKKHKKKGwKGKKKj”–æ‘÷YWvf<qXK J”Ì <B;uY;AUWjƒ'Éíwò–/²º~.žÚž¾vtÅ %Ÿ„~/òîvòëò¼ƒ <w.¤~¬Úòî³~ò”xìž”x¬îž,<Ú>V=ÌÉYɃÚwä©%  ºÌwä·% g<^¬ kfk.XjY;È×v¬³ %†žÀWuY;/jÉ'\b@·wJË,ægÍ’åVidZ f”nòÇÖóÐv¬êä–wfêf–w<ëž•¤Ÿ‰wž÷f‰w<ùž/Õwž¬  Wƒ žuY;/¾Ú¿”óÉ;KŠwfûÈŸåˆXgWPÈãwºXãwfäãwȺœ'äwä‘ ,PJ`žž©w#Ù%Ÿ¦wºÜ%Ÿržlž*žÃwžì‚k‚ŸWwºÿXw< ä WƒÅ<».ývXó%žž‚wºÿžÍJŸv.á Ÿv á XŸv ç X,>h"ÖËeH"s‘I Èx J)‡)r¬xž`‘“s‘I'MræHùuX‡ f|ñuº fñu<’ žH¼ºÀv.À Àv À XÀv Å X,>hV®d0½HÊs/IÁi ‚)‡)w‚Ês/I J™vºç f™v<ê žHzºsŸv‚á f•}¬ƒ—Xkž</»ñxfñx<”žG[xfoòɇyò.àx XàxX žàx‚ Xàx<à .çÀzfZW=tÉŸKó;É­e‚XXéÜu‚%žvI=hÉŸK JŸƒóƒdfƒÒuJ­ äÓu<° òäÉ|òô,;vK:vŸƒgI´ò[Jo.KJ‘ käk)K u‚à f u<â žwò§u‚Ù f§u<Û ÖØ ž Zƒ›=KƒeÉYƒ½+YƒÉ®uX× #M»YXX0 _filenosocklen_t__streamns_r_badsigqdatatypens_t_keysize_tns_r_formerrsa_familysockaddr_in6__ssize_t__fmtns_t_wksdns_eventsns_t_ixfrsin_familysin_addr_IO_save_endns_t_srvns_t_nimlocns_o_maxSOCK_RAWns_t_minfosin6_addr_IO_write_baseaddr2hostdns_lookup2dns_waitfdstate_lockretranslastlogfrom_sastruct_IO_save_baselastlinkresolvestreamlogdns_forwardopcodes_chainssize_tss_familyns_t_invalidaddr2ip6arpabashnumdiffnamestringns_t_dnameSOCK_DCCPlong intSOCK_RDMdaysns_t_nullns_s_nsclassu_char_IO_markerns_r_nxdomainns_c_chaosres_reversesuccesswordns_t_optres_resendnullstringns_t_aaaa_initstampstrlongipresolvesigned charns_t_a6uint8_t_IO_FILESOCK_SEQPACKETns_s_prprevioushostsendrequest__fds_bits_vcsockunsigned charh_aliasesns_t_nxtlocalhost6packetheader__ns_classns_s_qd__off64_tsin6_scope_idfromlongipstrgethostbashallocresolvepreviousid__socket_typens_o_notifypreviousipcharSOCK_STREAMns_r_badkey__ss_alignndotsns_t_zxfrunusedns_t_maxnsaddr_list_IO_lock_tns_t_naptrsockaddr_inns_r_badverssin_portns_t_cnameh_addr_list_IO_read_ptridseedns_t_anysin6_port_pos__socklen_tdatabyte_adatabyte_b_cur_columnns_o_statusfrom4from6ns_r_notauthsin_zero__u_intres_send_rhook_markersaddrstrdns_opendwordns_t_aplaseedres_timeout__fd_maskgetidbashunlinkresolvehostns_o_queryarcounthostentin_addr_tdns.cidbashipv6_unavailns_s_ud__flags_offsetns_t_nsapstatmallocres_nserrorns_t_hinfofailrp__ns_opcode_exth_name__res_statesendstringnsaddrsns_t_atmaunspec_addrlong unsigned intres_goaheadstrcpy_flags2retryh_lengthresendrequest_IO_read_basens_t_amyresns_s_maxoption_unused2res_modifiedtempstringns_t_txtsprintf_old_offsetrdatalengthns_r_noerrorsnprintf__bufh_addrtyperes_h_errnouse_dnsres_send_qhook__u6_addr8__chlong long intgetipbashsigneddiff__d0__d1loglineqdcountns_t_ptrclearsetresolvecountdoubleres_erroripbash_IO_write_end__u_charmaskns_t_loclastresolveusefulanswerfloatu_longsecondsns_r_notzonens_t_nsap_ptrns_s_znaddrclasstypesdns_lookupdefdname_IO_buf_baseresponsecodesunsigned intistimenextidns_t_kxnextipns_t_certsintervalresfd6ancount__pad1__pad2u_int__pad4__pad5_sbufstackstringstdinns_r_maxSOCK_NONBLOCKdnsrchminutesrecvfrom_flagsresrecvbufresfdSTATE_PTRREQ1STATE_PTRREQ2STATE_PTRREQ3_modensinitlinkresolveu_int16_tin6_addrns_t_mbns_t_mdns_t_mfns_t_mgns_r_notimplalignedipns_t_mrtypefromlenns_t_mx__addrunlinkresolvens_o_iquerypreviousresourcetypesrrtypessin6_familyns_c_invalidSTATE_FAILEDFILEres_nxdomainqhookns_t_nsres_donestrtdiffSOCK_DGRAMns_t_tsig__fdsizelong long unsigned int__ns_rcodesa_family_tlinkresolveidns_r_servfailissetfduint16_tlinkresolveipdatatype__off_tbashvalueres_unknownidns_t_gposns_r_yxrrsetsa_datans_s_anns_s_arns_t_pxmallocsizestatfreedebugsockaddrhostnamememsetns_t_signssockslocalhostres_sendhookactuntieresolvenscount6_IO_backup_base_shortbufns_t_afsdbns_t_mailans_t_mailbdns_waitfd6_next/home/wolff/mtrdns_ackin_addrfindidns_r_refusedfindipnexthostSTATE_FINISHEDunlinkresolveidnsortsort_listunlinkresolveip_IO_buf_endns_t_rpns_t_rthostlinkresolvehostSOCK_CLOEXECnamefprintf__srcbyteSOCK_PACKET__ss_padding__lenns_r_yxdomainsockaddr_storagestderrshort intu_int32_tnsmapns_o_updatedns_ack6rhook__addr_len_vtable_offsetres_hostipmismatchns_r_nxrrsetip_t__destpfcodenextrpclearfdsetfdfd_set__u_shortqclassexpireresolveshostbashns_c_hs__ns_type_IO_read_enddorequestGNU C 4.6.1s_addr__u6_addr16sweeptime__u_longuint32_thoursns_c_inns_c_maxns_r_badtimefindhostns_c_noneexpiretimens_t_x25ns_t_eid__ns_sectns_c_anystrcatshort unsigned intstdoutns_t_sinkns_t_soa_IO_write_ptrns_t_tkeyres_iplookupsuccessres_nextnsu_shortnscountparserespacketoptionsns_t_isdn__u6_addr32sin6_flowinfonextns_c_2__pad3restellpassrpaddrpin_port_tns_t_axfr__in6_uGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx SHƒY A 8uDe G D A XÃKZ0Œ†ƒÏ D |)+¤-¸ Ìàô40A†AƒD0N AAJ > AAA hDV F J F Œ  O´<È¿ÜV<ðBŽEE ŒA(†A0ƒÀ (A BJBC 08DBBŒD †E(ƒG0° (A ABBF €^Aƒu J œ¦°ÖÄIØ2Aƒc L Aøm8 ÒBEŒD †A(ƒD0´ (D ABBA ,HBŒA†D ƒŽ ABA x%D\@dBŽOB ŒA(†A0ƒQàÏ 0A(A BBBC Ô1DJ B \ôhFƒl F fQ4(zBEŒE †D(ƒH0[(A ABB<` M†ƒ] ŽŒ J ‡ A … K 6 E 4 žBŒ[†F ƒ§ AJK ±AB8ØzBŒ[†F ƒ¡ AJI y ABL ( AƒG R AE d FF T@ BŽBB ŒD(†A0ƒD`  0D(A BBBI Ô0A(A BBB(˜uBŒD†A ƒfAB ÄMŒƒI0†P J è0Dk.symtab.strtab.shstrtab.rela.text.rela.data.bss.rodata.str1.8.rodata.str1.1.rela.rodata.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @¸'Àÿè2+(À &¨21À)î 62À)M E2 6#Y@9¤ T°6xaè9 s:Ž1n(70] –k’²oÍIX”Ø¢¹00›0±¯¹àÄÁç ¿`›Ð0vÍáÛ0WÝ+ä‚ÝùˆÝôx›8˜ãàëp Púoñÿ€.@$À.,€$   7 = C I OSZP^ev†”™`u¢§®´àýÄÒ°)Úà+à-è@ ñPûþp€(6AòÿG SòÿZ°cgòÿ 8my€‹òÿ•òÿ ¥¬òÿ²òÿ ¹òÿ ÂÐÏà ÙðOã@<ý@V  (À :P Hòÿ OW` ^gÀ ¦sx‚pŽ›p Ö«P I¸  2Æà mÍPÒÖ0ÝÐ%åëñdû "p1)X/°h6òÿ@òÿ @KZ Qa€zn }òÿ ‰òÿ ” `8®0º È8Õ€0àÀîòÿ ùòÿ (+2HFS^@qžz‡òÿ ’›¡òÿ­° zµ»Å0" Ó@# ÞéõP%u Ð%p'0' '1?òÿ €M`Uh_@(g  dns.caddrstr.6338CSWTCH.133addrstr.6595CSWTCH.147.LC18.LC66.LC64.LC71statmallocmemmalloc__errno_locationstrerrorstderr__fprintf_chkexitstatfreefreefwriteabortstrtdiffstrlen__sprintf_chkissetfdsetfdclearfdclearsetstrlongipafinet_ntoplongipstrinet_ptondns_forwardgethostbynamedns_waitfdresfddns_waitfd6resfd6dns_opendnsmyres__res_ninitsocketsetsockoptlocalhostlocalhost6timegetpidaseedidbashhostbashallocresolvegetidbashgetipbashgethostbashlinkresolveidunlinkresolveidlinkresolvehoststrcasecmpunlinkresolvehostlinkresolveipipbashaddrcmpunlinkresolveiplinkresolveexpireresolveslastresolveresolvecountlastlinkresolveuntieresolveunlinkresolvefindidfindhostfindiprestellfputsfputcdorequest__res_nmkquerysendto__stack_chk_failfailrpdebugpassrpsweeptimetempstring__snprintf_chkistimeaddr2ip6arpaparserespacketstackstringnamestring__dn_expandresponsecodesres_nserrorres_unknownidres_nxdomainclasstypesresourcetypessendstringalignedipaddrcpy__strcat_chkres_hostipmismatchstrcpyres_iplookupsuccess__strcpy_chknullstringres_reversesuccessdns_ack6fromfromlenresrecvbufrecvfromfrom6unspec_addrdns_ackfrom4inet_ntoaresendrequestdns_eventsres_resendres_timeoutsendrequestidseeddns_lookup2dns_lookupuse_dnsaddr2hostgethostbyaddrfrom_sastructlastlogstreamlogrrtypesopcodesüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ#üÿÿÿÿÿÿÿ*üÿÿÿÿÿÿÿ1 üÿÿÿÿÿÿÿ; G!üÿÿÿÿÿÿÿO"üÿÿÿÿÿÿÿ}üÿÿÿÿÿÿÿ˜ üÿÿÿÿÿÿÿ§ (¬%üÿÿÿÿÿÿÿ±&üÿÿÿÿÿÿÿ¸ üÿÿÿÿÿÿÿÇ PÌ%üÿÿÿÿÿÿÿÑ&üÿÿÿÿÿÿÿô(üÿÿÿÿÿÿÿ )üÿÿÿÿÿÿÿ$(üÿÿÿÿÿÿÿ1  D)üÿÿÿÿÿÿÿT(üÿÿÿÿÿÿÿa t)üÿÿÿÿÿÿÿ„ š)üÿÿÿÿÿÿÿU/üÿÿÿÿÿÿÿ_ €’6üÿÿÿÿÿÿÿ¢8üÿÿÿÿÿÿÿ¸:üÿÿÿÿÿÿÿÑ ;Ö<üÿÿÿÿÿÿÿÜ; ÷;=üÿÿÿÿÿÿÿ 6üÿÿÿÿÿÿÿ"=üÿÿÿÿÿÿÿ-8üÿÿÿÿÿÿÿ96üÿÿÿÿÿÿÿ[>üÿÿÿÿÿÿÿi8üÿÿÿÿÿÿÿƒ>üÿÿÿÿÿÿÿ ?• -Ÿ2üÿÿÿÿÿÿÿ¤ @© 7³2üÿÿÿÿÿÿÿºAüÿÿÿÿÿÿÿÄAüÿÿÿÿÿÿÿÐBüÿÿÿÿÿÿÿáCüÿÿÿÿÿÿÿë Dö E üÿÿÿÿÿÿÿ (%üÿÿÿÿÿÿÿ2"üÿÿÿÿÿÿÿ7üÿÿÿÿÿÿÿ>üÿÿÿÿÿÿÿC €M üÿÿÿÿÿÿÿY!üÿÿÿÿÿÿÿ`"üÿÿÿÿÿÿÿeüÿÿÿÿÿÿÿlüÿÿÿÿÿÿÿq È{üÿÿÿÿÿÿÿ‚üÿÿÿÿÿÿÿ‡ ‘ üÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿ§"üÿÿÿÿÿÿÿ¬üÿÿÿÿÿÿÿ³üÿÿÿÿÿÿÿ¸ XÚüÿÿÿÿÿÿÿªüÿÿÿÿÿÿÿ±üÿÿÿÿÿÿÿ¸ üÿÿÿÿÿÿÿÀ ;Ì!üÿÿÿÿÿÿÿÔ"üÿÿÿÿÿÿÿò/üÿÿÿÿÿÿÿ @‘ Dõ D! D: DM D… Dï E Müÿÿÿÿÿÿÿ0 MüÿÿÿÿÿÿÿL Müÿÿÿÿÿÿÿu E E= Ee Hüÿÿÿÿÿÿÿm P‚ /üÿÿÿÿÿÿÿŽ Qüÿÿÿÿÿÿÿ² /üÿÿÿÿÿÿÿ¾ QüÿÿÿÿÿÿÿÕ /üÿÿÿÿÿÿÿá Qüÿÿÿÿÿÿÿ Pi Hüÿÿÿÿÿÿÿq P­ Pà Tüÿÿÿÿÿÿÿ Uüÿÿÿÿÿÿÿ Vûÿÿÿÿÿÿÿ. Vûÿÿÿÿÿÿÿ7 TüÿÿÿÿÿÿÿR UüÿÿÿÿÿÿÿY Tüÿÿÿÿÿÿÿ` Vûÿÿÿÿÿÿÿs UüÿÿÿÿÿÿÿÛ Uüÿÿÿÿÿÿÿâ Vûÿÿÿÿÿÿÿ Vûÿÿÿÿÿÿÿ Tüÿÿÿÿÿÿÿ2 Uüÿÿÿÿÿÿÿ9 Tüÿÿÿÿÿÿÿ@ Vûÿÿÿÿÿÿÿn Vûÿÿÿÿÿÿÿ{ Uüÿÿÿÿÿÿÿ‚ Vûÿÿÿÿÿÿÿ“ Tüÿÿÿÿÿÿÿ¥ Xüÿÿÿÿÿÿÿ­ Küÿÿÿÿÿÿÿµ Rüÿÿÿÿÿÿÿí D< D£ E¸MüÿÿÿÿÿÿÿäMüÿÿÿÿÿÿÿMüÿÿÿÿÿÿÿ  E8Hüÿÿÿÿÿÿÿ@ PR/üÿÿÿÿÿÿÿ^Qüÿÿÿÿÿÿÿ‚/üÿÿÿÿÿÿÿŽQüÿÿÿÿÿÿÿ¥/üÿÿÿÿÿÿÿ±Qüÿÿÿÿÿÿÿ½ P× üÿÿÿÿÿÿÿÜ^üÿÿÿÿÿÿÿã üÿÿÿÿÿÿÿ ;\aüÿÿÿÿÿÿÿo;| ;›;¬; µ ;Ò; 6üÿÿÿÿÿÿÿ ;#büÿÿÿÿÿÿÿ28üÿÿÿÿÿÿÿEbüÿÿÿÿÿÿÿQ  V]üÿÿÿÿÿÿÿ`cüÿÿÿÿÿÿÿ…Xüÿÿÿÿÿÿÿ‹eüÿÿÿÿÿÿÿ” TÁgüÿÿÿÿÿÿÿÓXüÿÿÿÿÿÿÿÙeüÿÿÿÿÿÿÿí hó È iüÿÿÿÿÿÿÿ h$üÿÿÿÿÿÿÿ.güÿÿÿÿÿÿÿ¨ nÔ)üÿÿÿÿÿÿÿ. ðEZüÿÿÿÿÿÿÿÍeüÿÿÿÿÿÿÿà Pî ˆ/üÿÿÿÿÿÿÿ* m/küÿÿÿÿÿÿÿE nNnûÿÿÿÿÿÿÿToüÿÿÿÿÿÿÿ_ md °ˆ n m­ m³ n¹MüÿÿÿÿÿÿÿÈeüÿÿÿÿÿÿÿÖ hÜ mâ øû niüÿÿÿÿÿÿÿ hYp,f pp à„ h‹iüÿÿÿÿÿÿÿ h•]üÿÿÿÿÿÿÿœqûÿÿÿÿÿÿÿÑ 0á ˆñ Xrûÿÿÿÿÿÿÿeüÿÿÿÿÿÿÿsûÿÿÿÿÿÿÿa Øq ßv]üÿÿÿÿÿÿÿ ¨Ÿ ¾ hÅiüÿÿÿÿÿÿÿÊ hÏ]üÿÿÿÿÿÿÿßeüÿÿÿÿÿÿÿï h;t$N tW h]  siüÿÿÿÿÿÿÿx h}]üÿÿÿÿÿÿÿ–u„© u² h¸ (ÎiüÿÿÿÿÿÿÿÓ hØ]üÿÿÿÿÿÿÿ,eüÿÿÿÿÿÿÿpu„ u‹ 8 h¦iüÿÿÿÿÿÿÿ« h°]üÿÿÿÿÿÿÿÌ nØnûÿÿÿÿÿÿÿÞoüÿÿÿÿÿÿÿî m  n m1 m7 n=MüÿÿÿÿÿÿÿCeüÿÿÿÿÿÿÿP nV øj hviüÿÿÿÿÿÿÿ{ h€]üÿÿÿÿÿÿÿeüÿÿÿÿÿÿÿ2u„C uM xZ vi'üÿÿÿÿÿÿÿo µ† hiüÿÿÿÿÿÿÿ’ h—]üÿÿÿÿÿÿÿ·/üÿÿÿÿÿÿÿÄQüÿÿÿÿÿÿÿÖ.üÿÿÿÿÿÿÿÜ @ó húiüÿÿÿÿÿÿÿ/üÿÿÿÿÿÿÿ w xüÿÿÿÿÿÿÿ w.üÿÿÿÿÿÿÿ$ h)yüÿÿÿÿÿÿÿ. h3]üÿÿÿÿÿÿÿ?zûÿÿÿÿÿÿÿEdüÿÿÿÿÿÿÿZ nknûÿÿÿÿÿÿÿqoüÿÿÿÿÿÿÿˆeüÿÿÿÿÿÿÿº nÎüÿÿÿÿÿÿÿå ní{üÿÿÿÿÿÿÿ÷Lüÿÿÿÿÿÿÿfüÿÿÿÿÿÿÿ |ûÿÿÿÿÿÿÿ3eüÿÿÿÿÿÿÿ8 àV uk m)üÿÿÿÿÿÿÿŠ n @¤ h«iüÿÿÿÿÿÿÿ° hµ]üÿÿÿÿÿÿÿÀ nÆ ðÚ hæiüÿÿÿÿÿÿÿë hð]üÿÿÿÿÿÿÿ   °t$2 t< ŽP hWiüÿÿÿÿÿÿÿ\ ha]üÿÿÿÿÿÿÿmt$~ tˆ £œ h£iüÿÿÿÿÿÿÿ¨ h­]üÿÿÿÿÿÿÿ² P¼  Æ hÐ ¸ß nä mé}üÿÿÿÿÿÿÿó ý]üÿÿÿÿÿÿÿ ~".üÿÿÿÿÿÿÿ0 p? hJiüÿÿÿÿÿÿÿO hT]üÿÿÿÿÿÿÿ`ûÿÿÿÿÿÿÿœ h¦ ø¼iüÿÿÿÿÿÿÿÁ hË ¨ÕüÿÿÿÿÿÿÿÜüÿÿÿÿÿÿÿã üÿÿÿÿÿÿÿë Ç÷!üÿÿÿÿÿÿÿÿ"üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ8üÿÿÿÿÿÿÿ# ‚. ƒ4„üÿÿÿÿÿÿÿF…üÿÿÿÿÿÿÿP @YQüÿÿÿÿÿÿÿh;t ;Š †“Qüÿÿÿÿÿÿÿž;°…üÿÿÿÿÿÿÿÆQüÿÿÿÿÿÿÿÑ;ß ƒõ;û ; …üÿÿÿÿÿÿÿ& Qüÿÿÿÿÿÿÿ1 ;G …üÿÿÿÿÿÿÿQ À_ 0üÿÿÿÿÿÿÿe  q üÿÿÿÿÿÿÿx üÿÿÿÿÿÿÿ~ ù† hœ iüÿÿÿÿÿÿÿ¥ hµ üÿÿÿÿÿÿÿ½ 6üÿÿÿÿÿÿÿà ‚Î ƒÔ „üÿÿÿÿÿÿÿæ ˆüÿÿÿÿÿÿÿð ?þ Qüÿÿÿÿÿÿÿ!; ! †&!Qüÿÿÿÿÿÿÿ0!; >!ˆüÿÿÿÿÿÿÿQ! ;]!Qüÿÿÿÿÿÿÿg!; y! ƒ’!;  !ˆüÿÿÿÿÿÿÿ³! ;¼!QüÿÿÿÿÿÿÿÑ!üÿÿÿÿÿÿÿØ!üÿÿÿÿÿÿÿÞ! ùæ! hü!iüÿÿÿÿÿÿÿ" h"ˆüÿÿÿÿÿÿÿ"‰üÿÿÿÿÿÿÿ!"  R"/üÿÿÿÿÿÿÿn" hs"`üÿÿÿÿÿÿÿz"eüÿÿÿÿÿÿÿˆ".üÿÿÿÿÿÿÿŽ" € –" h¬"iüÿÿÿÿÿÿÿµ" hÅ" hÊ"küÿÿÿÿÿÿÿÙ"`üÿÿÿÿÿÿÿà"eüÿÿÿÿÿÿÿó" H # u&# h0#)üÿÿÿÿÿÿÿR#Tüÿÿÿÿÿÿÿh#güÿÿÿÿÿÿÿn# ~# ±#Šüÿÿÿÿÿÿÿ¶# @ »#]üÿÿÿÿÿÿÿÇ#üÿÿÿÿÿÿÿÏ#güÿÿÿÿÿÿÿê#jüÿÿÿÿÿÿÿñ#Œûÿÿÿÿÿÿÿ$güÿÿÿÿÿÿÿ"$eüÿÿÿÿÿÿÿ2$YüÿÿÿÿÿÿÿC$Tüÿÿÿÿÿÿÿy$Šüÿÿÿÿÿÿÿ~$  ƒ$]üÿÿÿÿÿÿÿ$üÿÿÿÿÿÿÿ¡$ h ¦$]üÿÿÿÿÿÿÿ®$düÿÿÿÿÿÿÿ¾$jüÿÿÿÿÿÿÿÅ$ûÿÿÿÿÿÿÿå$.üÿÿÿÿÿÿÿï$ ° % h-%iüÿÿÿÿÿÿÿ2% h7%]üÿÿÿÿÿÿÿc%üÿÿÿÿÿÿÿj%Aüÿÿÿÿÿÿÿq%Cüÿÿÿÿÿÿÿ~%üÿÿÿÿÿÿÿ’%üÿÿÿÿÿÿÿ %Cüÿÿÿÿÿÿÿ¥%Züÿÿÿÿÿÿÿ²%Jüÿÿÿÿÿÿÿç%\üÿÿÿÿÿÿÿ&eüÿÿÿÿÿÿÿB&eüÿÿÿÿÿÿÿP&.üÿÿÿÿÿÿÿV& À m& ht&iüÿÿÿÿÿÿÿy& h~&]üÿÿÿÿÿÿÿŒ&.üÿÿÿÿÿÿÿ’&  ©& h´&iüÿÿÿÿÿÿÿ¹& h¾&]üÿÿÿÿÿÿÿÒ&eüÿÿÿÿÿÿÿÛ&Füÿÿÿÿÿÿÿã&üÿÿÿÿÿÿÿí&/üÿÿÿÿÿÿÿü&güÿÿÿÿÿÿÿ'xüÿÿÿÿÿÿÿ'Süÿÿÿÿÿÿÿ"'/üÿÿÿÿÿÿÿ/'xüÿÿÿÿÿÿÿ7'OüÿÿÿÿÿÿÿD'ŽüÿÿÿÿÿÿÿP' üÿÿÿÿÿÿÿ_' ð d'%üÿÿÿÿÿÿÿv':üÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿŒ'’üÿÿÿÿÿÿÿ¯' €Š$üÿÿÿÿÿÿÿd0üÿÿÿÿÿÿÿ|2üÿÿÿÿÿÿÿ4üÿÿÿÿÿÿÿ, #üÿÿÿÿÿÿÿÅ Nüÿÿÿÿÿÿÿñ_üÿÿÿÿÿÿÿ]üÿÿÿÿÿÿÿ]üÿÿÿÿÿÿÿ?]üÿÿÿÿÿÿÿVdüÿÿÿÿÿÿÿ—füÿÿÿÿÿÿÿælüÿÿÿÿÿÿÿª ]üÿÿÿÿÿÿÿ€!lüÿÿÿÿÿÿÿ "]üÿÿÿÿÿÿÿ»"]üÿÿÿÿÿÿÿh$jüÿÿÿÿÿÿÿÁ%Šüÿÿÿÿÿÿÿ´'”üÿÿÿÿÿÿÿ•••@HP"X)`=€Pˆ^o˜„ Ž¨PÀ£È°ÐÀØ àÞèüðø0 X € $° A(Z0Ø 8r@„H£`•hžp´x €( ˆÃÚ è¨÷°¸ $ $p$¨#  $  E Š 7 !¸') . ×; @ ó M îR í_ ~d nq <x ž U æ’  Rª e½  ‘Í Ø Rã Ùî  ù  :   _ % ?8 óW ì d ­ k Up { ‡ Ç Ž “ Ò™ ïŸ Ã¥ Ü«  ± ë ¹  Á Ï Ì  Ø Næ V  =  • ß-  L ²W ÿ b wm Åx €ƒ O  Q¦ E± X¼ ƒø ™  Ù , “- E; žI äh Xt 6 ‚ ‚ ž æ¬ \» ÔÇ JÍ 7Ó ^ Ù Òß å ¤ë f ñ ¡ ï  e&  , ¿2 «8 o > ÉE Ä Q ûW A] é c 'i  o ^ u / { I  · ‡ × “  ™ 8Ÿ ¥ Ó« —É $Õ ŸÛ ”á t ç ª í ² ó Nù ÿ ¢  º  Ù  ý u ’# Ý) Û/ î 5 Ò; Æ A  G ÂM yS Î Y ¼_ )e © k 1q n w ? } wƒ å‰  Ë• ½› ´¡ &§ !­ ™³ ¨¹ ª¿ ÑÅ Ë XÑ $× )Þ ™ å ‰ì Ïó  ú   y ð  ?% B + †1 ¢7 5= C ­J ÞQ Ž` xl z ˆ – o¤ Y¹ \ Ä ºÑ 4 à eï .þ †  ð + É: cI º X Jg ê v §… ” †£ ² aÁ ãÐ ³à • ð ú  & ´  Ë0 Ò@ ©P ß` æp v € ±‘ ˜ ¤ 1 ² íÀ Œ N G º& | , ¸3 Ä > 6› õè ?ö à Z i ) ² 7 á E | S a É ûå ò , i q Z*  E  S Zb Ð q êƒ š • —§ ú¹   È n × „ æ "õ þ 4 b  m Sx ƒ Ä Ž –š ¨  ¶ ’Ä ’Ò ¡à ·î r ü Ú · ™ @  W q  ¨ Š› é Z· pÆ 2Ù { ß O å L ë Z ñ h ù ý   o* Æ< ¨ R v ` Û} o‹ oÆ ¢ Ø É ã Pî ) û I y, Ö 8 ' F èa ‰ o— ¸¾ ‹Ú ²é ±õ ç É    Z1 É <  I b­ úÄ  Ð Ü 'è ý ô ï‚ + ” £ Ÿ µ ¬À ö Ë Š Þ x÷ á S % `. ©7 ô@"HS["cSz.‚ ¤  ¬`´Õ¼ CÎ ËÕ … áàé£ñ ) ‰ m å Á# .( 3 8 # C ÅH €S ûX øc 1lØt 0„ ’ ¾—-ŸP³ ù¼ %Æ]΀â `ë Œõ€ý£# ÷ /°7Ùj æ ràz § Þ ¯·=ä ›ì@ôL Ç@K% x1 }@ ŒLPThn ês  €€žp¦€º  à VÌ ŒÓ r߀ç…÷ ø  Â Ö  '/—< % H P§] e°mÁu å~ ª‰ 圤£¸ Á AÊ mԣܷð ™ù ½ é BJ(  7J? `O A ^†fŽz m ‰Ž‘ ŸX± …½ÐÅØÍ ™ à ! éµñÐ;à é9 cEðM?g W u  ƒ ° “ Ô ˜ ' £ + ­@µ|É ˆ Ò Ó Ù Û á€é?ù ¿ 0  ¹(„0H Š P@X–u ¹‡@I§ Û ¯ ·± ¿ “ È ¿Ó “ â ç ¹÷¢ÿ À  e ð Å" S*À 2M L Q ¹aÇ i  u Xz Pƒ ËŒ  ”P œU ¤ (­ ¿¸ (Ç ‘Ì ¹× çÞ ª æ` î¾ ö 0   ¹ Ù  ƒ (À 0f X _ Xgp oF — 2ž Ô ¦P ®™ Í ý Õ  ÝÒ å Uø Éÿ W à M- %< [A ¹W ¤cPk"s ¾| ™ ‡ ¾– › ¹¦ ]¯R· €Ã “È °Ñ ñÚ k æ0îÍö N  þ G ¹( / °7Ð?õG æY 2` ;hpdx UŠ  á š µ© ë¸ Æ DÔ ³îpö¡þ   …€ à( »3°;C ÞP RY ›bèj v ¾{ @‰è‘ £ÈºhÌ Ôqè áø8 p   M ¬%€-ú5 pH \X f \t µ‚ & ‹¤“  ¡n¯ J ºÂÊ • × r!à F"* A2 à> È"G 7#L @U ø#^ 7#g Ì$p T%y  '‚ g(‹ ”)” Ø) n*¦ Þ+¯ s,¸ À,  Ï ú,Ø ·-Þ àë ?.ô é.ú ! q/! 0! @#! £0,! M16!Õ>!R! Õ1[! 2d! '2n!jv!Š! S2“! 2œ! ¥2¦!™®! p¾! Ñ2Ç! ý2Ð! #3Ú!Râ!wö! O3ÿ! {3" ¡3"­"Ò." Í37" ù3@" 4J"…R"f" K4o" w4x" 4‚"Š"  š" É4£" õ4¬" 5¶"N¾"zÒ" G5Û" s5ä" ™5î"mö" Ð# Å5# ñ5# 6"#Ú*# :# C6C# o6L# •6V#^#-r# Á6{# ä6…#U# 0# 7¦# <7°#ˆ¸#¯Ì# h7Õ# ”7Þ# º7è#¾ð#ê$ æ7 $ 8$ 88 $6($[<$ d8E$ 8N$ ¶8X$‚`$§t$ â8}$ 9†$ 49$Ù˜$ò¬$ `9µ$ Œ9¿$&Ç$ p×$ ¸9à$ ä9é$  :ó$›û$À% 6:% b:!% ˆ:+%à3%ûJ%ÇY% { a%i%® q% ´:ƒ%  ;‘% ü;–%  £%À°%¸%  Ê%‚Ø% m<ð%ƒþ% ˜<&c &i $& Ã<-& ï<6& =@&| H& àb& G j&° r&*"z& A=Œ& A>š& °>£&² «& ½&‚Ë& 4?ã&ƒñ& _?û&Ü!' P#'"+'%"=' T'hd'0"l'9#t' Š?' N@Š' ª@“'P"›' €«' A´' eA½'Œ"Å' Ðå' #í' û'u (h(í"#(#3( ®A<( ÚAE( BM( ~U(@#](M%e( ,Bn( ²y( ÎCˆ( *D( × ˜( ´D¡(í$©( Pµ( þD¾( *EÇ( PEÏ( ç×(P%ß(Å%ç( |Eú( Fÿ( á ) aF)  )Ð%%)m'-) ªF@)  GO) SGX)T&`) €p) ÂGy) îG‚) HŒ)&”) ° ) @H©) lH²) ’Hº) OÆ)p'Î) 'Ö) ¾Hé)  I÷) -Iþ) ÿ * '*¸'"* ?-* PI<* sIL* ©IR* ÿ_* l* N †* .“* 0¬* pÉ*  æ* D+ ; "+ 0+ Â>+ L+ Z+ îh+ ‚n+ Ï |+ º Š+ '˜+ d¦+ Š Â+ 3Ð+ @Þ+ a ì+ Ñú+ ¤ , 1 , a$, 32, ¤@, rN, -\, <j, Ñx, ˆ, j”, F ¢, ¼°, æ Ï, ÇÝ, ë, Æù, ó- l- ›#- ÿ0- =- N W- .e-’n- 0{-† - ~­-™¶- pÃ-pÌ-  Ù-uâ- Dï-t. . .˜. ; ,.ƒ5. C.DL. ÂZ.Pc. q.Ez. ˆ.T‘. îŸ.U¨. h¶.—Å. 4Ó.–Ü. Ï ê.wó. º /? / '/@!/ d//g8/ Š F/e]/f/ 3t/|}/ @‹/”/ a ¢/s«/ ѹ/qÂ/ ¤ Ð/zÙ/ 1 ç/rð/ aþ/Œ0 300 ¤,0V50 rC0L0 -Z0Cc0 <q0•z0 ш0…‘0 ËŸ0ˆ¨0 j¶0¿0 F Í06Ö0 ¼ä08í0 æ û0‚1 Ç1h1 )1v21 Æ@1nI1 óW1m`1 ln1~w1 ›…1;¥  sT?€-Ð@ü7( €T È€ ÿ  @G Dz Dã E&EeP¨PrD¥DE^Pè1ø:2hf2à¸2hä263hb3 ´3hà3(24h^48°4hÜ4x.5hZ5ø¬5hØ5µ*6hV6@¨6h÷6h#7uO7m{7@Í7hù7ðK8hw8ŽÉ8hõ8£G9hs9nŸ9mË9p:hI:ø›:h€<«<8Ö< (=hG?r?6ÁAH Bh=DTE° cEhÕGÀ 'HhSH ¥Hh œ <`\à€°”਼@ÐPäpø€   4°lÐà¤ð¸@Ì€à@ô 4À HP „`  À ´p ÈP Ü  üà PL0|ДØpø° ,€d¤Ü° 0"D@#œP%ÈÐ%ìp' 'mtr-0.85/AUTHORS0000664000175000017500000000474012144202516012340 0ustar wolffwolff Matt Kimball is the primary author of mtr. Roger Wolff is currently maintaing mtr. Bug reports and feature requests should be sent to the mtr mailing list. See the README file for details. Thanks to everyone who has provided feedback on mtr. Thanks especially to those of you who have sent code: (Reverse alphabetical order, and sometimes I just add people at the end... ) Bohdan Vlasyuk Evgeniy Tretyak John Thacker Juha Takala David Sward David Stone Andrew Stesin Greg Stark Robert Sparks Mike Simons Aaron Scarisbrick Craig Milo Rogers Antonio Querubin Russell Nelson Davin Milun Josh Martin Alexander V. Lukyanov Charles Levert Bertrand Leconte Anand Kumria Olav Kvittem Adam Kramer Philip Kizer Simon Kirby Christophe Kalt Steve Kann Brett Johnson Roland Illig Damian Gryski Rob Foehl Mircea Damian Cougar Travis Cross Brian Casey Andrew Brown Bill Bogstad Marc Bejarano Moritz Barsnick Thomas Klausner Roderick Groesbeek Kyle J. McKay Joseph Carter Thales "Min" Vaibhav Bajpai Jürgen Schönwälder and anyone who has slipped through the cracks of my mail file. Authors: If you want your Email mentioned here, send it to me. If you don't want your Email mentioned here, tell me. -- REW mtr-0.85/aclocal.m40000664000175000017500000013527312162521446013144 0ustar wolffwolff# generated automatically by aclocal 1.11.1 -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2007, 2008, 2009 Free Software Foundation, Inc. # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.68],, [m4_warning([this file was generated for autoconf 2.68. You have another version of autoconf. It may work, but is not guaranteed to. If you have problems, you may need to regenerate the build system entirely. To do so, use the procedure documented by the package, typically `autoreconf'.])]) # Configure paths for GTK+ # Owen Taylor 1997-2001 dnl AM_PATH_GTK_2_0([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND [, MODULES]]]]) dnl Test for GTK+, and define GTK_CFLAGS and GTK_LIBS, if gthread is specified in MODULES, dnl pass to pkg-config dnl AC_DEFUN([AM_PATH_GTK_2_0], [dnl dnl Get the cflags and libraries from pkg-config dnl AC_ARG_ENABLE(gtktest, [ --disable-gtktest do not try to compile and run a test GTK+ program], , enable_gtktest=yes) pkg_config_args=gtk+-2.0 for module in . $4 do case "$module" in gthread) pkg_config_args="$pkg_config_args gthread-2.0" ;; esac done no_gtk="" AC_PATH_PROG(PKG_CONFIG, pkg-config, no) if test x$PKG_CONFIG != xno ; then if pkg-config --atleast-pkgconfig-version 0.7 ; then : else echo "*** pkg-config too old; version 0.7 or better required." no_gtk=yes PKG_CONFIG=no fi else no_gtk=yes fi min_gtk_version=ifelse([$1], ,2.0.0,$1) AC_MSG_CHECKING(for GTK+ - version >= $min_gtk_version) if test x$PKG_CONFIG != xno ; then ## don't try to run the test against uninstalled libtool libs if $PKG_CONFIG --uninstalled $pkg_config_args; then echo "Will use uninstalled version of GTK+ found in PKG_CONFIG_PATH" enable_gtktest=no fi if $PKG_CONFIG --atleast-version $min_gtk_version $pkg_config_args; then : else no_gtk=yes fi fi if test x"$no_gtk" = x ; then GTK_CFLAGS=`$PKG_CONFIG $pkg_config_args --cflags` GTK_LIBS=`$PKG_CONFIG $pkg_config_args --libs` gtk_config_major_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` gtk_config_minor_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` gtk_config_micro_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_gtktest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$GTK_LIBS $LIBS" dnl dnl Now check if the installed GTK+ is sufficiently new. (Also sanity dnl checks the results of pkg-config to some extent) dnl rm -f conf.gtktest AC_TRY_RUN([ #include #include #include int main () { int major, minor, micro; char *tmp_version; fclose (fopen ("conf.gtktest", "w")); /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = g_strdup("$min_gtk_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_gtk_version"); exit(1); } if ((gtk_major_version != $gtk_config_major_version) || (gtk_minor_version != $gtk_config_minor_version) || (gtk_micro_version != $gtk_config_micro_version)) { printf("\n*** 'pkg-config --modversion gtk+-2.0' returned %d.%d.%d, but GTK+ (%d.%d.%d)\n", $gtk_config_major_version, $gtk_config_minor_version, $gtk_config_micro_version, gtk_major_version, gtk_minor_version, gtk_micro_version); printf ("*** was found! If pkg-config was correct, then it is best\n"); printf ("*** to remove the old version of GTK+. You may also be able to fix the error\n"); printf("*** by modifying your LD_LIBRARY_PATH enviroment variable, or by editing\n"); printf("*** /etc/ld.so.conf. Make sure you have run ldconfig if that is\n"); printf("*** required on your system.\n"); printf("*** If pkg-config was wrong, set the environment variable PKG_CONFIG_PATH\n"); printf("*** to point to the correct configuration files\n"); } else if ((gtk_major_version != GTK_MAJOR_VERSION) || (gtk_minor_version != GTK_MINOR_VERSION) || (gtk_micro_version != GTK_MICRO_VERSION)) { printf("*** GTK+ header files (version %d.%d.%d) do not match\n", GTK_MAJOR_VERSION, GTK_MINOR_VERSION, GTK_MICRO_VERSION); printf("*** library (version %d.%d.%d)\n", gtk_major_version, gtk_minor_version, gtk_micro_version); } else { if ((gtk_major_version > major) || ((gtk_major_version == major) && (gtk_minor_version > minor)) || ((gtk_major_version == major) && (gtk_minor_version == minor) && (gtk_micro_version >= micro))) { return 0; } else { printf("\n*** An old version of GTK+ (%d.%d.%d) was found.\n", gtk_major_version, gtk_minor_version, gtk_micro_version); printf("*** You need a version of GTK+ newer than %d.%d.%d. The latest version of\n", major, minor, micro); printf("*** GTK+ is always available from ftp://ftp.gtk.org.\n"); printf("***\n"); printf("*** If you have already installed a sufficiently new version, this error\n"); printf("*** probably means that the wrong copy of the pkg-config shell script is\n"); printf("*** being found. The easiest way to fix this is to remove the old version\n"); printf("*** of GTK+, but you can also set the PKG_CONFIG environment to point to the\n"); printf("*** correct copy of pkg-config. (In this case, you will have to\n"); printf("*** modify your LD_LIBRARY_PATH enviroment variable, or edit /etc/ld.so.conf\n"); printf("*** so that the correct libraries are found at run-time))\n"); } } return 1; } ],, no_gtk=yes,[echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_gtk" = x ; then AC_MSG_RESULT(yes (version $gtk_config_major_version.$gtk_config_minor_version.$gtk_config_micro_version)) ifelse([$2], , :, [$2]) else AC_MSG_RESULT(no) if test "$PKG_CONFIG" = "no" ; then echo "*** A new enough version of pkg-config was not found." echo "*** See http://pkgconfig.sourceforge.net" else if test -f conf.gtktest ; then : else echo "*** Could not run GTK+ test program, checking why..." ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$LIBS $GTK_LIBS" AC_TRY_LINK([ #include #include ], [ return ((gtk_major_version) || (gtk_minor_version) || (gtk_micro_version)); ], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding GTK+ or finding the wrong" echo "*** version of GTK+. If it is not finding GTK+, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH" ], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means GTK+ is incorrectly installed."]) CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi GTK_CFLAGS="" GTK_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(GTK_CFLAGS) AC_SUBST(GTK_LIBS) rm -f conf.gtktest ]) # pkg.m4 - Macros to locate and utilise pkg-config. -*- Autoconf -*- # serial 1 (pkg-config-0.24) # # Copyright © 2004 Scott James Remnant . # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # PKG_PROG_PKG_CONFIG([MIN-VERSION]) # ---------------------------------- AC_DEFUN([PKG_PROG_PKG_CONFIG], [m4_pattern_forbid([^_?PKG_[A-Z_]+$]) m4_pattern_allow([^PKG_CONFIG(_(PATH|LIBDIR|SYSROOT_DIR|ALLOW_SYSTEM_(CFLAGS|LIBS)))?$]) m4_pattern_allow([^PKG_CONFIG_(DISABLE_UNINSTALLED|TOP_BUILD_DIR|DEBUG_SPEW)$]) AC_ARG_VAR([PKG_CONFIG], [path to pkg-config utility]) AC_ARG_VAR([PKG_CONFIG_PATH], [directories to add to pkg-config's search path]) AC_ARG_VAR([PKG_CONFIG_LIBDIR], [path overriding pkg-config's built-in search path]) if test "x$ac_cv_env_PKG_CONFIG_set" != "xset"; then AC_PATH_TOOL([PKG_CONFIG], [pkg-config]) fi if test -n "$PKG_CONFIG"; then _pkg_min_version=m4_default([$1], [0.9.0]) AC_MSG_CHECKING([pkg-config is at least version $_pkg_min_version]) if $PKG_CONFIG --atleast-pkgconfig-version $_pkg_min_version; then AC_MSG_RESULT([yes]) else AC_MSG_RESULT([no]) PKG_CONFIG="" fi fi[]dnl ])# PKG_PROG_PKG_CONFIG # PKG_CHECK_EXISTS(MODULES, [ACTION-IF-FOUND], [ACTION-IF-NOT-FOUND]) # # Check to see whether a particular set of modules exists. Similar # to PKG_CHECK_MODULES(), but does not set variables or print errors. # # Please remember that m4 expands AC_REQUIRE([PKG_PROG_PKG_CONFIG]) # only at the first occurence in configure.ac, so if the first place # it's called might be skipped (such as if it is within an "if", you # have to call PKG_CHECK_EXISTS manually # -------------------------------------------------------------- AC_DEFUN([PKG_CHECK_EXISTS], [AC_REQUIRE([PKG_PROG_PKG_CONFIG])dnl if test -n "$PKG_CONFIG" && \ AC_RUN_LOG([$PKG_CONFIG --exists --print-errors "$1"]); then m4_default([$2], [:]) m4_ifvaln([$3], [else $3])dnl fi]) # _PKG_CONFIG([VARIABLE], [COMMAND], [MODULES]) # --------------------------------------------- m4_define([_PKG_CONFIG], [if test -n "$$1"; then pkg_cv_[]$1="$$1" elif test -n "$PKG_CONFIG"; then PKG_CHECK_EXISTS([$3], [pkg_cv_[]$1=`$PKG_CONFIG --[]$2 "$3" 2>/dev/null` test "x$?" != "x0" && pkg_failed=yes ], [pkg_failed=yes]) else pkg_failed=untried fi[]dnl ])# _PKG_CONFIG # _PKG_SHORT_ERRORS_SUPPORTED # ----------------------------- AC_DEFUN([_PKG_SHORT_ERRORS_SUPPORTED], [AC_REQUIRE([PKG_PROG_PKG_CONFIG]) if $PKG_CONFIG --atleast-pkgconfig-version 0.20; then _pkg_short_errors_supported=yes else _pkg_short_errors_supported=no fi[]dnl ])# _PKG_SHORT_ERRORS_SUPPORTED # PKG_CHECK_MODULES(VARIABLE-PREFIX, MODULES, [ACTION-IF-FOUND], # [ACTION-IF-NOT-FOUND]) # # # Note that if there is a possibility the first call to # PKG_CHECK_MODULES might not happen, you should be sure to include an # explicit call to PKG_PROG_PKG_CONFIG in your configure.ac # # # -------------------------------------------------------------- AC_DEFUN([PKG_CHECK_MODULES], [AC_REQUIRE([PKG_PROG_PKG_CONFIG])dnl AC_ARG_VAR([$1][_CFLAGS], [C compiler flags for $1, overriding pkg-config])dnl AC_ARG_VAR([$1][_LIBS], [linker flags for $1, overriding pkg-config])dnl pkg_failed=no AC_MSG_CHECKING([for $1]) _PKG_CONFIG([$1][_CFLAGS], [cflags], [$2]) _PKG_CONFIG([$1][_LIBS], [libs], [$2]) m4_define([_PKG_TEXT], [Alternatively, you may set the environment variables $1[]_CFLAGS and $1[]_LIBS to avoid the need to call pkg-config. See the pkg-config man page for more details.]) if test $pkg_failed = yes; then AC_MSG_RESULT([no]) _PKG_SHORT_ERRORS_SUPPORTED if test $_pkg_short_errors_supported = yes; then $1[]_PKG_ERRORS=`$PKG_CONFIG --short-errors --print-errors --cflags --libs "$2" 2>&1` else $1[]_PKG_ERRORS=`$PKG_CONFIG --print-errors --cflags --libs "$2" 2>&1` fi # Put the nasty error message in config.log where it belongs echo "$$1[]_PKG_ERRORS" >&AS_MESSAGE_LOG_FD m4_default([$4], [AC_MSG_ERROR( [Package requirements ($2) were not met: $$1_PKG_ERRORS Consider adjusting the PKG_CONFIG_PATH environment variable if you installed software in a non-standard prefix. _PKG_TEXT])[]dnl ]) elif test $pkg_failed = untried; then AC_MSG_RESULT([no]) m4_default([$4], [AC_MSG_FAILURE( [The pkg-config script could not be found or is too old. Make sure it is in your PATH or set the PKG_CONFIG environment variable to the full path to pkg-config. _PKG_TEXT To get pkg-config, see .])[]dnl ]) else $1[]_CFLAGS=$pkg_cv_[]$1[]_CFLAGS $1[]_LIBS=$pkg_cv_[]$1[]_LIBS AC_MSG_RESULT([yes]) $3 fi[]dnl ])# PKG_CHECK_MODULES # Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. # (This private macro should not be called outside this file.) AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version='1.11' dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to dnl require some minimum version. Point them to the right macro. m4_if([$1], [1.11.1], [], [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl ]) # _AM_AUTOCONF_VERSION(VERSION) # ----------------------------- # aclocal traces this macro to find the Autoconf version. # This is a private macro too. Using m4_define simplifies # the logic in aclocal, which can simply ignore this definition. m4_define([_AM_AUTOCONF_VERSION], []) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. # This function is AC_REQUIREd by AM_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.11.1])dnl m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl _AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))]) # AM_AUX_DIR_EXPAND -*- Autoconf -*- # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # AM_CONDITIONAL -*- Autoconf -*- # Copyright (C) 1997, 2000, 2001, 2003, 2004, 2005, 2006, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 9 # AM_CONDITIONAL(NAME, SHELL-CONDITION) # ------------------------------------- # Define a conditional. AC_DEFUN([AM_CONDITIONAL], [AC_PREREQ(2.52)dnl ifelse([$1], [TRUE], [AC_FATAL([$0: invalid condition: $1])], [$1], [FALSE], [AC_FATAL([$0: invalid condition: $1])])dnl AC_SUBST([$1_TRUE])dnl AC_SUBST([$1_FALSE])dnl _AM_SUBST_NOTMAKE([$1_TRUE])dnl _AM_SUBST_NOTMAKE([$1_FALSE])dnl m4_define([_AM_COND_VALUE_$1], [$2])dnl if $2; then $1_TRUE= $1_FALSE='#' else $1_TRUE='#' $1_FALSE= fi AC_CONFIG_COMMANDS_PRE( [if test -z "${$1_TRUE}" && test -z "${$1_FALSE}"; then AC_MSG_ERROR([[conditional "$1" was never defined. Usually this means the macro was only invoked conditionally.]]) fi])]) # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2009 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 10 # There are a few dirty hacks below to avoid letting `AC_PROG_CC' be # written in clear, in which case automake, when reading aclocal.m4, # will think it sees a *use*, and therefore will trigger all it's # C support machinery. Also note that it means that autoscan, seeing # CC etc. in the Makefile, will ask for an AC_PROG_CC use... # _AM_DEPENDENCIES(NAME) # ---------------------- # See how the compiler implements dependency checking. # NAME is "CC", "CXX", "GCJ", or "OBJC". # We try a few techniques and use that to set a single cache variable. # # We don't AC_REQUIRE the corresponding AC_PROG_CC since the latter was # modified to invoke _AM_DEPENDENCIES(CC); we would have a circular # dependency, and given that the user is not expected to run this macro, # just rely on AC_PROG_CC. AC_DEFUN([_AM_DEPENDENCIES], [AC_REQUIRE([AM_SET_DEPDIR])dnl AC_REQUIRE([AM_OUTPUT_DEPENDENCY_COMMANDS])dnl AC_REQUIRE([AM_MAKE_INCLUDE])dnl AC_REQUIRE([AM_DEP_TRACK])dnl ifelse([$1], CC, [depcc="$CC" am_compiler_list=], [$1], CXX, [depcc="$CXX" am_compiler_list=], [$1], OBJC, [depcc="$OBJC" am_compiler_list='gcc3 gcc'], [$1], UPC, [depcc="$UPC" am_compiler_list=], [$1], GCJ, [depcc="$GCJ" am_compiler_list='gcc3 gcc'], [depcc="$$1" am_compiler_list=]) AC_CACHE_CHECK([dependency style of $depcc], [am_cv_$1_dependencies_compiler_type], [if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_$1_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n ['s/^#*\([a-zA-Z0-9]*\))$/\1/p'] < ./depcomp` fi am__universal=false m4_case([$1], [CC], [case " $depcc " in #( *\ -arch\ *\ -arch\ *) am__universal=true ;; esac], [CXX], [case " $depcc " in #( *\ -arch\ *\ -arch\ *) am__universal=true ;; esac]) for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. Also, some Intel # versions had trouble with output in subdirs am__obj=sub/conftest.${OBJEXT-o} am__minus_obj="-o $am__obj" case $depmode in gcc) # This depmode causes a compiler race in universal mode. test "$am__universal" = false || continue ;; nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; msvisualcpp | msvcmsys) # This compiler won't grok `-c -o', but also, the minuso test has # not run yet. These depmodes are late enough in the game, and # so weak that their functioning should not be impacted. am__obj=conftest.${OBJEXT-o} am__minus_obj= ;; none) break ;; esac if depmode=$depmode \ source=sub/conftest.c object=$am__obj \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c $am__minus_obj sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst1.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep $am__obj sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_$1_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_$1_dependencies_compiler_type=none fi ]) AC_SUBST([$1DEPMODE], [depmode=$am_cv_$1_dependencies_compiler_type]) AM_CONDITIONAL([am__fastdep$1], [ test "x$enable_dependency_tracking" != xno \ && test "$am_cv_$1_dependencies_compiler_type" = gcc3]) ]) # AM_SET_DEPDIR # ------------- # Choose a directory name for dependency files. # This macro is AC_REQUIREd in _AM_DEPENDENCIES AC_DEFUN([AM_SET_DEPDIR], [AC_REQUIRE([AM_SET_LEADING_DOT])dnl AC_SUBST([DEPDIR], ["${am__leading_dot}deps"])dnl ]) # AM_DEP_TRACK # ------------ AC_DEFUN([AM_DEP_TRACK], [AC_ARG_ENABLE(dependency-tracking, [ --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors]) if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi AM_CONDITIONAL([AMDEP], [test "x$enable_dependency_tracking" != xno]) AC_SUBST([AMDEPBACKSLASH])dnl _AM_SUBST_NOTMAKE([AMDEPBACKSLASH])dnl ]) # Generate code to set up dependency tracking. -*- Autoconf -*- # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. #serial 5 # _AM_OUTPUT_DEPENDENCY_COMMANDS # ------------------------------ AC_DEFUN([_AM_OUTPUT_DEPENDENCY_COMMANDS], [{ # Autoconf 2.62 quotes --file arguments for eval, but not when files # are listed without --file. Let's play safe and only enable the eval # if we detect the quoting. case $CONFIG_FILES in *\'*) eval set x "$CONFIG_FILES" ;; *) set x $CONFIG_FILES ;; esac shift for mf do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`AS_DIRNAME("$mf")` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`AS_DIRNAME(["$file"])` AS_MKDIR_P([$dirpart/$fdir]) # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done } ])# _AM_OUTPUT_DEPENDENCY_COMMANDS # AM_OUTPUT_DEPENDENCY_COMMANDS # ----------------------------- # This macro should only be invoked once -- use via AC_REQUIRE. # # This code is only required when automatic dependency tracking # is enabled. FIXME. This creates each `.P' file that we will # need in order to bootstrap the dependency handling code. AC_DEFUN([AM_OUTPUT_DEPENDENCY_COMMANDS], [AC_CONFIG_COMMANDS([depfiles], [test x"$AMDEP_TRUE" != x"" || _AM_OUTPUT_DEPENDENCY_COMMANDS], [AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"]) ]) # Do all the work for Automake. -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2008, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 16 # This macro actually does too much. Some checks are only needed if # your package does certain things. But this isn't really a big deal. # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.62])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl # test to see if srcdir already configured if test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT. m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,, [m4_fatal([AC_INIT should be called with package and version arguments])])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AC_REQUIRE([AM_PROG_INSTALL_SH])dnl AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl AC_PROVIDE_IFELSE([AC_PROG_OBJC], [_AM_DEPENDENCIES(OBJC)], [define([AC_PROG_OBJC], defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl ]) _AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl dnl The `parallel-tests' driver may need to know about EXEEXT, so add the dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen. This macro dnl is hooked onto _AC_COMPILER_EXEEXT early, see below. AC_CONFIG_COMMANDS_PRE(dnl [m4_provide_if([_AM_COMPILER_EXEEXT], [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl ]) dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion. Do not dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further dnl mangled by Autoconf and run in a shell conditional statement. m4_define([_AC_COMPILER_EXEEXT], m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_arg=$1 _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count]) # Copyright (C) 2001, 2003, 2005, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi AC_SUBST(install_sh)]) # Copyright (C) 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Check to see how 'make' treats includes. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 4 # AM_MAKE_INCLUDE() # ----------------- # Check to see how make treats includes. AC_DEFUN([AM_MAKE_INCLUDE], [am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo this is the am__doit target .PHONY: am__doit END # If we don't find an include directive, just comment out the code. AC_MSG_CHECKING([for style of include used by $am_make]) am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # Ignore all kinds of additional output from `make'. case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=include am__quote= _am_result=GNU ;; esac # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=.include am__quote="\"" _am_result=BSD ;; esac fi AC_SUBST([am__include]) AC_SUBST([am__quote]) AC_MSG_RESULT([$_am_result]) rm -f confinc confmf ]) # Fake the existence of programs that GNU maintainers use. -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 6 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl AC_REQUIRE_AUX_FILE([missing])dnl if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # Copyright (C) 2003, 2004, 2005, 2006 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_MKDIR_P # --------------- # Check for `mkdir -p'. AC_DEFUN([AM_PROG_MKDIR_P], [AC_PREREQ([2.60])dnl AC_REQUIRE([AC_PROG_MKDIR_P])dnl dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P, dnl while keeping a definition of mkdir_p for backward compatibility. dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile. dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of dnl Makefile.ins that do not define MKDIR_P, so we do our own dnl adjustment using top_builddir (which is defined more often than dnl MKDIR_P). AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl case $mkdir_p in [[\\/$]]* | ?:[[\\/]]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac ]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 4 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # ------------------------------ # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ---------------------------------- # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # Check to make sure that the build environment is sane. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[[\\\"\#\$\&\'\`$am_lf]]*) AC_MSG_ERROR([unsafe absolute working directory name]);; esac case $srcdir in *[[\\\"\#\$\&\'\`$am_lf\ \ ]]*) AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_STRIP # --------------------- # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Copyright (C) 2006, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in. # This macro is traced by Automake. AC_DEFUN([_AM_SUBST_NOTMAKE]) # AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Public sister of _AM_SUBST_NOTMAKE. AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. AM_MISSING_PROG([AMTAR], [tar]) m4_if([$1], [v7], [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR mtr-0.85/config.h.in0000664000175000017500000001027112162521460013311 0ustar wolffwolff/* config.h.in. Generated from configure.ac by autoheader. */ /* Define to enable IPv6 */ #undef ENABLE_IPV6 /* Define to 1 if you have the header file. */ #undef HAVE_ARPA_NAMESER_COMPAT_H /* Define to 1 if you have the `attron' function. */ #undef HAVE_ATTRON /* Define to 1 if you have the header file. */ #undef HAVE_CURSESX_H /* Define to 1 if you have the header file. */ #undef HAVE_CURSES_H /* Define to 1 if you have the declaration of `errno', and to 0 if you don't. */ #undef HAVE_DECL_ERRNO /* Define to 1 if you have the `fcntl' function. */ #undef HAVE_FCNTL /* Define to 1 if you have the header file. */ #undef HAVE_FCNTL_H /* Define to 1 if you have the header file. */ #undef HAVE_INTTYPES_H /* Define to 1 if you have the `curses' library (-lcurses). */ #undef HAVE_LIBCURSES /* Define to 1 if you have the `cursesX' library (-lcursesX). */ #undef HAVE_LIBCURSESX /* Define to 1 if you have the `m' library (-lm). */ #undef HAVE_LIBM /* Define to 1 if you have the `ncurses' library (-lncurses). */ #undef HAVE_LIBNCURSES /* Define to 1 if you have the `nsl' library (-lnsl). */ #undef HAVE_LIBNSL /* Define to 1 if you have the `socket' library (-lsocket). */ #undef HAVE_LIBSOCKET /* Define to 1 if you have the `termcap' library (-ltermcap). */ #undef HAVE_LIBTERMCAP /* Define to 1 if you have the `tinfo' library (-ltinfo). */ #undef HAVE_LIBTINFO /* Define to 1 if you have the header file. */ #undef HAVE_MEMORY_H /* Define to 1 if you have the header file. */ #undef HAVE_NCURSES_CURSES_H /* Define to 1 if you have the header file. */ #undef HAVE_NCURSES_H /* Define to 1 if you have the `seteuid' function. */ #undef HAVE_SETEUID /* Define to 1 if you have the header file. */ #undef HAVE_SOCKET_H /* Define if your system has socklen_t */ #undef HAVE_SOCKLEN_T /* Define to 1 if you have the header file. */ #undef HAVE_STDINT_H /* Define to 1 if you have the header file. */ #undef HAVE_STDLIB_H /* Define to 1 if you have the header file. */ #undef HAVE_STRINGS_H /* Define to 1 if you have the header file. */ #undef HAVE_STRING_H /* Define if you have struct in_addr */ #undef HAVE_STRUCT_INADDR /* Define to 1 if you have the header file. */ #undef HAVE_SYS_SOCKET_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_STAT_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_TYPES_H /* Define to 1 if you have the header file. */ #undef HAVE_SYS_XTI_H /* Define to 1 if you have the header file. */ #undef HAVE_UNISTD_H /* Define if struct __res_state_ext needs to be defined. */ #undef NEED_RES_STATE_EXT /* Define if you don't have the curses libraries available. */ #undef NO_CURSES /* Define if you don't have the glib libraries available. */ #undef NO_GLIB /* Define if you don't have the GTK+ libraries available. */ #undef NO_GTK /* Define if you don't have the herror() function available. */ #undef NO_HERROR /* Define to disable ipinfo lookup */ #undef NO_IPINFO /* Define if you don't have the strerror() function available. */ #undef NO_STRERROR /* Name of package */ #undef PACKAGE /* Define to the address where bug reports for this package should be sent. */ #undef PACKAGE_BUGREPORT /* Define to the full name of this package. */ #undef PACKAGE_NAME /* Define to the full name and version of this package. */ #undef PACKAGE_STRING /* Define to the one symbol short name of this package. */ #undef PACKAGE_TARNAME /* Define to the home page for this package. */ #undef PACKAGE_URL /* Define to the version of this package. */ #undef PACKAGE_VERSION /* The size of `unsigned char', as computed by sizeof. */ #undef SIZEOF_UNSIGNED_CHAR /* The size of `unsigned int', as computed by sizeof. */ #undef SIZEOF_UNSIGNED_INT /* The size of `unsigned long', as computed by sizeof. */ #undef SIZEOF_UNSIGNED_LONG /* The size of `unsigned short', as computed by sizeof. */ #undef SIZEOF_UNSIGNED_SHORT /* Define to 1 if you have the ANSI C header files. */ #undef STDC_HEADERS /* Version number of package */ #undef VERSION mtr-0.85/mtr0000775000175000017500000115242512162522443012031 0ustar wolffwolffELF>ÈH@@˜r@8 @%"@@@@@øø88@8@@@”b”b ˆmˆmaˆmad¸Ò3 °m°ma°ma00TT@T@DDPåtdAAAAAÜÜQåtdRåtdˆmˆmaˆmaxx/lib64/ld-linux-x86-64.so.2GNUGNUÅ8ˆLsg|ø‚Ð?Ùï¼Òù¾  ”€ˆ¾Áƺã’|BEÕì)ŒØ+ŒfUaØqX8ò‹¹ñêÓï2Ä÷²¢÷͇þáH  `õ “ Ì +Ñ p å½ æµ ?: à 2  j ~® . ”Û ! Ä ˆ 1 X¦ ¶ 9 ³ h{Vv Ê Þ‡þ ë´Ÿ > ò] ‹c }WN  f Å “U š  ªøüÕ@,Ð93iô C $¼i ÷ mM  Ù· và7„óMa aâ¨a F ü ½ùy  ¨ Âþ 1AÃ’>• ­¬ à à   ð § 3  í šÀÛíšÎn *  o ¹ Á OË$Å‚ 1 Ñ IÒŽá<% H* L r 4 ? ˜ à+ ßY h¤dƒ Ó*Šbé ·«I  N%ñÿ@@•Õ ñÿì…aN 0†a…†a» †aÜ ñÿì…a¶ (†ap p6@x÷@V †a¯  †aœˆalibresolv.so.2__gmon_start___Jv_RegisterClasses__res_query__res_nmkquery__dn_expandlibm.so.6sqrtpowlibtinfo.so.5raw_finistdscrlibncurses.so.5timeoutnoechowattr_onmvprintwwgetchendwinwattr_offwrefreshwerasewmoveinitscrlibgtk-x11-2.0.so.0g_freeg_io_channel_unix_newg_object_setg_source_removeg_signal_connect_datagtk_list_store_removegtk_initgtk_toggle_button_new_with_mnemonicgtk_box_pack_startgtk_list_store_newgtk_toggle_button_get_typegtk_scrolled_window_newgtk_list_store_appendgtk_entry_get_typegtk_window_newgtk_box_get_typegtk_window_set_default_icongtk_maingtk_spin_button_set_numericgtk_container_get_typegtk_entry_set_textgtk_label_set_mnemonic_widgetgtk_scrolled_window_get_typegtk_label_get_typegtk_entry_newgtk_tree_view_get_typegtk_button_new_with_mnemonicgtk_tree_model_get_typegtk_tree_model_getgtk_tree_view_column_set_cell_data_funcgtk_tree_view_column_set_expandgtk_tree_view_set_cursorgtk_label_new_with_mnemonicgtk_editable_insert_textgtk_window_set_titlegtk_tree_path_freegtk_container_addgtk_cell_renderer_text_newgtk_adjustment_newgtk_tree_model_get_iter_firstgtk_vbox_newgtk_tree_view_new_with_modelgtk_object_get_typegtk_show_about_dialoggtk_spin_button_newgtk_menu_shell_appendgtk_window_set_default_sizegtk_widget_show_allgtk_window_get_typegtk_editable_get_typegtk_menu_get_typegtk_scrolled_window_set_policygtk_entry_get_textgtk_toggle_button_set_activegtk_tree_model_iter_nextgtk_menu_item_new_with_labelgtk_list_store_setgtk_scrolled_window_set_shadow_typegtk_button_new_from_stockgtk_widget_showgtk_spin_button_get_valuegtk_spin_button_get_typegtk_menu_newgtk_tree_view_column_new_with_attributesgtk_clipboard_set_textgtk_clipboard_getgtk_tree_view_get_path_at_posgtk_main_quitgtk_hbox_newgtk_box_pack_endgtk_container_set_border_widthgtk_tree_model_get_itergtk_tree_view_column_set_resizablegtk_menu_popupgtk_tree_view_append_columnlibgdk-x11-2.0.so.0gdk_pixbuf_new_from_xpm_datagdk_pixmap_colormap_create_from_xpm_dgdk_colormap_get_systemg_type_check_instance_castg_io_add_watchg_timeout_addlibgdk_pixbuf-2.0.so.0libgobject-2.0.so.0libglib-2.0.so.0g_set_application_namelibpthread.so.0recvfrom__errno_locationfcntlconnectsendtolibc.so.6setuidsocket__res_initfflushhcreatestrcpy__printf_chkexitsrandfopengai_strerrorinet_atonoptind__strdup__res_ninitperrorinet_ntoainet_ntopstrncpy__stack_chk_failputcharselectabortstdinhdestroygetpidinet_pton__assert_failstrtodstrtokstrtolfgetscallocstrlengetaddrinfomemsetbindmemcmpclearerr__fprintf_chkctimestdoutgethostbyaddrfputcfputsfclosesetsockoptmallocstrcasecmpgetgid__ctype_b_locgetenvoptargstderrioctlgethostbyname__snprintf_chk__memset_chkgetuidgetegidgetopt_longindex__fxstatfilenogethostnamefwritegettimeofdaygeteuidstrchrgetsocknamehsearch__strcpy_chk__ctype_tolower_loc__sprintf_chkmemmovesetgid__strcat_chkstrcmp__libc_start_mainferrorsnprintf_edata__bss_startGLIBC_2.2.5GLIBC_2.4GLIBC_2.3GLIBC_2.3.4Z ui è  ui è © ui è èii ô ii þ ti  ui è àoa†aÁ†adža †aÈ(†aÄ0†aÀpapapapa pa(pa0pa8pa@pa Hpa Ppa Xpa `pa hpappaxpa€paˆpapa˜pa pa¨pa°pa¸paÀpaÈpaÐpaØpaàpaèpa ðpa!øpa"qa#qa$qa%qa& qa'(qa(0qa)8qa*@qa+Hqa,Pqa-Xqa.`qa/hqa0pqa1xqa2€qa3ˆqa4qa5˜qa6 qa7¨qa8°qa9¸qa:Àqa;Èqa<Ðqa=Øqa>àqa?èqa@ðqaAøqaBraCraDraEraF raG(raH0raI8raJ@raKHraLPraMXraN`raOhraPpraQxraR€raSˆraTraU˜raV raW¨raX°raY¸raZÀra[Èra\Ðra]Øra^àra_èra`ðraaørabsacsadsaesaf sag(sah0sai8saj@sakHsalPsamXsan`saohsappsaqxsar€sasˆsatsau˜sav saw¨sax°say¸sazÀsa{Èsa|Ðsa}Øsa~àsaèsa€ðsaøsa‚taƒta„ta…ta† ta‡(taˆ0ta‰8taŠ@ta‹HtaŒPtaXtaŽ`tahtapta‘xta’€ta“ˆta”ta•˜ta– ta—¨ta˜°ta™¸tašÀta›ÈtaœÐtaØtažàtaŸèta ðta¡øta¢ua£ua¤ua¥ua¦ ua§(ua¨0ua©8uaª@ua«Hua¬Pua­Xua®`ua¯hua°pua±xua²€ua³ˆua´uaµ˜ua¶ ua·¨ua¸°ua¹¸uaºÀua»Èua¼Ðua½Hƒìè{èè½ÀHƒÄÃÿ5Z9!ÿ%\9!@ÿ%Z9!héàÿÿÿÿ%R9!héÐÿÿÿÿ%J9!héÀÿÿÿÿ%B9!hé°ÿÿÿÿ%:9!hé ÿÿÿÿ%29!héÿÿÿÿ%*9!hé€ÿÿÿÿ%"9!hépÿÿÿÿ%9!hé`ÿÿÿÿ%9!h éPÿÿÿÿ% 9!h é@ÿÿÿÿ%9!h é0ÿÿÿÿ%ú8!h é ÿÿÿÿ%ò8!h éÿÿÿÿ%ê8!héÿÿÿÿ%â8!héðþÿÿÿ%Ú8!héàþÿÿÿ%Ò8!héÐþÿÿÿ%Ê8!héÀþÿÿÿ%Â8!hé°þÿÿÿ%º8!hé þÿÿÿ%²8!héþÿÿÿ%ª8!hé€þÿÿÿ%¢8!hépþÿÿÿ%š8!hé`þÿÿÿ%’8!héPþÿÿÿ%Š8!hé@þÿÿÿ%‚8!hé0þÿÿÿ%z8!hé þÿÿÿ%r8!héþÿÿÿ%j8!héþÿÿÿ%b8!héðýÿÿÿ%Z8!h éàýÿÿÿ%R8!h!éÐýÿÿÿ%J8!h"éÀýÿÿÿ%B8!h#é°ýÿÿÿ%:8!h$é ýÿÿÿ%28!h%éýÿÿÿ%*8!h&é€ýÿÿÿ%"8!h'épýÿÿÿ%8!h(é`ýÿÿÿ%8!h)éPýÿÿÿ% 8!h*é@ýÿÿÿ%8!h+é0ýÿÿÿ%ú7!h,é ýÿÿÿ%ò7!h-éýÿÿÿ%ê7!h.éýÿÿÿ%â7!h/éðüÿÿÿ%Ú7!h0éàüÿÿÿ%Ò7!h1éÐüÿÿÿ%Ê7!h2éÀüÿÿÿ%Â7!h3é°üÿÿÿ%º7!h4é üÿÿÿ%²7!h5éüÿÿÿ%ª7!h6é€üÿÿÿ%¢7!h7épüÿÿÿ%š7!h8é`üÿÿÿ%’7!h9éPüÿÿÿ%Š7!h:é@üÿÿÿ%‚7!h;é0üÿÿÿ%z7!h<é üÿÿÿ%r7!h=éüÿÿÿ%j7!h>éüÿÿÿ%b7!h?éðûÿÿÿ%Z7!h@éàûÿÿÿ%R7!hAéÐûÿÿÿ%J7!hBéÀûÿÿÿ%B7!hCé°ûÿÿÿ%:7!hDé ûÿÿÿ%27!hEéûÿÿÿ%*7!hFé€ûÿÿÿ%"7!hGépûÿÿÿ%7!hHé`ûÿÿÿ%7!hIéPûÿÿÿ% 7!hJé@ûÿÿÿ%7!hKé0ûÿÿÿ%ú6!hLé ûÿÿÿ%ò6!hMéûÿÿÿ%ê6!hNéûÿÿÿ%â6!hOéðúÿÿÿ%Ú6!hPéàúÿÿÿ%Ò6!hQéÐúÿÿÿ%Ê6!hRéÀúÿÿÿ%Â6!hSé°úÿÿÿ%º6!hTé úÿÿÿ%²6!hUéúÿÿÿ%ª6!hVé€úÿÿÿ%¢6!hWépúÿÿÿ%š6!hXé`úÿÿÿ%’6!hYéPúÿÿÿ%Š6!hZé@úÿÿÿ%‚6!h[é0úÿÿÿ%z6!h\é úÿÿÿ%r6!h]éúÿÿÿ%j6!h^éúÿÿÿ%b6!h_éðùÿÿÿ%Z6!h`éàùÿÿÿ%R6!haéÐùÿÿÿ%J6!hbéÀùÿÿÿ%B6!hcé°ùÿÿÿ%:6!hdé ùÿÿÿ%26!heéùÿÿÿ%*6!hfé€ùÿÿÿ%"6!hgépùÿÿÿ%6!hhé`ùÿÿÿ%6!hiéPùÿÿÿ% 6!hjé@ùÿÿÿ%6!hké0ùÿÿÿ%ú5!hlé ùÿÿÿ%ò5!hméùÿÿÿ%ê5!hnéùÿÿÿ%â5!hoéðøÿÿÿ%Ú5!hpéàøÿÿÿ%Ò5!hqéÐøÿÿÿ%Ê5!hréÀøÿÿÿ%Â5!hsé°øÿÿÿ%º5!hté øÿÿÿ%²5!huéøÿÿÿ%ª5!hv逸ÿÿÿ%¢5!hwépøÿÿÿ%š5!hxé`øÿÿÿ%’5!hyéPøÿÿÿ%Š5!hzé@øÿÿÿ%‚5!h{é0øÿÿÿ%z5!h|é øÿÿÿ%r5!h}éøÿÿÿ%j5!h~éøÿÿÿ%b5!héð÷ÿÿÿ%Z5!h€éà÷ÿÿÿ%R5!héÐ÷ÿÿÿ%J5!h‚éÀ÷ÿÿÿ%B5!hƒé°÷ÿÿÿ%:5!h„é ÷ÿÿÿ%25!h…é÷ÿÿÿ%*5!h†é€÷ÿÿÿ%"5!h‡ép÷ÿÿÿ%5!hˆé`÷ÿÿÿ%5!h‰éP÷ÿÿÿ% 5!hŠé@÷ÿÿÿ%5!h‹é0÷ÿÿÿ%ú4!hŒé ÷ÿÿÿ%ò4!hé÷ÿÿÿ%ê4!hŽé÷ÿÿÿ%â4!héðöÿÿÿ%Ú4!héàöÿÿÿ%Ò4!h‘éÐöÿÿÿ%Ê4!h’éÀöÿÿÿ%Â4!h“é°öÿÿÿ%º4!h”é öÿÿÿ%²4!h•éöÿÿÿ%ª4!h–é€öÿÿÿ%¢4!h—épöÿÿÿ%š4!h˜é`öÿÿÿ%’4!h™éPöÿÿÿ%Š4!hšé@öÿÿÿ%‚4!h›é0öÿÿÿ%z4!hœé öÿÿÿ%r4!héöÿÿÿ%j4!hžéöÿÿÿ%b4!hŸéðõÿÿÿ%Z4!h éàõÿÿÿ%R4!h¡éÐõÿÿÿ%J4!h¢éÀõÿÿÿ%B4!h£é°õÿÿÿ%:4!h¤é õÿÿÿ%24!h¥éõÿÿÿ%*4!h¦é€õÿÿÿ%"4!h§épõÿÿÿ%4!h¨é`õÿÿÿ%4!h©éPõÿÿÿ% 4!hªé@õÿÿÿ%4!h«é0õÿÿÿ%ú3!h¬é õÿÿÿ%ò3!h­éõÿÿÿ%ê3!h®éõÿÿÿ%â3!h¯éðôÿÿÿ%Ú3!h°éàôÿÿÿ%Ò3!h±éÐôÿÿÿ%Ê3!h²éÀôÿÿÿ%Â3!h³é°ôÿÿÿ%º3!h´é ôÿÿÿ%²3!hµéôÿÿÿ%ª3!h¶é€ôÿÿÿ%¢3!h·épôÿÿÿ%š3!h¸é`ôÿÿÿ%’3!h¹éPôÿÿÿ%Š3!hºé@ôÿÿAWAVAUATUSHì‰|$ H‰4$èÂE…À…~è…ôÿÿ‰ÇèŽþÿÿ…À…èQüÿÿ‰ÇèZ÷ÿÿ…À…è=÷ÿÿ‰Ãè6üÿÿ9Ã…îèÙøÿÿ‰ÃèBôÿÿ9Ã…Úè¥öÿÿ‰ÇèîûÿÿH|$ H‰æèQ”èL9¿e&Aè‚úÿÿH‰Çèj?H‹4$‹|$ è9‹C!;T$ })H‹$HcʃÂH‹4ÈH‹8‰éB!èÄ6‹ÞB!;T$ |ØèãE…À…‹ ¥C!…É…å‹“C!…Ò…¸1ÿHœ$ L¤$ðè˜þÿÿH‹-yC!I‰ÅH‰èH…À„ÈfH‹¸z&A¾€¿àèH…ÒHEÂH‰0C!è‹øÿÿ…À…ë1À¹H‰ßóH«‹ðB!H‹= C!HŒ$1öH‰ÚÇ„$¨‰„$¤è…ôÿÿ…À„̓øõ„d‰ÇèÝüÿÿH‹=B!H‰Áº›&A¾1Àè¢óÿÿƒ=o P…%H‹¶B!H‹@H…ÀH‰¨B!…:ÿÿÿèUGH…íu ë+fDH‰ÝH‹}èüõÿÿH‹]HÇEH‰ïèèõÿÿH…ÛuÛHÄ1À[]A\A]A^A_ÀH¸UNKNOWNHÇ,¤POSTH‰¤Péõþÿÿ„H‹”$HÇ„$àHÇ„$èHÇ„$ØH‹B ‹JH‰„$ЋB‰Œ$äL‰¤$èƒø‰„$à‰“A!„­ƒø tHH‹ é@!º¾¿·&Aè]ûÿÿƒ=JŸP„Ûþÿÿ¿èÆòÿÿfD¿„&AèVûÿÿé¯þÿÿH‹BHƒÀH‰„$ðH¼$ÐHÇ„$øèçI…ÀtKH‹ t@!º!¾¿¨%Aèèúÿÿƒ=ÕžP„fþÿÿë‰f„H‹BHƒÀH‰„$ðëžfDH‹=Ù@!è¼D…Àt(H‹ @!º%¾¿Ð%Aèúÿÿéþÿÿ„L‹=ù?!H‹$M…ÿL‹0„'fǰ@!HÇ­@!fÇž@!HÇ¡@!èüòÿÿL‰ÿ‰›@!è>ðÿÿHT$‰Æ¿A‰ÇèÊöÿÿ…Àu‹D$(%ð=€„²è­èhhÇÞPè¹’èDAL‰ïè<‘L‹=U?!H‹$M…ÿL‹0„œfÇ,@!HÇ)@!fÇ@!HÇ@!èXòÿÿL‰ÿ‰@!èšïÿÿHT$‰Æ¿A‰Çè&öÿÿ…Àu‹D$(%ð=€t^ƒ=OP„àüÿÿéöüÿÿ1Àº‡a¾D‰ÿè,úÿÿƒÀ…1ÿÿÿèþõÿÿ‹8èôÿÿH‹=˜>!I‰ÀL‰ñº×&A¾1Àè)ðÿÿéÿÿÿ1Àº ‡a¾D‰ÿèàùÿÿƒÀu‰è¶õÿÿ‹8èÏóÿÿH‹=P>!I‰ÀL‰ñº×&A¾1ÀèáïÿÿéZÿÿÿH‹ ->!¿#Aº ¾è¡øÿÿ¿èðÿÿH‹$¿¾$AH‹1Àè/ðÿÿ1ÿèøïÿÿ¿q&Aè¾ïÿÿ1ÿèçïÿÿH‹ Ø=!¿à#Aº)¾èLøÿÿ¿èÂïÿÿ¹`+AºÀ¾Ñ&A¿(AèÉïÿÿ¹e+AºÜ¾Ñ&A¿(Aè°ïÿÿH‹ =!¿¸#Aº!¾èõ÷ÿÿ¿èkïÿÿ1íI‰Ñ^H‰âHƒäðPTIÇÀ0÷@HÇÁ ö@HÇÇPB@è/ðÿÿôHƒìH‹á&!H…ÀtÿÐHƒÄÃUH‰åSHƒì€==!uK» maH‹=!Hë˜maHÁûHƒëH9Øs$fDHƒÀH‰ít+D‰èH‹\$8H‹l$@L‹d$HL‹l$PL‹t$XL‹|$`HƒÄhÃDƒ~4uÏòF òNòD,àò,ÙèjóÿÿH‹=K:!H‰ÆI‰Æè¸ñÿÿHL$(E1ÉE1ÀH‰ÇHÇ$D‰â‰ÞèÈôÿÿ…ÀtH‹\$(H‹=:!L‰öè€ñÿÿ1Ò1ÉH‰ÞH‰ÇèqîÿÿèLìÿÿ¿ù@I‰Æè¿îÿÿ¿-ù@H‰Ãè²îÿÿI‰ÄèªìÿÿL‰÷H‰ÆI‰Åè<ñÿÿH‰ÞH‰ÇèÑêÿÿL‰îL‰÷è&ñÿÿL‰æH‰Çè»êÿÿH‹L$(H‰L$èüïÿÿH‰ßH‰ÆI‰ÇèþðÿÿH‹L$E1ÉE1Àº _@¾Dù@H‰Çè±ðÿÿH‹L$(L‰þL‰çH‰L$èÌðÿÿH‹L$E1ÉE1Àº`@¾Dù@H‰ÇèðÿÿH‰ßè·ðÿÿL‰çè¯ðÿÿ‹]L‰îL‰÷è‘ðÿÿE1ÉE1À1É1Ò1öH‰Ç‰$A½èïÿÿé\þÿÿffffff.„USH‰ûHƒìèðÿÿH‰ßH‰ÆH‰ÅèDðÿÿH‰ÇèÜëÿÿH‰Çè4aH…Àt/H‰Çè×Sè2ñÿÿH‹=‹8!H‰Æèðÿÿ1öH‰Çè ñÿÿHƒÄ1À[]ÃH‰îH‰ßèõïÿÿH‰ÇèëÿÿH‰Çèuìÿÿ‰D$ èìðÿÿH‹=E8!H‰ÆèÍïÿÿ¾H‰ÇèÀðÿÿèûìÿÿH‰ßH‰Æè°ïÿÿHL$ H‰Çºÿÿÿÿ¾Mù@èéòÿÿHƒÄ1À[]ÃHƒìó81!èß4¿ÓMb‰Á¾[@÷ïÁù‰×1ÒÁÿ)Ïèòÿÿ‰²7!HƒÄÃDHƒì‹¢7!…Àuè=íÿÿÇ7!HƒÄÃfffff.„Hƒì¿Yù@è’îÿÿH…À•ÀHƒÄ¶ÀÃ@SH‰ûèòÿÿI‰Ø1É1Ò[H‰Æ1ÿéUíÿÿDAWAVAUATUH‰ý¿aù@SHƒìèÅðÿÿI‰ÅèýçÿÿH‰ïH‰ÆH‰Ãè¯îÿÿE1À1É1ÒL‰îH‰ÇèÝòÿÿèˆíÿÿL‰ïH‰ÆI‰ÄèŠîÿÿE1ÉE1À1ɺ K@¾jù@H‰Çè@îÿÿ¿rù@èfðÿÿH‰ÞI‰ÅH‰ïèXîÿÿE1À1É1ÒL‰îH‰Çè†òÿÿL‰ïL‰æè;îÿÿE1ÉE1À1ɺðJ@¾jù@H‰Çèñíÿÿ¿|ù@èéÿÿH‰ÞI‰ÅH‰ïè îÿÿ1É1ÒE1ÀL‰îH‰Çè7òÿÿL‰ïL‰æèìíÿÿE1ɺà[@E1À¾jù@1ÉH‰Çè¢íÿÿ¿…ù@è(ìÿÿH‰ÞI‰ÅH‰ïH‰(6!è³íÿÿE1À1É1ÒH‰ÇL‰îèáñÿÿH‹= 6!L‰æè’íÿÿE1ÉE1À1ɺ[@¾jù@H‰ÇèHíÿÿècîÿÿ…Àò ÑËuò ¿Ëó /!fWíò%»ËZÀò¨Ëò°Ëèãëÿÿò«Ë¾H‰ÇI‰Æè{ïÿÿI‰ÅèƒðÿÿL‰ïH‰Æèíÿÿ¾H‰ÇèûëÿÿH‰ÞH‰ïèðìÿÿE1À1É1ÒL‰îH‰ÇèñÿÿL‰æL‰÷èÓìÿÿE1ÉE1ÀL‰éº@[@¾Œù@H‰Çèˆìÿÿ¿šù@èíÿÿH‰ÞI‰ÅH‰ïè ìÿÿE1À1É1ÒL‰îH‰ÇèÎíÿÿèyåÿÿL‹5r5!I‰ÇH‰ð4!è#ìÿÿL‰ÿH‰ÆèhìÿÿL‰öH‰Çè­æÿÿH‹=Î4!L‰æèNìÿÿE1ÉE1À1ɺM@¾Dù@H‰ÇèìÿÿL‹%¥4!H‰ÞH‰ïè"ìÿÿE1À¹ºL‰æH‰ÇèJíÿÿH‹{4!èÞêÿÿL‰ïH‰ÆèóëÿÿHƒÄH‰ÞH‰Ç[]A\A]A^A_éŠìÿÿf.„ATA¹A¸¹º8¾@U¿ 1ÀSHƒì0HÇD$ @HÇD$8HÇD$HÇD$HÇ$è¥ëÿÿH‰ÃH‰ë3!èæéÿÿH‰ßH‰Æè[ëÿÿH‰ÇèƒçÿÿH‰ÃH‰Ñ3!è4êÿÿH‰ßH‰Æè9ëÿÿE1ÉE1À1ɺ°K@¾¥ù@H‰Çèïêÿÿèåÿÿ1ÉA¹ A¸¸ù@º«÷@H‰Æ¿Ãù@1ÀHÇ$è`íÿÿ¾H‰ÅH‰Çè°îÿÿH‰ï¾è£éÿÿènìÿÿH‹=O3!H‰ÆH‰Ãè¼êÿÿH‰îH‰Çèqçÿÿè¬äÿÿ¾PH‰ÇH‰ÅèœêÿÿòüÈ1ÒH‰Ç¾Ìù@¸è@èÿÿA¹ A¸¸ù@¹º«÷@H‰î¿Óù@1ÀHÇ$èÃìÿÿ¾I‰ÄH‰ÇèéÿÿE1À¹ºÐI@H‰îL‰çè îÿÿH‹=¬2!H‰ÞèêÿÿL‰æH‰ÇèÑæÿÿè äÿÿ¾PH‰ÇH‰Åèüéÿÿò\È1ÒH‰Ç¾Ìù@¸è çÿÿA¹ A¸¸ù@¹º«÷@H‰î¿Øù@1ÀHÇ$è#ìÿÿ¾H‰ÇH‰ÅèsèÿÿH‹=$2!H‰Þè”éÿÿH‰îH‰ÇèIæÿÿè„ãÿÿ¾PH‰ÇH‰ÅètéÿÿòÔÇ1ÒH‰Ç¾Ìù@¸èçÿÿA¹ A¸¸ù@¹º«÷@H‰î¿Üù@1ÀHÇ$è›ëÿÿ¾H‰ÇH‰ÅèëçÿÿH‹=œ1!H‰Þè éÿÿH‰îH‰ÇèÁåÿÿèüâÿÿ¾PH‰ÇH‰ÅèìèÿÿòLÇ1ÒH‰Ç¾Ìù@¸èæÿÿA¹ A¸¸ù@¹º«÷@H‰î¿áù@1ÀHÇ$èëÿÿ¾H‰ÇH‰ÅècçÿÿH‹=1!H‰Þè„èÿÿH‰îH‰Çè9åÿÿètâÿÿ¾PH‰ÇH‰ÅèdèÿÿòÄÆ1ÒH‰Ç¾Ìù@¸èæÿÿA¹ A¸¸ù@¹º«÷@H‰î¿åù@1ÀHÇ$è‹êÿÿ¾H‰ÇH‰ÅèÛæÿÿH‹=Œ0!H‰ÞèüçÿÿH‰îH‰Çè±äÿÿèìáÿÿ¾PH‰ÇH‰ÅèÜçÿÿò<ÆH‰Ç1Ò¾Ìù@¸è€åÿÿA¹ A¸¸ù@¹º«÷@H‰î¿êù@1ÀHÇ$èêÿÿ¾H‰ÇH‰ÅèSæÿÿH‹=0!H‰ÞètçÿÿH‰îH‰Çè)äÿÿèdáÿÿ¾PH‰ÇH‰ÅèTçÿÿò´ÅH‰Ç1Ò¾Ìù@¸èøäÿÿA¹ A¸¸ù@¹º«÷@H‰î¿ðù@1ÀHÇ$è{éÿÿ¾I‰ÄH‰ÇèËåÿÿH‰îL‰çE1À¹º`J@èÃêÿÿH‹=d/!H‰ÞèÔæÿÿHƒÄ0L‰æH‰Ç[]A\éãÿÿAW¹AVAUATUH‰õS‰ûHìÈdH‹%(H‰„$¸1ÀH¼$¸HÇ„$°???L¤$°óH«‰ßè|-‹6/!¾äH‰ÇI‰Åèö6…À…Ɖßè70ºöù@…À¸üù@HDЉßH‰”$ˆèÈ.‰ß‰„$èZ.‰ß‰„$˜èl.‰ßA‰Çè".‰ßA‰Æèø-‰ßA‰Åèž/‰ß‰„$ èp/‰ß‰„$¨èb-D‹Œ$ò*ÀòFÄ‹Œ$˜H‹”$ˆ¿ÓMbD‹„$ òA*É‹´$¨‰ÈÁùA¹H‰T$hD‰D$A¸÷ïD‰øAÁÿ‰4$H‰îÇD$pÿÿÿÿÇD$` ÇD$XÁúÇD$HÇD$8)ÊL‰áÇD$(ò^‰T$PÇD$÷ïD‰ðAÁþÇD$ÁúD)ú‰T$@÷ïD‰èAÁýÁúD)ò‰T$0÷ïH‹=m-!¸Áúò^ÊD)ê‰T$ 1ÒfÀfÉfZÀfZÉÀÉZÀZÉèçåÿÿH‹„$¸dH3%(…HÄÈ[]A\A]A^A_ÃfDL‰ïèpyH…ÀI‰ÄtX‹V-!…À„þÿÿL‰ïè2UH¼$°H‰$M‰áA¸ú@¹º¾1ÀL¤$°èoæÿÿéÜýÿÿf.„L‰ïèèTI‰ÄéÂýÿÿè+äÿÿff.„AUATUSHƒì(èÁ4‰Åèj-‰ÃècâÿÿH‹=\,!H‰ÆI‰ÅèÑãÿÿH‰æH‰Çè¦ÜÿÿfD…Àt39Ý~x‰ßH‰æDcèêüÿÿH‹=#,!L‰îD‰ãè˜ãÿÿH‰æH‰Çèçÿÿ…ÀuÍ9ÝDë+fDD‰ãH‹=î+!H‰æDcèâÿÿH‰æ‰ßè˜üÿÿA9ìuÛHƒÄ([]A\A]ÄH‹=¹+!H‰æè‘ßÿÿélÿÿÿfff.„Hƒìè§oèÿÿÿ¸HƒÄÄHƒìè'qèòþÿÿ¸HƒÄÄHƒìè×þÿÿèâDèÍO‹=+!è‚âÿÿè-óÿÿ¸HƒÄÃSH‰óèæÿÿH‰ßH‰ÆèœâÿÿH‰ÇèäæÿÿfÀ‹=â*!fZÀó2$!è9âÿÿèäòÿÿèoþÿÿ1À[Ãff.„Hƒì‹ ¶*!…Éu2‹=¤*!èâÿÿ‹¡*!1À…Ò”À‰”*!è/þÿÿ1ÀHƒÄÄè‹òÿÿëÒf„Hƒìè·-èþÿÿ1ÀHƒÄÃff.„H‰\$ÐH‰l$ØH‰ûL‰d$àL‰l$èL‰t$ðL‰|$øHƒì8èßÿÿH‰ßH‰ÆH‰Åè¸áÿÿ¾ú@H‰Çè»ÞÿÿH‰îH‰ßè áÿÿº¾ŠH‰Çè®ÞÿÿèÙÝÿÿH‰ßH‰ÆI‰Äè{áÿÿ¾ H‰Çè.åÿÿ1ÿ¾ è‚Ûÿÿ¾ 1ÿI‰ÅèÓáÿÿH‰ÇH‰ÅèhòÿÿèƒÚÿÿL‰ïH‰ÆI‰Æè5áÿÿE1À1É1ÒH‰îH‰ÇècâÿÿèNõÿÿ1ö1ÿè5âÿÿH‰ÅèãÿÿH‰ïH‰ÆI‰ÇèÿàÿÿºH‰Ç¾è-ÜÿÿL‰þH‰ïèâàÿÿ¾H‰ÇèõÙÿÿL‹=V)!L‰æH‰ïèÃàÿÿH‰ÇL‰þèxáÿÿL‰öL‰ïè­àÿÿH‰îH‰ÇE1À¹ºèÕáÿÿL‰æH‰ßèŠàÿÿL‰îH‹\$H‹l$L‹d$L‹l$ H‰ÇL‹t$(L‹|$0HƒÄ8éáÿÿffff.„SHƒì Ht$H$H|$ÇD$HÇ$d&AH‰D$HÇD$èÊðÿÿ¿vaèðßÿÿH‰Çè˜âÿÿ1ÿèQÙÿÿ¿ú@H‰](!èàßÿÿH‹=Q(!èôýÿÿèÏÞÿÿH‹=@(!H‰ÆH‰ÃèÍßÿÿE1ÉE1À1ɺ K@¾ú@H‰ÇèƒßÿÿH‹=(!H‰Þè¤ßÿÿE1ÉE1À1ɺ K@¾#ú@H‰ÇèZßÿÿH‹=ë'!èŽÛÿÿHƒÄ [ÄóÃfffff.„1ÀÃffff.„Hƒìè·ïÿÿè‚-‰ÇèûØÿÿ1ɺ°I@¾H‰Çè—ÜÿÿèBP‰ÇèÛØÿÿ1ɺÐZ@¾H‰ÇèwÜÿÿèP‰Çè»Øÿÿ1ɺðZ@¾H‰ÇèWÜÿÿHƒÄéžÙÿÿfffff.„USH‰ûHƒì8HÇD$(è9ÝÿÿH‹=2'!H‰ÆH‰Åè§ÞÿÿH‰ÚH‰æH‰Çèéàÿÿ…Àt)H‹='!H‰îè†ÞÿÿHL$(H‰ÇA¸ÿÿÿÿ1ÒH‰æ1ÀèLàÿÿH‰ßèDßÿÿH‹D$(HƒÄ8[]ÄSH‰÷èwÿÿÿH…ÀH‰Ãt<¿Eè…ßÿÿºÿÿÿÿH‰ÞH‰ÇèeÜÿÿ¿èkßÿÿºÿÿÿÿH‰ÇH‰ÞèKÜÿÿH‰ßè³Öÿÿ¸[Ãfff.„SH‰÷èÿÿÿH…ÀH‰Ãt5èŠÝÿÿH‹=K&!H‰ÆèËÝÿÿH‰ÞH‰ÇèØÿÿH‹=1&!1öèRíÿÿH‰ßèZÖÿÿ¸[ÃUH‰ýSHƒìH‹ %!H…Àt[¿P¿XƒÂƒÃ‰&!H‰ïèÿÙÿÿ)ÉØÁèÃÑû…Û~ƒëD1À¿¨AƒëèIØÿÿƒûÿuìHƒÄH‰ï1À[]é4Øÿÿ@Ƕ%!ÿÿÿÿ»ÿÿÿÿë¨ffffff.„H‰\$àH‰l$è»L‰d$ðL‰l$øHƒìXH‹=ü$!dH‹%(H‰D$(1ÀèÜÿÿƒøq‰Åt0ƒøt+ƒø ³t$ƒø³tD¥€Aüv=ƒý uP»H‹T$(dH3%(‰Ø…µH‹\$8H‹l$@L‹d$HL‹l$PHƒÄXÃèËÝÿÿH‹HcÕƒÎÿÿ¿ðA1Àè2Îÿÿ¿ A1Àè&Îÿÿ¿` A1ÀèÎÿÿ¿  A1ÀèÎÿÿ¿à A1ÀèÎÿÿ¿!A1ÀèöÍÿÿ¿X!A1ÀèêÍÿÿ1À¿€!A1ÛèÜÍÿÿ¿dA1ÀèÐÍÿÿ¿¸!A1ÀèÄÍÿÿ¿ìA1Àè¸ÍÿÿºA1ö¿1ÀèuÎÿÿH‹=®!èÙÑÿÿéôõÿÿ‹6!ƒøtƒøt ƒè…JþÿÿÇ!1ÛéÊõÿÿÇ!1Ûé¹õÿÿ‹û!ƒøtƒøt߃è…þÿÿÇÞ!1Ûéõÿÿffffff.„AWAVAUATUSHì8‰|$dH‹%(H‰„$(1ÀèÃ"‰D$èjD‹=SxPAÇD9|$Ž•DAG¿žA‰Æ‰D$1ÀèºÌÿÿD‰ÿèÂD‰ÿH‰D$èõ‹o!H‹|$¾äI‰Åè-"…À„MH‹|$èkfD‰ÿH‰Ãè`…À„胉…À…ÂH…Û„ÖD‹ .!E…É„‘H‹|$èBH‰ÞH‰Â¿ú@1Àè%ÌÿÿH‹=.!1Ò¾ èÓÿÿH‹=!¾ÿÿÿÿ‰ðH…ÿt¿7¿G‹T$‰~!»`aE1äèaÊÿÿëY€AÿV ò*ÀI‹NHD$ IcüHÇÂÿÿÿÿ¾HǸò^0¯èÃÒÿÿHDmHÁàD À{aHƒÃHûtatv¶‹,…ÀäƒýÿtäHcí¾fLtmIÁæIƨ{aI‹~èÆÐÿÿH…ÀD‰ÿ¸…mÿÿÿAÿV I‹NA‰ÀHD$ IcüHÇÂÿÿÿÿ¾HÇ1Àè<Òÿÿétÿÿÿ€Ht$ Mcä¿Q:A1ÀBÆD$ L‰íèóÊÿÿ1Ûë9€D‹Á!E…Àt2¾MP¶U@¿à!AD¶EHI‹tÝ1ÀHƒÃHƒÅè¶ÊÿÿA¶UX¾Â9ØÂE1öëDAƒÆAƒþ„2D‰öD‰ÿè·D‰öD‰ÿH‰Ãèé‹C!H‹t$H‰ßI‰Åè …Àt¿‹)!¾äH‰ßèì…À„äH‰ßè,dD‰ÿH‰Åè!…À„Y¿¤A1ÀèÊÿÿè8‡…À…H…í„‹=å!…ÿ„ÙH‰ßèÁ?H‰îH‰Â¿ú@1ÀèßÉÿÿA€}X~S‹5²!…ötIL‰ëM‰ì1íë@‹ š!HƒÃIƒÄ…Ét)¾KP¶S@1ÀD¶CHI‹4$¿à!AƒÅèŽÉÿÿA¾EX9èÅH‹=Ž!1Ò¾ AƒÆè^ÐÿÿAƒþ…Òþÿÿ@1À¿ìAèTÉÿÿ‹D$9D$„D‹|$élüÿÿ@¿ªA1Àè,ÉÿÿëÊf.„H‰î¿Q:A1ÀèÉÿÿé-ÿÿÿ@H‰ßè@…H‰Ç1ÀèöÈÿÿH…í…æþÿÿH‰ßèµ>¿Q:AH‰Æ1ÀèÖÈÿÿéòþÿÿH‹=Ù!1Ò¾ èÍÑÿÿéþÿÿ„H‰Þ¿Q:A1Àè¡Èÿÿéwüÿÿ@H‹|$è΄H‰Ç1Àè„ÈÿÿH…Û…*üÿÿH‹|$èA>¿Q:AH‰Æ1ÀèbÈÿÿé8üÿÿDH‹=a!1Ò¾ èUÑÿÿéØûÿÿH‹=I!1Ò¾è­ÆÿÿH‹„$(dH3%(uHÄ8[]A\A]A^A_Ãè#ÍÿÿUSHƒìÇ„!@BÇ~!ÿÿÿÿÇŒ!dž!Ç€!Çz!Çt!Çn!Çh!Çb!èa‹ûrP‰Å9Ø~ND‰ßèÉ‹=!‹5!1É‹…Òx 9×Oú9òOòHƒÁHù uâƒÃ‰=Õ!‰5Ó!9ëu·‹Å!‹Ã!ò*Ò)Ðò*È1Àò„@"AòYÁòXÂò,Љ †aHƒÀHƒø uÛHƒÄ[]Ã1ÀfD9<… †a}HƒÀHƒøuí¿$?A1ÀéÉÆÿÿf„Hcп˜A1À¾²®AéªÆÿÿf.„ATUS‰óèåºÈ)ÚúÇe¹Ç1Û)ÑHcÒL$H,ë&@;=*!~H¾>¿˜A1ÀèOÆÿÿHƒÃL9ãt%‹|ƒÿþt=ƒÿÿtHƒ=áqPtÇHƒÃè6ÿÿÿL9ãuÛ[]A\Ã@¿œA1Àè Æÿÿë»f.„¿¨A1ÀèôÅÿÿë£fH‹=ù!1Ò¾ èíÎÿÿ¿¬A1ÀèÑÅÿÿH‹=Ú!1Ò¾ è®Ìÿÿéjÿÿÿf„AWA‰ÿAVA‰öAUATUSHƒìèg‹qPA‰Å9Ø›é!蛂…À…#L‰çè[_H…À„5H‰Æ¿Q:A1ÀèSÅÿÿH‹=\!1Ò¾ è0ÌÿÿH‹=I!¾ÿÿÿÿ‰ðH…ÿt¿7¿GD‰ú‰­!è˜Ãÿÿ¿¨A1Àè ÅÿÿD‰ö‰ßèbþÿÿ1À¿ìAèöÄÿÿD9턉ëk¿žA1À‰îèÚÄÿÿ‰ßèãH…ÀI‰ÄtS‰ßè´…Àt0‹Š!¾äL‰çèM…À…%ÿÿÿ¿ªA1Àè™ÄÿÿéAÿÿÿ@H‹=™!1Ò¾ èÍÿÿë»1À¿·AèlÄÿÿD9í…vÿÿÿHƒÄ[]A\A]A^A_ÃL‰ç舀H‰Ç1Àè>ÄÿÿL‰çè&^H…À…ËþÿÿL‰çèõ9é¾þÿÿAUATUSHìˆH‹=!dH‹%(H‰„$x1Àè„ÄÿÿH‹=ý!H…ÿ„L¿G¿_ƒÀDkƒë‰\!1Ò1öèCÂÿÿH‹=Ì!1Ò¾ èÀÌÿÿ¿¼AèëÿÿH‹=¯!1Ò¾ èƒÊÿÿèž¹àèI‰À1öºú@¿1ÀèCÄÿÿH|$è‰ÌÿÿH|$èÁÿÿ‰ÞH‰Â¿1ÀèÄÿÿ¿ÓA1ÀèBÃÿÿH‹=K!1Ò¾ è?Ìÿÿ¿ÛA1Àè#ÃÿÿH‹=,!1Ò¾ èÊÿÿ¿ÝA1ÀèÃÿÿH‹= !1Ò¾ èÌÿÿ¿äA1ÀèåÂÿÿH‹=î!1Ò¾ èÂÉÿÿ¿æA1ÀèÆÂÿÿH‹=Ï!1Ò¾ èÃËÿÿ¿õA1Àè§ÂÿÿH‹=°!1Ò¾ è„Éÿÿ¿÷A1ÀèˆÂÿÿH‹=‘!1Ò¾ è…Ëÿÿ¿,A1ÀèiÂÿÿH‹=r!1Ò¾ èFÉÿÿ¿ A1ÀèJÂÿÿH‹=S!1Ò¾ èGËÿÿ¿A1Àè+ÂÿÿH‹=4!1Ò¾ èÉÿÿ1À¿ Aè ÂÿÿD‹µmPE…Ò…L»`aE1ä@¶‹…Àä…ÀxcH˜H¼$`¹%AH,@º¾1ÀHÁåD‹…À{aèÓÈÿÿHD$L‹…°{aIcüHŒ$`HÇÂÿÿÿÿ¾HÇ1Àè¦ÈÿÿD¥À{aHƒÃHûtau‚H‹={!1Ò¾ E)åAƒíèhÊÿÿº+A1ö¿1ÀèÂÿÿHL$ºQ:AD‰î¿1ÀèüÁÿÿº"AD‰î¿1ÀèèÁÿÿH‹=!!1Ò¾ èõÇÿÿH‹=!1Ò¾èr¿ÿÿD‰ïèÊóÿÿH‹=ó !èÃÿÿH‹„$xdH3%(…_HĈ[]A\A]Ãf„èË}…À…%½ºæ¹D‰è»ÈH¼$)ÈA9Õ¹1ANغP¾A‰Ø1ÀèƒÇÿÿH”$‰î¿1ÀèÁÿÿH‹=V !1Ò¾ è*ÇÿÿH‹=C !1Ҿ觾ÿÿè"øÿÿ‰Þ‰ï1Ûègúÿÿ¿ìA1À½ÓMbèÀÿÿH‹= !1Ò¾ èÉÿÿ¿AA1Àèç¿ÿÿH‹=ð !1Ò¾ èÄÆÿÿ@‹  †a¾³®A¿HAHƒÃ‰ÈÁù÷í1ÀÁú)Ê覿ÿÿHƒûuÐé±þÿÿÇ !ÿÿÿÿ»æÿÿÿA½ÿÿÿÿé²ûÿÿèy{HæhéÔþÿÿèƒÄÿÿHƒìèÀÿÿ袿ÿÿèÍÇÿÿHƒÄé$ûÿÿ@Hƒì¿ìA1Àè0¿ÿÿHƒÄé§¾ÿÿ€Hƒìè×ÿÿÿHƒÄé®ÿÿÿH‰\$èH‰l$ðH‰óL‰d$øH‰ýHƒì¾¿èXÅÿÿH…ÀI‰Ät2H‰ßèè¿ÿÿI‰$H‹Å !H‹$L‰%º !H‹l$I‰D$L‹d$HƒÄÃH‹=Ï !H‰éºˆ"A¾1Àèc½ÿÿ¿è¹½ÿÿf„ATUSH‰ûèô¿ÿÿH‰ÅLcåè9ÀÿÿIÜ1ÒëfAÆM¾DÿH‹0‰Ñé@•ÇBöDF A•ÀHƒêA„øu×¶H‰Ø„Òt2H¾ÒöDV t,@„ÿuë%H¾ÒƒéöDV t…Ét HƒÀ¶„Òuã[]A\ÃH‰ØëöUSH‰ûH‰÷HìdH‹%(H‰„$1ÀH…öt€>-…ˆ€~…~H‹=Ç !èÊÄÿÿH‹-» !ëH‰çèÿÿÿH‰ßH‰Æè}þÿÿH‰ê¾H‰çè¾ÿÿH…ÀuØH‰ïè¿ÿÿ…ÀuH9-} !tH‰ïèÛÃÿÿH‹„$dH3%(uVHÄ[]ÃfD¾›(Aè>½ÿÿH…ÀH‰Åu™è¡Áÿÿ‹8躿ÿÿH‰ÙI‰Àºö%AH‹=0 !¾1ÀèÌ»ÿÿ¿è"¼ÿÿèýÁÿÿèhÁÿÿ‹8è¿ÿÿH‰ÙI‰Àº&AëÅ@¸ÀäÇÿÿÿÿHƒÀH=Àèuî¶Oÿ 1ö„Òt+¹Ð{a1ÀfˆÀè¶Òp‰•Àä¶HƒÀHƒÁ0„ÒuÞHcöƆÀèÃAWAVAUATA¼ÿÿÿÿU‰ýSH‰óHƒì€E1À¹Àaº¨"AH‰Þ‰ïèYÀÿÿƒøÿ„€ƒè4ƒøFwØÿ$Å()AÇÚ !ǰgPëºf.„ÇšgPë¤@L‹- !L‰ïèa½ÿÿHƒø‡¹A¶uE1ÿA¾@„öu ë.fM‰÷I‰Æ@¾ö¿Àè輿ÿÿH…À„_IFA¶tÿ@„öuÔº(L‰î¿`aè2¿ÿÿé-ÿÿÿDÇ!éÿÿÿf„H‹=y!º 1öè-¾ÿÿ=ÿ‰Â‰Ð!ŽÚÇÀ!ÿºÿ9¹!ŽÏþÿÿ‰­!éÄþÿÿ@ǪfPé±þÿÿH‹=!1öèÒÃÿÿfÀWÉfZÀ.Èó€!ƒè±Àÿÿ…À„yþÿÿóA¤.^!†dþÿÿH‹ Õ!¿#Aº9¾èIÂÿÿ¿迹ÿÿ€Çj!é)þÿÿf„Ç fPéþÿÿH‹=y!º 1öè-½ÿÿ‰Â‰Ù!‹Ï!9Ð}‰É!‰Â…ÒÛýÿÿǵ!éÌýÿÿ@ÇÞ!é¹ýÿÿf„H‹=!º 1öèͼÿÿÇË!‰…!éˆýÿÿ„Çš!éqýÿÿH‹Ù!H‰Š!é]ýÿÿDH‹=Á!º 1öèu¼ÿÿiÀ@B‰!é4ýÿÿ@ƒ=!…zÇ!éýÿÿ@H‹=y!º 1öè-¼ÿÿ1Ò=ÿFЉ!éèüÿÿ„H‹=I!1öº èý»ÿÿ‰£ÿ ƒè=þÿ†¹üÿÿH‹ *!¿H&Aº¾èžÀÿÿ¿è¸ÿÿ@H‹5ù!H‹;èáúÿÿé|üÿÿ@ÇbdPéiüÿÿf„H‹=É!1öº è}»ÿÿ=ÿAOĉZ!é9üÿÿf„Ç6! é!üÿÿÇ&!éüÿÿÇ>!éüÿÿH‹=i!º 1öè»ÿÿ1Ò…ÀIЉ!éÛûÿÿÇÂcPéÉûÿÿf„Çö!é±ûÿÿƒ=‘þ …úÇþ é”ûÿÿ@ÇzcPéûÿÿH‹=é!º 1öèºÿÿ‰Sþ ébûÿÿf‹NcPƒøt…ÀuÇCþ HƒÄ[]A\A]A^A_Ãøtâƒøt݃øtØHƒÄ[]A\A]A^A_Ãf.„…À-üÿÿÇÞý ºéüÿÿC¾L=H‹=_!º*&A¾èøµÿÿ¿èN¶ÿÿH‹=?!L‰éº&A¾1ÀèÓµÿÿ¿è)¶ÿÿH‹ !¿@#Aº"¾莾ÿÿ¿è¶ÿÿH‹ õ!¿Ø"Aº ¾èi¾ÿÿ¿èßµÿÿffffff.„ATUSHìH…ÿt}¾b&AHÇ$^&Aè¼ÿÿH…ÀtrLd$»ë DH…Àt1ÿƒÃ¾b&AI‰$IƒÄèÜ»ÿÿƒûvßH…ÀtH‹=c!H‰Áºh#A¾1Àè÷´ÿÿH‰æ‰ßè­ùÿÿÇ#!HÄ[]A\ûëÙS1À¾‰û葾ÿÿƒøÿt,‰Â¾1ÀƒÊ‰ßèy¾ÿÿ…Àu[Ã[¿„+A镽ÿÿD[¿l+Aé…½ÿÿDó* ˜!ó^ÁóY¨©ó,ÀÀ‰ðÁèƸÿÿÑþt0ƒî1ÒHLwfD·HƒÇÂH9Ïuò‰ÐâÿÿÁèÂ÷Ò·ÂóÃfffff.„UH‰åAWAVAUA‰ÕE| McíATI‰üSH‰óHƒì‹5ä!dH‹%(H‰EÈ1ÀD‰øHƒÀHÁèHÁàH)ÄD‰øÁøLt$‰ÂD1úIƒæð)‹§!L‰÷HcÒMõÁø1Æ)Æ@¶öè²²ÿÿA‹$AÆFA‰A‹D$A‰FA¶D$ AˆF A·D$ fA‰F ·fA‰E·CfA‰E·CfA‰E·CfA‰ED‰øÁèAǸÿÿAÑÿt3Aƒï1ÒKL~€A·IƒÆÂI9Îuñ‰ÐâÿÿÁèÂ÷Ò·ÂH‹UÈdH3%(uHeØ[A\A]A^A_]Ãè¹ÿÿfff.„HcÇHiÀXH@‡‰Ãffffff.„HcÿHcöHiÿXHƒÆHÁæH„>@‡‰ÃfHcÇHiÀXH˜‹‰Ãffffff.„HcÿHcöHiÿXHvHÁàH„8˜‹‰ÃfHcÿ1ÀHiÿX‹Ð‡‰‹— ˆ‰9Ñt2)Ñò j§ò*‡Ô‡‰ò*ÑòYÁò^Âò\Èò²–òYÁò,ÀóÃHcÿHiÿX‹‡Ð‡‰+‡ ˆ‰+‡Ô‡‰ÃHcÿHiÿX‹‡è‡‰Ãffffff.„HcÿHiÿX‹‡ì‡‰Ãffffff.„HcÿHiÿX‹‡ð‡‰Ãffffff.„HcÿHiÿX‹‡ô‡‰Ãffffff.„HcÿHiÿX‹‡ø‡‰Ãffffff.„HcÿHƒì1ÀHiÿX‹—Ô‡‰ƒú~/ò*ÊòH*‡à‡‰ò\ ˜•ò^ÁòQÈf.ÉzòY ¢•ò,ÁHƒÄÃ蜺ÿÿf(ÈëäfDHcÿHiÿX‹‡ü‡‰Ãffffff.„HcÿHiÿX‹‡ˆ‰Ãffffff.„HcÿHiÿX‹‡ˆ‰Ãffffff.„HcÿHiÿX‹‡ˆ‰Ãffffff.„‹ø ƒèÃfDHcÿHiÿX‹‡Ô‡‰Ãffffff.„HcÿHiÿX‹‡Ð‡‰Ãffffff.„HcÿHiÿX‹‡ ˆ‰Ãffffff.„HcÿHiÿX‹‡Ü‡‰Ãffffff.„¸€éÃf.„¸ ˆ‰ÇHXH= àuìóÃfSºÿ¾¿»ÿÿÿÿHƒìÇD$ èê´ÿÿ…À‰baPˆ¡º:¾¿ èÈ´ÿÿº¾¿ ‰+aPè®´ÿÿ‹=(aPHL$ 1öA¸º‰´`Pè«°ÿÿ…ÀuWº¾¿ès´ÿÿ…À‰Û`Px.‰Ç1Ûè úÿÿº:¾¿ èL´ÿÿ…À‰daPx‰ÇèûùÿÿHƒÄ‰Ø[ÿœ+Aè¶·ÿÿëé@‹š`P…Àxf‹hö ƒøtCƒø‹"`Pt 1À…Òx óÄ‹j`PÁøÃfD‹þ_P1À…Ò‰ð_PyÔëÜ@‹:`P1À…Ò‰Ø_Py¼ëÄ@¸ÿÿÿÿÃf.„‹îõ HÇÆpÿÿÿSÇ8ú ¹Ð‡‰Hî@‡‰ƒè‰{UPHÇÇA<ÇAÇA1ÀÇA ÇAÇA$ÇAÇA ÇA(HÇAÇA,ÇA0ÇA4ÇA8Ç„ˆ‰þÿÿÿHƒÀH= uéÇ`:ÿÿÿHÁXHùÐß…[ÿÿÿ»`‡afD‹;ÇCä…ÿ~ èάÿÿÇHƒÃ(Hû`‡‰uÛ[1ö¿Pßéî­ÿÿfffff.„1ÒH…ÿSH‰ût6‹ïû H‹5ù ƒøf‰„|1Òƒø t‹=Ã^Pèšµÿÿ1Òƒøÿ„‰Ð[ÃH‹Ùø H‰þ¿ fÇBHƒÂè*¬ÿÿ…ÀH‹5©ø ºµH‹=ëú º ,AH‰Ù¾1Àè¬ÿÿºë©„H‹5aø fÇFHƒÆèJµÿÿ…ÀH‹5Yø ºaÿÿÿëª@¿À,Aè6µÿÿº‰Ð[Ãffff.„Hƒì‹ ^P…Éx‹=¨]Pè—«ÿÿ‹=1_P茫ÿÿ‹=Ö]P…ÿxè}«ÿÿ‹w]P…Òx‹=Å]Pèh«ÿÿ‹=f]Pè]«ÿÿ‹=W^P…ÿxHƒÄéJ«ÿÿf.„HƒÄÃff.„‹2]PÃf„HcÇHiÀXHˆ‰Ãffffff.„U1íS»0‹‰HƒìHcýºƒÅHiÿXH·ˆ‰HLj‰èk°ÿÿƒÇCüþÿÿÿHÃXýuÂHƒÄ[]Ãff.„SHcßHiÃXƒ¸,‹‰þtè‡ÿÿÿHiÛXǃ,‹‰ÿÿÿÿ[Ã@HcÏHcöHiÁXH¶HÁ≺@‡aÇ‚D‡aD‹€Ð‡‰‹°Ø‡‰HÇ‚P‡aHÇ‚X‡aÇ€ ˆ‰AƒÀ…öD‰€Ð‡‰D‰‚H‡at ǀ܇‰HiÉXÇØ‡‰éHÿÿÿ„S‹mö ¸è€S‰ÞúL‰Tö èKÿÿÿ‰Ø[ÀHcÿHiÇX+°0‹‰þÈwHiÿÖHcöHD>4‰…@‡‰óÃH‰\$ðH‰l$øHƒì·H‰óH‰Õfƒøt3fƒø t]H‹ ø º!¾¿è,Aè’²ÿÿÆH‹l$H‹\$HƒÄËè¯ÿÿHUÿH‰ßH‰Æèi±ÿÿÆD+ÿH‹\$H‹l$HƒÄÃDHw‰ÑH‹l$H‰Ú¿ H‹\$HƒÄé³ÿÿffffff.„ƒút ƒú t¸ÿÿÿÿúé¶°ÿÿfDº馰ÿÿfDAWAVAUATE1äUSHƒì‹¹ð ƒø~nƒÀD‹5Ú÷ L‹=\P‰D$ »ë'„D‰ò¾äH‰ïè€ÿÿÿ…ÀDEãƒÃ;\$ t+DkþD‰òL‰þIcíHiíXHÅ@‡‰H‰ïèNÿÿÿ…ÀuºEeHƒÄD‰à[]A\A]A^A_Ã@ƒútƒú tóÃ@H‹H‰H‹FH‰GˉÃff.„SH‰ûHì dH‹%(H‰„$˜1Àèíùÿÿ‹CH‹ô ƒøf‰t3ƒø „ÒH‹ Sö ¿Ñ+Aº¾èǰÿÿ¿è=¨ÿÿD‹ÂYPH‹=»ó º‰¤YP‹šYPHƒÇ‰HYPH‹CH‹0è4ÿÿÿH‹•ó HƒÀH‰*ZPH‹{ó HƒÀH‰¸ZP‹=YPHT$ Ht$ÇD$ €è“«ÿÿH|$º.¾€éè_ýÿÿ1ÀH‹”$˜dH3%(uoHÄ [˺XP…Òx`‹°YP…ÀxV‰®XPH‹CH‹=ó ‰éXPº H‹0HƒÇè„þÿÿH‹ó HƒÀH‰zYPH‹ëò HƒÀH‰ZPéKÿÿÿè­ÿÿH‹ õ ¿µ+Aº¾苯ÿÿ¿è§ÿÿAWA‰ÿAVAUATUSHƒìXH‰T$ ‹tõ H|$0dH‹%(H‰D$H1ÀH‰L$(èõýÿÿAÿÿÿ‡øMcÿK¿HÁãD‹ƒD‡aE…À„Ý‹»`‡aǃD‡a…ÿ~è´¥ÿÿǃ`‡aK¿L‹d$(D‹-úô ¾äHÁâ‹‚@‡aD+¢X‡a‰D$Lct$H‹D$ H+‚P‡aD‰êIiÞXiÀ@BH«@‡‰AÄH‰ïè}üÿÿ1Ò…ÀH‰\$„žfDHj‰T$H‹T$Ht$0H‰èHÁàHœ@‡‰D‰êH‰ßè<üÿÿ…Àt!D‰ê¾äH‰ßè(üÿÿ…À„XHƒýH‰êu¯IiÖXD‰à+‚臉‰‚ü‡‰HÂð‡‰…ÀˆIiÆX‹¸Ô‡‰D‰ è‡‰…ÿަIiÆXHà‡‰D;` }D‰` IiÆXD; ð‡‰~D‰ ð‡‰IiÆX‹ü‡‰Hˆ‰;P~‰PIiÎXD‰â‹ô‡‰‹±Ô‡‰H™Ð‡‰D‹ü‡‰D‹‰ˆ‰H©ð‡‰)ƒÆò*ÊD‰â‰±Ô‡‰ò*Þò*ÀòX Á™f(Ñò^ÓòXÂòH*‘à‡‰ò,À)‰ô‡‰ò*ÂòYÁò^˜™òXÐòH,ÂH‰à‡‰D‰ÀD)ȉÂÁú÷þ‹‘ˆ‰AÁBD‰‰ˆ‰ÁøA)ÀDƒþ‰‘ˆ‰~Uò„ˆò*ø‡‰f(Ëò$ò\Êò^Ë莧ÿÿò*Kò$òD$ò^ÑòA*Äf(Êèl§ÿÿòYD$ò,À‰EIiÖXK¿‹ÅH‡a+‚0‹‰Ç‚؇‰Ç‚܇‰Ç‚ ˆ‰=Èv:‹|$D‰æèÖDfDH‹D$HdH3%(…HƒÄX[]A\A]A^A_ÃDMiöÖH˜‹|$D‰æJD04D‰$…@‡‰è†Dë´@Ht$0D‰êH‰ïèúÿÿH‹”$‹|$H‰îH‰“8‹‰H‹”$˜H‰“@‹‰H‹”$ H‰“H‹‰H‹”$¨H‰“P‹‰H‹”$°H‰“X‹‰H‹”$¸H‰“`‹‰H‹”$ÀH‰“h‹‰H‹”$ÈH‰“p‹‰H‹”$ÐH‰“x‹‰H‹”$ØH‰“€‹‰H‹”$àH‰“ˆ‹‰H‹”$èH‰“‹‰èÐC‹*ñ H»P‡‰Ht$0è¹ùÿÿH‹„$H‰ƒ˜‹‰H‹„$˜H‰ƒ ‹‰H‹„$ H‰ƒ¨‹‰H‹„$¨H‰ƒ°‹‰H‹„$°H‰ƒ¸‹‰H‹„$¸H‰ƒÀ‹‰H‹„$ÀH‰ƒÈ‹‰H‹„$ÈH‰ƒÐ‹‰H‹„$ÐH‰ƒØ‹‰H‹„$ØH‰ƒà‹‰H‹„$àH‰ƒè‹‰H‹„$èH‰ƒð‹‰éüÿÿHˆð‡‰D‰ ø‡‰D‰ ð‡‰D‰ ì‡‰HÇ€à‡‰Ç€ô‡‰Ç€ˆ‰Ç€ˆ‰ÇA é üÿÿ€÷؉B éÜûÿÿfDHt$0D‰êH‰ßèˆøÿÿHcD$H‹T$H‰Þ‹|$H@HÁàH„‹‰H‹”$H‰PH‹”$˜H‰PH‹”$ H‰PH‹”$¨H‰P H‹”$°H‰P(H‹”$¸H‰P0H‹”$ÀH‰P8H‹”$ÈH‰P@H‹”$ÐH‰PHH‹”$ØH‰PPH‹”$àH‰PXH‹”$èH‰P`èÒAéæúÿÿèx¦ÿÿ„AU1Ò¾ATA‰üUSHì(‹=ï dH‹%(H‰„$1ÀAD$ÇD$‰D$èZ¥ÿÿ…À‰Ãˆ²Ll$1À¹H¬$L‰ïóH«H‰ï±óH«‹¨î ƒøf‰D$f‰„$„"ƒø „iº€L‰î‰ßèJ¨ÿÿ…À… HT$ L‰î‰ßÇD$ €è›£ÿÿ…À…HT$1À¾!T‰ßÇD$èøžÿÿ…À…à‹*î ƒø„aƒø „·D$fƒøt%fƒø tèA¿<,Aè¨ÿÿ¿è^ŸÿÿfDD·l$D‰çfAÁÍE·íD‰îMcíOd­èöóÿÿIÁä1öI¼$P‡a蓟ÿÿº€H‰î‰ßA‰œ$`‡aèü¢ÿÿH‹„$dH3%(…€HÄ([]A\A]ÀH‹5qê I}ºHƒÆè÷õÿÿH}‹Mí H‹5ŽQPèáõÿÿ·æ fÁÈf‰„$’é þÿÿf„H‹5Aê I}º HƒÆè§õÿÿH}ë®HL$A¸º¾)‰ß脟ÿÿ…À„Äþÿÿèç?¿,Aèݦÿÿ¿è3žÿÿHL$1öA¸º‰ßèGŸÿÿ…ÀuÇ1öA¸¹È†aº‰ßè*Ÿÿÿ…À„jþÿÿè?¿*,A胦ÿÿ¿èÙÿÿèt?¿õ+Aèj¦ÿÿ¿èÀÿÿè[?¿ ,AèQ¦ÿÿ¿è§ÿÿèB?¿ü+Aè8¦ÿÿ¿èŽÿÿè)?¿ì+Aè¦ÿÿ¿èuÿÿèP£ÿÿAVAUATA‰üUSHìdH‹%(H‰„$ˆ1Àƒ=¬ä „ž‹-HDPAD$ÇD$ ‰D$ƒý~rýv޶ÇDPvºv½v‹˜ë ‹5’ë H\$¹vH‰ßÁø1Æ)Æ@¶öèé¢ÿÿ‹cë ƒøt4ƒø „/1í1ÒE1öé«f„ǶCPº½똋,ë D‹¡CPH{ H‹5è ºÆD$EfÇD$fÇD$A¾ˆD$‰èfÇD$fÁÈE…ÛEÅHƒÆ½f‰D$‹D$ˆD$‹™ã ˆD$èXóÿÿH‹5ùNPH{ºèCóÿÿº‹pã ƒø„ÿE1íƒø„[‹}ê ƒø„ìƒø „“‹åBP‹ßBPÁø1Â)ÂL‹aç ‹=?MP1ÉHcÒA‰éH‰Þèë£ÿÿÁè„Àt%D‹ eç E…Étèã ÿÿ‹ƒøZ„˜ƒø„Ç=ç H‹„$ˆdH3%(…HÄ[]A\A]A^ÃfDƒ=©â …`ÿÿÿ‹=¹LPHL$ A¸º¾)èKœÿÿ…À„8ÿÿÿ¿e,Aè©£ÿÿ¿èÿšÿÿ€ƒ=Yâ „“‹õAP‹ïAP¹ÿÿÿÿÁø1Â)‰ÐÑøt$ƒè1ÉH|CH‰Ø·0HƒÀñH9øuò‰ÈÁèÁ÷Ñf‰L$é×þÿÿ€McîIÝfAÇEèÆ›ÿÿf=ÿD‹‰APF‹|APfÁÈfA‰E‹mAPÁø1Â)ÂfD)òE…ÒfA‰Uu fÁÊfA‰UD‰çè‡ïÿÿfA‰E·À1öH€H<ÅP‡a茚ÿÿA·EfÁÈfA‰Eéþÿÿf„McîIÝAˆUAÆEfAÇEè%›ÿÿD‰çfA‰Eè(ïÿÿ‹â@P‰ÇfA‰E‹Õ@PÁú1Ð)ÐD)ð‰ÂÁêкÿÿÿÿÑøt*ƒè1ÒItEL‰èfD·HƒÀÊH9ðuò‰ÐÁèÂ÷Ò·ÇfA‰U1öH€E1íH<ÅP‡aèÓ™ÿÿékýÿÿfDD‹d$E…ä„_þÿÿ¿ èšÿÿ‹T$ ‹ F@PL‰îD‰ H‰Ç‰P¶T$ˆP A·Uf‰P ‹#@PÁú1Ñ)Ѻ D)ñèäÿÿfA‰Eé þÿÿD‹ú?P‹ô?P1ÉL‹{ä ‹=YJPA‰éH‰ÞÁø1Â)Âf‰T$HcÒèû ÿÿ…Àˆ4ýÿÿǽ?Pé%ýÿÿ@è øÿÿé!ýÿÿ‹=JPHL$A¸º¾)覙ÿÿ…Àu½º€E1öéRüÿÿHcÕéVûÿÿè3žÿÿ¿H,Aèé ÿÿ¿è?˜ÿÿffffff.„AWAVAUATUSHƒì‹=4?P;=zß }(‹zß …Àˆ‰?P‹–æ …Ûˆ0‹=?Pèwúÿÿ‹Eß D‹5ò>P1ÛD‹-aæ L‹=¢JPƒèD9ð‰D$ }U‹l$ 1Û„LcåD‰ê¾äMiäXIÄ@‡‰L‰çèïíÿÿD‰êƒøL‰þL‰çƒÓèÛíÿÿ…À¸D؃ÅA9î¹IcþD‰êL‰þHiÿXHÇ@‡‰è­íÿÿ…Àt9ƒû4‹žÞ ƒèA9Æ}&AƒÆ1ÀD‰5A>PHƒÄ[]A\A]A^A_Ãf.„‹D$ AƒÆD‰5Áâ ‰>PHƒÄ¸[]A\A]A^A_Ãè’Ÿÿÿ¹äÿÿÿ+ CÞ ‰ÂÁú÷ùƒÂ‰×=PéÂþÿÿèmŸÿÿò*Àò^©‹òY©‹òX©‹ò,À÷؉1å éžþÿÿS1ÒH‰û1ÀA¸ëfHiòXHƒÂL‰ÁHÆ@‡‰HúH‰÷óH«uÜH‹õá ‹SH‹=#IPf‰H‹CH‹0èlíÿÿ‹Cƒøt*ƒø tLH‹ ä ¿~,Aº¾蔞ÿÿ¿è –ÿÿH‹CH‹=á ºH‹0HƒÇèíÿÿèYçÿÿ[é³ýÿÿH‹CH‹=ˆá º H‹0HƒÇè÷ìÿÿè2çÿÿ[éŒýÿÿfff.„HcÁH‰\$ØH‰l$àD¶L‰d$èA¹L‰l$ðL‰t$øD¾T¶\D¶\E!ÁEÑ…LAÀøA€ø…>D¾ÃE¾ÛAÁàEØ„)DAA9øD¾D¾\D¶LAÁàAØAƒø†ú€|…ïA€ù…åAƒèAÁèA¾ØDˆBX…ÛŽÍA9ÇŒÂDi Da i I‰ÑƒÁ E1ÒE1Àë+f„D9ÃŽ—‰ÈHƒÂIƒÁ9ÇF…H|~G"H˜AƒÀ¾McÛIóE¶3Áà %ðAÀþAƒæIÆC*AêMcÒH˜¾Áà%ðLðH‰A¶ÐøƒàAˆA@A¶ƒàAƒøAˆAPB¶AˆAHŽjÿÿÿf.„H‹\$ØH‹l$àL‹d$èL‹l$ðL‹t$øÃfDH‰\$ØH‰l$à1öL‰d$èL‰l$ðL‰t$øHìH|$`Æ„$ØdH‹%(H‰„$è1Àè)”ÿÿ‹Câ ƒø„Zƒø „!L„$1í1ÛE1íE1ä‹=ÁDPLL$|H´$€1ɺvèàšÿÿ‹úá ƒú„ÁE1öƒú ti‹ »Ú ƒùtvƒù„%ƒù„ H‹„$èdH3%(…²H‹œ$ðH‹¬$øL‹¤$L‹¬$L‹´$HÄÃDƒøL´$€v§‹ EÚ ƒùuŠA¶9Ùt9Íuƒú„Ó1Ûƒú „H·;fÁÏ·ÿé¸f„ƒøL´$”‡6ÿÿÿéNÿÿÿf.„L„$ÇD$|½»A½M`éÈþÿÿ€L„$ÇD$|½» E1íM`é›þÿÿf.„A¶9Ùt9Í…Ôþÿÿƒú„×1Ûƒú „L·{fÁÏ·ÿ…ÿ„­þÿÿH‹„$€H‹T$`L‰æH‹L$hH‰$H‹„$ˆH‰D$H‹„$H‰D$H‹„$˜H‰D$H‹„$ H‰D$ H‹„$¨H‰D$(H‹„$°H‰D$0H‹„$¸H‰D$8H‹„$ÀH‰D$@H‹„$ÈH‰D$HH‹„$ÐH‰D$PH‹„$ØH‰D$Xè<êÿÿéûýÿÿ€A¶D9étW9Ë…ãýÿÿƒú„fƒú u>ƒø7†Éýÿÿ=ŒL´$°~&H”$€H´$€¹ˆ‰Çè*ûÿÿf.„A·^è’ÿÿf9Ã…ýÿÿA·~éÂþÿÿƒø7†kýÿÿ=ŒHœ$°Ž˜þÿÿH”$€H´$€¹ˆ‰ÇèÈúÿÿéwþÿÿƒø7†+ýÿÿ=ŒHœ$°ŽœýÿÿH”$€H´$€¹ˆ‰Çèˆúÿÿé{ýÿÿƒø7†ëüÿÿ= Hœ$°ŽþÿÿH”$€H´$€¹œ‰ÇèHúÿÿé÷ýÿÿƒø7†«üÿÿ= Hœ$°ŽýÿÿH”$€H´$€¹œ‰Çèúÿÿéûüÿÿƒø7†küÿÿ= L´$°ŽÄþÿÿH”$€H´$€¹œ‰ÇèÈùÿÿé£þÿÿèN•ÿÿfffff.„¸`‡aA¸D‹…É~‰ÊM‰ÁÁúIÓáHcÒL ×;|ƒÁ‰HƒÀ(H=`‡‰uÓóÃAVI‰þ1öAUATE1äUS»`‡aHìàH|$`Æ„$ÈdH‹%(H‰„$Ø1ÀèOÿÿH‹D$`Liè@BLl$hë:@H‹CðL‰êHiÀ@BHCøH)ÂHcÖ H9ÂwoAƒÄHƒÃ(Aü„*‹+…í~å‰è‰éÁøH˜I‹ÆHÓø¨t°º¾›,A‰ïèg—ÿÿƒøtBè­“ÿÿ‹ƒøot6ƒø t‰‰ïèzÿÿÇéwÿÿÿ€‰ïèaÿÿÇë‚f„H‹D$pH‹T$`D‰çH‹L$hH‹5ß@PH‰$H‹D$xH‰D$H‹„$€H‰D$H‹„$ˆH‰D$H‹„$H‰D$ H‹„$˜H‰D$(H‹„$ H‰D$0H‹„$¨H‰D$8H‹„$°H‰D$@H‹„$¸H‰D$HH‹„$ÀH‰D$PH‹„$ÈH‰D$Xèræÿÿé¥þÿÿDH‹„$ØdH3%(uHÄà[]A\A]A^Ãè “ÿÿS¹1ÀHì Ç„$œH‰çüóH«H´$œH‰çHÇ„$€HÇ„$ˆè—ýÿÿ‹¼$œL„$€H‰â1É1öèÌŒÿÿH‰çè´ýÿÿHÄ [ÃH=94PSH‰ûHè|ÿÿH…Àt H‰HƒÀ[Ãèé‘ÿÿ‹8èÿÿH‹=ƒÚ I‰À‰Ùº@-A¾1ÀèŒÿÿƒÏÿèmŒÿÿffff.„HƒìH…ÿt'H‹GøH…Àt#H= w;H)¿3PHƒïHƒÄérŽÿÿfHƒÄÃH‹ Ú º&¾¿h-Aè”ÿÿè{‹ÿÿH‹ üÙ º)¾¿-Aèp”ÿÿè[‹ÿÿff.„H‰ñL‰l$øI‰ýHÁù?H‰\$àH‰l$èH‰ÏL‰d$ðHƒì(H1÷H)Ï„ÇH‰øI¹‰ˆˆˆˆˆˆˆI¼«ªªªªªªªI÷áH‰ÓI‰ÐHÁëIÁèH‰ØHŸHÁàH)ÃL‰ÀI÷áH‰ÕH‰×HÁíHÁïH‰èI,¨HÁàH)ÅH‰øI÷äI‰ÔHºW)QΠÈEIÁìKdI‰üHÁàI)ÄH‰ðH÷êHÁú H)Ê…ßAÆEM…ä…¡H…íulH…Ûu7L‰èH‹\$H‹l$L‹d$L‹l$ HƒÄ(ÃfAÇE0sAÆEëÓf.„L‰ïèÿÿI|I‰Ø¹œ9AHÇÂÿÿÿÿ¾1À舒ÿÿëŸfDL‰ïèèŒÿÿI|I‰è¹—9AHÇÂÿÿÿÿ¾1ÀèX’ÿÿégÿÿÿL‰ï踌ÿÿI|M‰à¹’9AHÇÂÿÿÿÿ¾1Àè(’ÿÿé2ÿÿÿI‰Ð¹9AHÇÂÿÿÿÿ¾L‰ï1Àè’ÿÿéÿÿÿffff.„F?…öIÆÁøHcЉðÁøÁè ƒá?)ÁH‹×HÓøƒàÀV?…ö‰ðIÖÁøÁèÁú HcÒƒá?)Á¸HÓàH ×ÃDV?…ö‰ðIÖÁøÁèÁú HcÒƒá?)ÁHÇÀþÿÿÿHÓÀH!×ù1ÀüóH«Ã@H‰þ‹=÷× ¹.ºàß鸒ÿÿ„H‰ø‰×H‰òH‰Æé`ˆÿÿéëˆÿÿff.„‹ÚFQÃf„‹î†QÃf„USHƒì‹tÐ …ÒuHƒÄ[]Ãf„¿€óèF‹ÿÿ‹@DP…À„)1Ò¾¿H DPÀèÌÿÿƒøÿ‰Ã‰aFQ„!1Ò¾¿ èªÿÿƒøÿ‰Ã‰c†Q„-‹=3FQHL$ A¸º¾ÇD$ 葉ÿÿ…À…‹='†QHL$ A¸º¾èi‰ÿÿ…À…ºÀõ¾º9A¿è=‡ÿÿº0:’¾Ä9A¿ è)‡ÿÿ1ÿèâ‘ÿÿ1ÿH‰ÃèØ‘ÿÿH‰ÅHÁåè,‰ÿÿH1ÝH˜H1Å1ÀH‰-ó>PHÇ€àõHÇ€à>“HƒÀH=uÞHƒÄ[]ÃH‹  Õ ¿¡9Aº¾èÿÿ¿ÿÿÿÿ芇ÿÿèÕŒÿÿ‹8èîŠÿÿºÀ-AH‰ÁH‹=gÕ ¾1Àè‡ÿÿ‰ßè\‡ÿÿè§Œÿÿ‹8èÀŠÿÿº.AH‰ÁëÐ葌ÿÿ‹8誊ÿÿºP.AH‰ÁH‹=#Õ ¾1À迆ÿÿ¿ÿÿÿÿè‡ÿÿè`Œÿÿ‹8èyŠÿÿº˜.AH‰ÁëÍffffff.„Hƒì¿hè"úÿÿH…ÀH‰Æ„¿¨H‰Çºh…†@öÇ…”@öÇu^‰Ñ1ÀÁéöÂóH«u7öÂu"ƒâu H‰ðHƒÄÃDÆH‰ðHƒÄÃDfÇHƒÇƒâtÕëàÇHƒÇöÂt¿ë߀ǃêHƒÇë“f„HxƲg@öÇ„qÿÿÿDfǃêHƒÇé[ÿÿÿèb‹ÿÿ‹8è{‰ÿÿH‹=üÓ H‰ÁºÈ9A¾1Àè…ÿÿƒÏÿèè…ÿÿ„H‰ø%ÿÀ‹ZÔ 1Àƒêƒúw=D‹ •=AE…É~01ɶ4HƒÁH¾Ö@ÐþH1ÂH¾öI‰ÐHòIÑèA9ÉJØ%ÿóö1À„Ét1€H¾ÑÐùHƒÇH1ÂH¾ÉH‰ÖHʶHÑîH2„ÉuÛ%ÿóÃ@·O`H‰ÎæÿH‹õàõH…Àué‡f;J`v#H‰ÐH‹PH…ÒuîH‹PH…ÒtDf;J`s H‰ÐH‹PH…Òuîf;H`w(H‰WH‹PH‰GH…ÒtH‰zH‰xH‰<õàõÃfDH‹PH‰GH‰WH‹PH…ÒtH‰zH‰xH‰<õàõÃHÇGHÇGH‰<õàõ÷G`%ÿH9<Åàõt%H‹GH…ÀtH‹WH‰PH‹WH…ÒtH‰BóÃDH‹WH…ÒtH‰ÅàõëÈDH‹Wëëf.„AVE1öAUI‰ýATUSL‹gHA¶$„Òt0L‰áfH¾ÂHƒÁÐúL1ðL¾ò¶H‰ÆIÆHÑîIö„ÒuÜAæÿJ‹õà>“H…Ûué¢H‹uHL‰çè„ÿÿ…Ày+H‰ëH‹k0H…íuäH‹k8H…ítH‹uHL‰çèìƒÿÿ…À~ H‰ëH‹k8H…íuäH‹sHL‰çèЃÿÿ…Àx,I‰m8H‹C8I‰]0H…ÀtL‰h0L‰k8[]A\N‰,õà>“A]A^ÃfH‹C0I‰]8I‰E0H‹C0H…ÀtL‰h8L‰k0ëÎIÇE8IÇE0ë¼ffffff.„I‰ùH‹H1ö¶H‰ù„Òt0DH¾ÂÐúHƒÁH1ðH¾ÒI‰ÀHжIÑèJ4„ÒuÛæÿL9 õà>“t#I‹A0H…ÀtI‹Q8H‰P8I‹Q8H…ÒtH‰B0é0öÿÿI‹A8H…ÀtH‰õà>“I‹yHëÆI‹A0ëìAUATI‰üUHoPSH‰ïHƒìè‡üÿÿH‹Åà>’I‰ÅH…Ûu!éÃf‹ÊÐ HƒÆPH‰ïèŽØÿÿ…À~4H‹[ H‹s H…öuÝH‹s(H…öt'@‹šÐ HƒÆPH‰ïè^Øÿÿ…Ày H‹[(H‹s(H…öuÝ‹wÐ H{PH‰îè;Øÿÿ…Àx7H‹C(I‰\$ I‰D$(H‹C(H…ÀtL‰` L‰c(N‰$íà>’HƒÄ[]A\A]ÃDH‹C I‰\$(I‰D$ H‹C H…ÀtL‰`(L‰c ëÇIÇD$(IÇD$ ë³ff.„SH‰ûHPèƒûÿÿH9Åà>’t)H‹C H…ÀtH‹S(H‰P(H‹S(H…ÒtH‰B [Ãf„H‹S(H…ÒtH‰Åà>’ëÄDH‹S ëëfH‹¡(PH…ÀttóG@ëD.@@r2H‰ÐH‹H…Òuï.@@r!HÇH‰GH‰8H‰=\(PHƒì'PÃH‹PH‰H‰WH‹PH…ÒtH‰:H‰xHƒÅ'PÃH‰=-(PëêHÇHÇGH‰= (PH‰= (PHƒ“'PÃf.„H‹é'PH…À„ óO@ëf„.Áv(H‰ÐH‹Pó@@H…ÒuêH‹H…Òtf.Èr;óB@H‰ÐH‹H…Òuë.Èr&HÇH‰GH‰8H‰='PHƒ'PÄH‹PH‰H‰WH‹PH…ÒtH‰:H‰xHƒå&PÃH‰=M'PëêHÇHÇGH‰=*'PH‰=+'PHƒ³&PÃf.„H‹GH‹H…Àt4H‰H‹H…ÒtH‰BHƒ-…&PÃ@H‰á&PHƒ-q&PÄH‰Ñ&PëÉ€SH‰ûè§ÿÿÿH‰ßèúÿÿH‰ßè§ýÿÿHƒ{HtH‰ß[é÷ûÿÿ€[Ãfffff.„H‰ùáÿH‹ÍàõH…ÀuëS„f;z`r#H‰ÐH‹PH…ÒuîH‹PH…ÒtDf;z`w H‰ÐH‹PH…Òuîf9x`uH‰ÍàõÀ1ÀÃóÃAUE1íATI‰üUSHƒì¶„Òt5H‰ùE1íH¾ÂÐúHƒÁL1èH¾ÒH‰ÆHжHÑîL,0„ÒuÛAåÿMcíJ‹íà>“H…ÛuëbfH‹uHL‰çèd~ÿÿ…Àx/H‰ëH‹k0H…íuäH‹k8H…ít#H‹C0L‰çH‹pHè8~ÿÿ…À H‰ëH‹k8H…íuàH‹sHL‰çè~ÿÿ…ÀuJ‰íà>“HƒÄH‰Ø[]A\A]Ã1Ûëîfffff.„ATUH‰ýSè´÷ÿÿH‹Åà>’I‰ÄH…Ûuësf‹úË HƒÆPH‰ïè¾Óÿÿ…Àx4H‹[ H‹s H…öuÝH‹s(H…öt'@‹ÊË HƒÆPH‰ïèŽÓÿÿ…À H‹[(H‹s(H…öuÝ‹§Ë HsPH‰ïèkÓÿÿ…ÀuJ‰åà>’H‰Ø[]A\Ã1ÛëôHƒìH‹5ÝÊ è€€ÿÿH‹5ÑÊ ¿ HƒÄéË~ÿÿff.„AVA‰ðE1É1ö¹AUATUS‰ÓH‰ú¿€óHì0Ll$ ÇD$HÇD$dH‹%(H‰„$(1ÀL‰l$Ç$èð{ÿÿƒøÿA‰Ä„äfƒ=°9Pf‰\$ t/»˜õ1íLcðL‹M…Àt fAƒ8 „˜·…9PƒÅHƒÃ9èÛ‹ p7P…É~'½”ó1ÛMcôfƒ}Lct7CHƒÅ9J7PL‰ããH‹„$(dH3%(uqHÄ0[]A\A]A^ÃfL‰à‹=g9QA¹HÁà1ÉL‰òL€„óL‰îèÙƒÿÿë €‹=^yQA¹1ÉL‰òL‰îè·ƒÿÿéJÿÿÿf¿à.Aèvþÿÿé|ÿÿÿè<ÿÿfff.„Hƒì€buHƒÄÃÆGbèÇûÿÿ‹5¹"P…ötç¿á9AHƒÄé/þÿÿffffff.„òH*ÆSÆGbH‰ûòXë-PfÀfZÀóG@èyûÿÿ‹=k"P…ÿu[ÃDL‹KH¿ö‘A¸/A¹@º¾@1À賂ÿÿ[¿ö‘é¸ýÿÿ„f.€o{6ò ~-Pf.Ávò\Áòf.Èv"ò1ÀøÃf.„uÈ1ÀÃ1ÀfDÃffffff.„AUI‰õATLf@UH‰õSH_Hƒì„D¶H‰ï¹û9AHÇÂÿÿÿÿ¾HƒÅHƒëD‰ÀAƒàÀèA‰Á1ÀAƒáèÈÿÿL9åuÃI¸ip6.arpaM‰E@ÆEHƒÄ[]A\A]ÃfDH‰\$ÐH‰l$ØH‰ûL‰d$àL‰l$è‰õL‰t$ðL‰|$øH옃þ ¿0/AŽØƒþ „·;è—úÿÿH…ÀI‰Ä„«€xb†B¶{·C·S·KfÁÈfÁÊfÁÉ·s A‰Àf‰CfÁÎ@öÇf‰Sf‰Kf‰s …P@„ÿ‰7ƒçx…®D¶KAƒá…‡f…Ò„¶D‹ w PE…É…¶fAƒø¿0A…&Hcí¿È0AL,+Hk I9í‚ A¶D$bƒè<w(‹:Ç ƒø„*ƒø uI|$P¾À:’èMþÿÿDH‰êH‰ßA¸¹`ïL‰îÆ/Pè˜zÿÿƒøÿA‰ÆºÀ:’¿ð0A„¢‹ HƒÂÿþþþ÷Ñ!È%€€€€té‰Á¾`ï¿À:’Áé©€€DÁHJHDÑÀHƒÚHêÀ:’Æ‚`ïècxÿÿ…À„D‹|PE…À„Ì¿ö‘A¹À:’A¸81A¹@º¾@1ÀHÇ$`ïè¼ÿÿ¿ö‘€H‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘéúÿÿDAƒù„¾AƒùH‹ÃÄ  IcÁH‹Å`…aH‰$A¸ 6A¹@º¾@¿ö‘1Àè1ÿÿ¿ö‘è7úÿÿHƒPH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘÿp/Aé6ÿÿÿfD¿È/Aé&ÿÿÿfD¿˜/AéÿÿÿfDHƒPë—fDD‹ 1PE…ÉuTHƒPL‰çH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘéûÿÿfD¿0Aé¦þÿÿfD¿l:AèVùÿÿë @¿è5Aé†þÿÿfD·ö·É·ÒD·ÈA¸P0A‰t$‰L$‰$¹@º¾@¿ö‘1Àè÷}ÿÿ¿ö‘èýøÿÿD·Céýüÿÿ‹=eP…ÿ…Mcö¿¨1ALõLuM9õ‚ þÿÿ¶E¶UÁà ¶E¶mf‰T$FÁàf‰l$Df D$Dfƒ|$DtOfƒ|$DH‹ùÁ D·L$Dw IcÁH‹Å€„aH‰$¿ö‘A¸à1A¹@º¾@1ÀèI}ÿÿ¿ö‘èOøÿÿfƒ|$F „“fƒ|$FH‹> D·L$Fw IcÁH‹ÅÀ„aH‰$¿ö‘A¸h2A¹@º¾@1Àèî|ÿÿ¿ö‘èô÷ÿÿ·CfCfC f‰D$B„®ýÿÿM9õ‚ÉID$PL‰d$PH‰\$8H‰D$Xé«¶ÒÁà@¶öÁâ¶É ЋPÁá ð ÈH˜…ÒH‰D$H…E…Òuifƒû„ùfƒû „ïfƒû„BfƒûH‹dÁ D·Ëw IcÁH‹ÅÀ„aH‰$A¸x5A¿ö‘¹@º¾@1Àè|ÿÿ¿ö‘è÷ÿÿfƒl$B„áüÿÿH‹|$8A¸¹`ïL‰òL‰îÆ+Pèvÿÿƒøÿ‰Ã„ºÀ:’‹ HƒÂÿþþþ÷Ñ!È%€€€€té‰Á¾`ï¿À:’Áé©€€DÁHJHDÑÀHƒÚHêÀ:’Æ‚`ïèßsÿÿ‹ PA‰Â…Ét;A¹`ïA¸83A¹@º¾@¿ö‘1ÀD‰T$(èF{ÿÿ¿ö‘èLöÿÿD‹T$(HcÛIÞIn I9í‚A¶FE¶FA¶A¶~A¶VA¶NA¶vE¶~ ÁàA ÀfD9D$DA¶F…9E„ÿ„E¶÷IîM9õ‚ÜÁã@¶ÿ ûfƒûA”ÄE„äE‰ã…þÿÿf9\$F„ýýÿÿD‹&PE…Ò„‰þÿÿfƒûH‹¢¿ D·Ëw IcÁH‹ÅÀ„aH‰$A¸¸5Aé9þÿÿH‰Æ¿ 6’D‰T$(Dˆ\$0èsæÿÿA¸B:AI‰Á¹@º¾@¿ö‘1Àè/zÿÿ¿ö‘è5õÿÿD¶\$0D‹T$(é›ýÿÿA€ÿ…æ‹•À H‹|$XH‰îèXÈÿÿ…À…6H‹|$XèvèÿÿA¸€4AI‰Á¹@º¾@¿ö‘1ÀèÂyÿÿ‹LÀ H‰î¿0ëèßÈÿÿ¿0ëè5èÿÿº@H‰Æ¿ö‘è3sÿÿ¿ö‘è™ôÿÿH‹|$PHƒÔPè'öÿÿéfýÿÿH‹|$8A¸¹`ïH‰êL‰îDˆ\$0Æ€(Pè{sÿÿƒøÿ‰ÃD¶\$0„D‹-¼P…í…*ûÿRE„ä…0H‹D$PHƒxH…ûüÿÿ¿`ïHƒÉÿD‰Øò®H÷ÑH‰Ïè.äÿÿH‹T$PH…ÀH‰BH„ð¾`ïH‰ÇèwÿÿH‹|$Pè¥ìÿÿH‹t$HH‹|$Pè¦õÿÿHƒ&Péüÿÿf„A¶D$bƒè<†«ûÿÿ‹5P¿ 2A…ö„˜ûÿÿéÇøÿÿA¶D$PE¶L$R¹:AE¶D$Sº¾¿À:’‰D$A¶D$Q‰$1Àèxÿÿé°÷ÿÿA¹`ïA¸€1A¹@º¾@¿ö‘1Àèxÿÿ¿ö‘èóÿÿé-úÿÿA¹`ïA¸05A¹@º¾@¿ö‘1ÀDˆ\$0èÖwÿÿ¿ö‘èÜòÿÿD¶\$0é•þÿÿ¿Ð3Aéøÿÿ¿ð2Aéý÷ÿÿfƒ|$DE‰ÆH‹¼ D·L$Dw IcÁH‹Å€„aH‰$A¸:A¹@º¾@¿ö‘1Àèewÿÿ¿ö‘èkòÿÿfAƒþH‹Ç» E·Îw IcÁH‹Å€„aH‰$A¸0:A¹@º¾@¿ö‘1Àèwÿÿ¿ö‘èòÿÿ¿3AéU÷ÿÿ¿`3AéK÷ÿÿ¿¨2AéA÷ÿÿ¿ø3Aé7÷ÿÿº¾`ï¿À:’èSsÿÿéÂúÿÿ¿P5AL‹d$PèÏñÿÿéøÿÿL‹d$PH‹|$X¸`ßI‹\$HH…ÛHDØè*åÿÿ¾@I‰ÁA¸°4A¹@º¿ö‘1ÀH‰$èrvÿÿ¿ö‘èxñÿÿH‹t$HHƒËPL‰çH‹\$hH‹l$pL‹d$xL‹¬$€L‹´$ˆL‹¼$HĘéóÿÿ¿ö‘E¶ÏA¸84A¹@º¾@1Àèvÿÿ¿ö‘éFöÿÿ¿è4Aé<öÿÿè7sÿÿ‹8èPqÿÿH‹=Ñ» H‰ÁºT:A¾1ÀèemÿÿƒÏÿè½mÿÿffff.„ATL‹¹ 1É‹=skQA¹„aºU¾@ëSèøtÿÿ…ÀA‰ÄŽ-H‹=^¹ º ¾0:’HƒÇèÃÃÿÿ…À…‹fƒ=·*P„ѽ˜õ1Ûë1@H‹}º ¾äHƒÇè‰Ãÿÿ…Àt3·‚*PƒÃHƒÅ9Ø~(H‹5ô¸ H‹}º HƒÆHƒÇèVÃÿÿ…Àu²·O*P9Ãtk[]D‰æ¿@ëA\éóÿÿfD1Ûfƒ=**P½˜õtC€H‹}H…ÿtH‹5¸ HƒÇº HƒÆèöÂÿÿ…Àt ·ï)PƒÃHƒÅ9ØÈ9Ãu•H‹5]¸ ¹.º à¿ HƒÆè½uÿÿA¸P6AI‰Áëfè›qÿÿ‹8è´oÿÿA¸†:AI‰Á¿ö‘¹@º¾@1Àè tÿÿ[]A\¿ö‘é"ïÿÿfATL‹ß· 1É‹=¯)QA¹„aºU¾@ëSèXsÿÿ…ÀA‰ÄŽíH‹=¶· º¾Àõ»HƒÇèÂÿÿ…À‹'Pu|…À+ëYfDº¾äH‰ïèöÁÿÿ…Àt7‹ì&PƒÃ9Ø~0H‹5^· HcëºHÁåHŘóHƒÆH‰ïè¿Áÿÿ…Àu³‹µ&P9Ä[]D‰æ¿@ëA\é|ñÿÿ@…ÀëÝf‹Š&PƒÃ9Ø~ÎH‹5ü¶ HcûºHÁçHǘóHƒÆè`Áÿÿ…ÀuÌëŸf.„è;pÿÿ‹8èTnÿÿA¸†:AI‰Á¿ö‘¹@º¾@1ÀèÀrÿÿ[]A\¿ö‘éÂíÿÿfH‹‰¶ ‹xèÁoÿÿA¸P6AI‰Áë»fDSH‰ûHƒìƒþ„ƒþ t HƒÄ[Ã@‹ú¸ ƒø„¡ƒø t\·S`¾ ¿ö‘è‰íÿÿD‹ÊPE…ÒtÃH{PèÄàÿÿA¸À6AI‰Á¿ö‘¹@º¾@1ÀèrÿÿHƒÄ¿ö‘[éíÿÿHP¾ö‘è²ïÿÿë”·W`H‹Hè#íÿÿD‹dPE…Û„YÿÿÿL‹KHA¸ˆ6A뜀¶GPD¶OR¹:AD¶GSº@¾‰D$¶GQ¿ö‘‰$1Àèlqÿÿé+ÿÿÿ€AVAUATI‰üUSHƒì0H‹PH…Û„áóS@ò DPA½`ßZÒf.Êf(‚ÕDD¶sbH‹+A€þw`A¶Æÿ$ÅÀAHƒÄéŸ €HƒÄéo€‹Š­ …Òx1ÀèHƒÄé>¡ÿÿfDHƒÄéÿ…ÿÿ€HƒÄéOþÿÿ€HƒÄé_ €HƒÄéÏ ffffff.„‹Þ Pƒøt%ƒøtƒøt óÃf„éë›ÿÿéûÿÿéû€ÿÿff.„‹ž Pƒøt%ƒøtƒøt 1ÀÄ黇ÿÿéÃýÿÿé[…ÿÿff.„ƒ=] PtóÃDéÛùÿÿff.„ƒ== PtóÃDé[úÿÿff.„ƒ= PvóÃDHc P¸HÓà¨ût é „¨t éç„ÿÿ€óÃfffff.„ƒ=Í PtóÃDéëŸÿÿH‰\$èH‰l$ðH‰õL‰d$øHƒì(‹´¬ H‰û¾äH‰ïèt´ÿÿ…ÀtH‹ z¥ …ÉuFH‰ïèŽÔÿÿH‰ÁºQ:A¾QH‰ß1ÀèÔ\ÿÿH˜H‹\$H‹l$L‹d$ HƒÄ(ÃfD¹ªAëÉ‹5J¬ H‰ïè’øÿÿH…ÀI‰Ät¤‹¥ …Òt ‹>¬ …ÀuI‹ $ë˜H‰ïèÔÿÿH‰$M‹ $A¸ú@HÇÁÿÿÿÿº¾QH‰ß1Àè_eÿÿH˜évÿÿÿ„S1ÿHƒìè$gÿÿH|$H‰D$èµ[ÿÿH‰ÃH‰Çèz_ÿÿÆDÿHƒÄH‰Ø[Ãfff.„Hƒìè·ÿÿÿ¾@>AH‰Â¿1ÀHƒÄé]ÿÿffffff.„AUI‰ýATUSHƒì€X~FH‰ûH‰ýE1ä@¶K@D¶KH1ÀD¾CPH‹U¾x?A¿AƒÄHƒÃHƒÅèÁ\ÿÿA¾EXD9àÇHƒÄ[]A\A]Ãfff.„AWAVAUATUSHìÈ‹-íª dH‹%(H‰„$¸1ÀÇD$,!…í…?‹è© D‹L$,…Àx‰Â‹³ª Áú÷=®© …ۉƩ …sH¼$ A¸K>A¹º¾1ÀLt$@èßcÿÿL„$ 1ÀA¹à蹺¾L‰÷è¸cÿÿD‹Eª D‹d$,E…Òt;M‰ôA‹$IƒÄ‚ÿþþþ÷Ò!Ð%€€€€tç‰ÂÁê©€€DÂIT$LDâÀIƒÜE)ô»`a€¶‹…Àä…ÀxiH˜H¼$ A¸%AH,@¹º¾1ÀHÁåD‹À{aècÿÿL‹°{aIcüL„$ L÷HÇÁÿÿÿÿº¾1ÀèðbÿÿD¥À{aHƒÃHûta…xÿÿÿL‰÷è Zÿÿè[±ÿÿ‰D$<èªÿÿ9D$<ŽƒÀ‰D$(H„$@H‰D$ @D‹d$(AƒìD‰çè_§ÿÿD‰çH‰Ãè”§ÿÿH‹|$ H‰ÞH‰D$0è2üÿÿèM…ÀD‹L$,„äH¼$ A¸X>A¹º¾1ÀèAè5Xÿÿ‹=Ÿ¦ …ÿ…Ù€ƒÃƒû…ÿÿÿè¿…Àt#ƒûuH‹D$0€xXt‹5e¦ …ö…¹DƒD$(‹T$89T$<ýÿÿH‹„$¸dH3%(…'HÄÈ[]A\A]A^A_ÃH¼$ A¸i>A¹º¾1ÀèX_ÿÿ‹D$(H‹T$ L„$ ¹¾L‰÷‰D$8H‰$A‰Áº1Àè#_ÿÿé&ýÿÿH‰ïè6úÿÿé!ÿÿÿH‰Çè)úÿÿéÑþÿÿH‰Çèúÿÿé?ÿÿÿ¿àèè=Yÿÿ‰D$,èt­ÿÿ‰Åè¦ÿÿ9ʼnÃŽúÿÿH”$@D‹d$,I‰Õ‰ß茣ÿÿL‰ïH‰Æèqøÿÿ…ÀtA9ÄDLàƒÃ9ëuÜD‰d$,é_úÿÿD‰ËèMD‹L$,D‹9¤ ƒÃ‰\$,AÁE…ÛAADDÈé_úÿÿèB\ÿÿfóÃfffff.„éÛùÿÿff.„óÃfffff.„AWºàè¾…>A¿AVAUATUSHƒìhH‹ ¼¤ dH‹%(H‰D$X1Àè'Vÿÿ‹‰¤ 1À¾˜>A¿èVÿÿ‹F …ÒˆÂ1À¾¢>A¿èñUÿÿ‹W¤ …ÀˆË¶Ð¾¿>A¿1ÀèÏUÿÿ‹ ¾ì>A¿1Àè¸Uÿÿè¬ÿÿA‰Å軤ÿÿA9ʼnÅŽ7‰ïDe»`aè0¢ÿÿH‰çH‰Æè÷ÿÿH‰áD‰â¾ø>A¿1ÀènUÿÿëA@AÿW ò*ÀI‹–°{aH‰æ¿¸H‰Ñò^Y9èÆD$ IÁæM¾¨{aI‹wèPVÿÿºQ¾?AH‰çè>VÿÿI‹¾fèÀZÿÿH…À‰ï¸…HÿÿÿAÿW I‹–°{a‰ÁH‰æ1À¿HƒÃI‰ÐèTÿÿHûta…Uÿÿÿ¿?AèTÿÿE9ìtD‰åéÉþÿÿ¿&?AèÿSÿÿH‹D$XdH3%(uMHƒÄh[]A\A]A^A_ÉÑ1Àº÷Ù¾¬>A¿è&Tÿÿ‹Œ¢ …À‰5þÿÿ¾Ò>A¿1ÀèTÿÿé3þÿÿè­Yÿÿffff.„óÃfffff.„AWAVAUATUSHì¨dH‹%(H‰„$˜1ÀH‰|$8¸`af¶HƒÀH=ta‹•Àäuêèõ©ÿÿA‰Çè¢ÿÿA9ÇŽ[D`Ll$@Al$ÿ‰ïè  ÿÿL‰ïH‰ÆI‰Æèîôÿÿ‰ïèç ÿÿ‰Â‹×  …À…GL‰÷‰T$(è H…À‹T$(t H‰ÇèJ•ÿÿ‹T$(L‹ Ÿ¡ H‹L$8A¸-?A‰T$H‰D$ºu&A¾0?A¿1ÀE‰æL‰l$D‰$$èéRÿÿÇD$4ë1€ÿR ò*À¾g?A¿¸ò^Ò6èµRÿÿƒl$4tnHcÛ¶ƒ`a‹…Àä…ÛxäHcþfH@HÁâH‹º¸{aH¨{aH‰T$(èqXÿÿH…À‰ïH‹T$(¸uˆÿR ¾n?A‰Â¿1ÀèJRÿÿƒl$4u•¿ AƒÄè’RÿÿE9þŒ±þÿÿH‹„$˜dH3%(uSHĨ[]A\A]A^A_Ã@L‹ y  H‹L$8A¸-?A‰T$¾M?Aºu&A¿1ÀE‰æL‰l$D‰$$èÈQÿÿéÚþÿÿènWÿÿAW1öAVAUATE1äU1íSHìXH¼$H\$L´$Ç„$Lè³QÿÿÇD$ ó§˜ èNœÿÿºƒÞC‰ÁH‰ß÷ê‰ÈÁøÁú)ÂHcÂiÒ@BH‰HýO1À)ѺHcÉH‰ =ýOH‰ÑüóH«H‰ÑL‰÷üóH«‹Z˜ Ç„$L…ÀtHƒL$Ç„$L‹(˜ E1ÿÇD$…À…è ¤ÿÿH?…À‰ÂIÈÁúÁêÁùD,HcÉH‰ $Aƒå?A)ÕºD‰éHÓâH‹ $H TÌ;„$L| ƒÀ‰„$Lƒ=µ— „À l$ éîfDH‹¼$(H‹´$L‹iüO„ÓH)ÑH)÷ˆ”I)øH)ÈM…ÀL‰„$8H‰„$0ˆ(D‹Y— E…Ûtcò¬VTòH,ÈH9Œ$0Ž)òY±DHºÛ4¶×‚ÞCòH,ðH‰ðH÷êH‰ðHÁø?HÁúH)ÂHiÒ@BH)ÖH‰òH‰Œ$0H‰”$8‹¼$LL„$01É1ÒH‰ÞèVOÿÿ…À‰2è©Tÿÿƒ8… …í…à‹¾– …À…bH¼$ 1öè›OÿÿH‹”$H‹\ûOH‹Œ$ H4H9ñŽÏþÿÿH‹„$ D;%p– H‰„$H‹„$(H‰„$|‹T– …À„h‹‚ …À…Zè¶ÿÿ…ÀtAƒÄH‹¼$(H‹´$H‹Œ$ H‹”$L‹ÖúOH‹ÇúOH)ÑH)÷‰lþÿÿHƒéHÇ@Bé\þÿÿ‹¼$LL„$01ÉL‰òH‰ÞHÇ„$0HÇ„$8è$Nÿÿ…ÀˆÎþÿÿH‹$1íH‹DÔL£ès@µèºÿÿD‹|• E…Ò…ÓöD$…¨ƒ=Y• …°üÿÿL‰÷èþÿÿé£üÿÿfDècîÿÿé‘þÿÿHƒèIÀ@BH‰„$0L‰„$8é¸ýÿÿ„…þÿÿòY‚BHºÛ4¶×‚ÞCòH,ðH‰ðH÷êH‰ðHÁø?HÁúH)ÂHiÒ@BH)ÖH9´$8H‰òŽÓýÿÿé¾ýÿÿ€N L9ÏŒ ýÿÿé/þÿÿfD¿£?AèÆUÿÿ¿èMÿÿ@èóÃÿÿ‰Â‰D$‹L$ƒÂ?…ÀIÐÁøÁèÁúÁHcÒƒá?)Á¸HÓàH DÔ‹D$;„$L| ƒÀ‰„$L‹4” …À„Æè‡ÃÿÿA‰Ç…ÀAW?IÐÁøÁèÁúA HcÒƒá?)Á¸HÓàH DÔD;¼$LŒÖûÿÿAG‰„$LéÆûÿÿHÄX[]A\A]A^A_ÃfDèíÿÿƒø †Ð½é@þÿÿ„óœ“ ¿?•ZÀòèRTè“âÿÿD‹ |“ E…É„þÿÿ‹D$D‹D$‹T$ƒÀ?E…ÀID$ÁúÁêÁøHcÈ‹D$Ѓà?)ÐH‹TÌH£Âr`AG?E…ÿAIÇÁøHcÐD‰øÁøÁèAÇAƒç?A)ÇH‹DÔL£øƒ“ýÿÿèßÿÿ½é„ýÿÿH´$LL‰÷è¼ÿÿé+ûÿÿ‰Àÿ$Ÿ?Af„è«Ýÿÿ‹=Å’ ½…ÿuƒéDýÿÿ€‹5Ú™ 1À…ö”À‰Í™ èÈìÿÿ½é&ýÿÿ‹ ˆ÷OºVUUU½ƒÁ‰È÷ê‰ÈÁø)ÂR)щ e÷Oéøüÿÿè[œÿÿ½ééüÿÿ‹ ÷O½ƒè…À‰ûöO‰ÍüÿÿÇëöOé¾üÿÿƒßöO½é­üÿÿƒ=V˜ ½Œ›üÿÿ¸D;˜ ‰9˜ é„üÿÿ‹.˜ ½…ÀˆqüÿÿƒÀ;˜ ‰˜ Ž\üÿÿǘ éMüÿÿ‹ ¯‘ ½…É„:üÿÿ‹ü• 1À…Ò”À‰ï• èºëÿÿéüÿÿÇD$ ½é üÿÿÇD$ é´ýÿÿE1ÿéIùÿÿATUH‰ýSHìdH‹%(H‰„$ˆ1ÀèjLÿÿ…Àˆº1À¹@H‰çóH«A¸H‰áº¾H‰ïèÊLÿÿ…Àˆ LcàHl$ HŒ$IäA¸€H‰çH‰êL‰æè‹Kÿÿ…Àˆ1H˜HŶE¶UÁà Ѓø…HƒÅHŒ$A¸€H‰êL‰æH‰çèHKÿÿ…ÀˆXH˜HŶE¶UÁà Ѓø…å¶M¶E ¶U Áá Á9Ê …Ò„‹õOƒúA¼DNâ»@?•…ÀuhMcäHu H‰ßL‰âè&PÿÿBÆ#H‰ØH‹”$ˆdH3%(…àHÄ[]A\ËÂôO¸ªA…ÒtË¿è/IÿÿH…Àt¼Ç???ë´fA|$HcÿèIÿÿH…ÀH‰Ãuƒ1À뙀¿D@AèöGÿÿ1Àë„¿2@AèèGÿÿ1Àésÿÿÿ¿p@AèÖGÿÿ1Àéaÿÿÿ€H‹ é• º¾¿ @Aè]Pÿÿ1Àé8ÿÿÿfD¾Ð@A¿1ÀèïGÿÿ1Àéÿÿÿ¿W@Aè~Gÿÿ1Àé ÿÿÿè‚MÿÿfS¶<|uTH‰ûDÆHƒÃ¶<|tò< tîH‰ßèÆIÿÿƒèH˜H¶ €ù|u-HDÿƶH‰ÂHƒè€ù|tî€ù téH‰Ø[Ã< H‰ût¥ë½€ù tÎëåfffff.„AUATUH‰ýSHƒìH…ÿ„;‹ TóOH‹” …É…ÍH‰ïèMÿÿÿH‰H‰Å1Ûë>AÆ$L‹-d” H‰ïè,ÿÿÿHcÓI|$ƒÃI‰DÕL‹-E” èÿÿÿH‰ÅHcÃI‰lž|H‰ïèxKÿÿH…ÀI‰Ä„¬ƒûu§H‹ ” ‰ØfDHcЃÀƒøHÇÑuí;” ~‰ ” ‹ ” 9ÃU;û“ | Çó“ H‹HƒÄ[]A\A]ÃD¿€èîFÿÿH…ÀH‰ÃH‰¡“ …ÿÿÿH‰ïèCHÿÿ1Àë €H˜H‹ÁHƒÄ[]A\A]Àƒû„PÿÿÿƒÃéHÿÿÿ1ÀëÙff.„AUI‰õATI‰üUH‰õS1ÛHƒìE¶DH‰ï¹û9AHÇÂÿÿÿÿ¾HƒëHƒÅD‰ÀAƒàÀèA‰Á1ÀAƒáèNMÿÿHƒûøuÀL‰ïè°GÿÿAÆDÿHƒÄ[]A\A]Ãffffff.„ATUSHì@dH‹%(H‰„$81ÀH…ÿ„Áƒ=¢“ „‹H\$0A¸›@A¾1íH‰ß‰Â¶ÈA‰ÁÁê‰L$¶Ì¶Ò‰„$0‰L$‰$AÁé1À¹ºè½Lÿÿƒø~”L¤$°1ÀI‰ÙA¸§@A¹º¾L‰çèŠLÿÿƒø~e‹=ÏðO…ÿ…ÓL‰çèúÿÿH‰ÇèGýÿÿH…ÀH‰Åt?‹5©ðO…öt5H‰ßè-FÿÿH…Àt(H‹5Ñ‘ ºH‰ÇH‰D$ H‰t$(èJMÿÿf.„H‹”$8dH3%(H‰è…µHÄ@[]A\Ãf.„H\$0L¤$°1íH‰Þèþÿÿ1ÀI‰ÙA¸‚@A¹º¾L‰çè·Kÿÿƒø~’‹=üïO…ÿ„-ÿÿÿH‹t$(1ÒH‰ßH‰\$ è°LÿÿH…À„ÿÿÿHc8‘ H‹@H‹,ÐH…í…OÿÿÿH‹(H…í…CÿÿÿéçþÿÿfD1íé1ÿÿÿè+Iÿÿff.„‹ò ‹ Ì 9È|‰ÂÁú÷ùHcÒ‹•Ð…aÃfDH˜‹…Ð…aÃfffff.„SHƒì dH‹%(H‰D$1Àè¦ýÿÿ‹ ˜ ‹5r H‰Ã9ñHcÁ‹…Ð…a…ɺ¿@AH|$A¹d&A‰$A¸`>ALDʹº¾1ÀèJÿÿH…ÛA¹ªALD$LE˺1À¹ ¾ ¿ ?•ècJÿÿH‹T$dH3%(¸ ?•u&HƒÄ [ĉʉÈÁú÷þHcÒ‹•Ð…aécÿÿÿèHÿÿ‹Ò 1À…Òx 1À;À •ÀóÀHƒìD‹­ E…Àx¿€èÆEÿÿ…À‰.îOt HƒÄÀ¿Â@AHƒÄébJÿÿfHƒìD‹ îOE…Étè;IÿÿÇñíOHƒÄÃH‰l$ØL‰d$àH-Óv L%Ìv L‰l$èL‰t$ðL‰|$øH‰\$ÐHƒì8L)åA‰ýI‰öHÁýI‰×è‹?ÿÿH…ít1Û@L‰úL‰öD‰ïAÿÜHƒÃH9ëuêH‹\$H‹l$L‹d$L‹l$ L‹t$(L‹|$0HƒÄ8ÀóÃUH‰åSHƒìH‹8v Hƒøÿt»ˆmaDHƒëÿÐH‹HƒøÿuñHƒÄ[]ÃHƒìèQÿÿHƒÄÃ%.1f%%textwebsitecopyrightversionlicensecommentsauthorshttp://www.bitwizard.nl/mtr/Juha TakalaDavid Sward David Stone Andrew StesinGreg Stark Aaron Scarisbrick,Davin Milun Anand KumriaSimon KirbyChristophe KaltRob Foehl Mircea DamianCougar Brian CaseyCopy to clipboardSet as new destinationactivate: not foundDISPLAYgtk-quitclickedgtk-about_Restart_Pausevalue_changed_Hostname:button_press_eventforegroundHostnamexalignLossSntLastAvgBestWorstStDevblackred%s (%s)My traceroutedelete_eventdestroy48 48 131 2 c #000000. c #020204+ c #3E7E3C@ c #62BA64# c #4E9E4C$ c #628664% c #6EDA6C& c #7A9E7C* c #468E44= c #6ACA6C- c #224224; c #56AE54> c #326234, c #567E54' c #7ABA7C) c #3A723C! c #629E64~ c #428644{ c #6E926C] c #7AEA7C^ c #4A964C/ c #62C264( c #52A654_ c #4A7E4C: c #82AE84< c #366A34[ c #5AB65C} c #4A764C| c #6AD26C1 c #8EC68C2 c #7A9A7C3 c #7AE27C4 c #82A6845 c #568E546 c #5686547 c #3E7A3C8 c #6AC26C9 c #3E6A3C0 c #468244a c #56A254b c #4E8E4Cc c #5EAE5Cd c #86C684e c #427244f c #62A664g c #769A74h c #82F284i c #5A9A5Cj c #5AA65Ck c #428244l c #66BE64m c #6A8E6Cn c #76DA74o c #7E9E7Cp c #2A522Cq c #5E825Cr c #82BE84s c #669E64t c #6E966Cu c #529A54v c #62C664w c #4A824Cx c #366E34y c #72D674z c #427E3CA c #5EBE5CB c #52A254C c #628A64D c #4A924CE c #6ACE6CF c #5AB25CG c #326634H c #568254I c #7ABE7CJ c #3A763CK c #468A44L c #7EEE7CM c #4E9A4CN c #56AA54O c #86B684P c #62B664Q c #162A14R c #529E54S c #72DA74T c #76A274U c #4A8E4CV c #264A24W c #5AAE5CX c #5EA25CY c #468644Z c #729274` c #7EEA7C . c #4E964C.. c #66C264+. c #56A654@. c #4E7E4C#. c #8AB28C$. c #3A6A3C%. c #5EB65C&. c #527A54*. c #6ED26C=. c #92C694-. c #7E9A7C;. c #7AE67C>. c #86AA84,. c #5E865C'. c #6AC66C). c #3E6E3C!. c #5AA25C~. c #4E924C{. c #5EB25C]. c #467244^. c #86F284/. c #5AAA5C(. c #76DE74_. c #829E84:. c #325E34<. c #66A264[. c #729674}. c #66C664|. c #4E824C1. c #3A6E3C2. c #76D6743. c #427E444. c #62BE645. c #668A646. c #6ECE6C7. c #3666348. c #5A825C9. c #7EBE7C0. c #3E763CCopyright © 1997,1998 Matt KimballThis program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details.The 'traceroute' and 'ping' programs in a single network diagnostic tool.Matt Kimball Roger Wolff Bohdan Vlasyuk Evgeniy Tretyak John Thacker Robert Sparks Mike Simons Craig Milo Rogers Antonio Querubin Russell Nelson Josh Martin Alexander V. Lukyanov Charles Levert Bertrand Leconte Olav Kvittem Adam Kramer Philip Kizer Steve Kann Brett Johnson Roland Illig Damian Gryski Travis Cross Andrew Brown Bill Bogstad Marc Bejarano Moritz Barsnick Thomas Klausner G 7.G G G G G 7.G < z . .* k 1.G G G G G G 0.K x 7.7.7.7.7.< J Y D M D ) 7.7.7.7.7.7.< 7.7.7.7.7.G 7.> > > 7.G ) D M K 7 < > > > > > > > > + * < G G G G G G 7.G x k * M K x G G G G G G G G G G G 7.G > > < ~ M D + G > > G > > 7.7.7.7.> 7 D x 7.7.7.7.7.G 7.7.G < ) ~ D M 7 7.7.7.7.7.7.7.7.7.7.G > 7.< * M ~ x > G > G > > 7.> > > > G 7 * 1.G G G G G 7.G G 7.G G G J * M ~ < G G G G G G > G G > x D M k < G > G > > G > > G G G > 7.7 * x 7.7.7.7.G 7.7.G 7.7.7.7.G x ~ # Y < 7.7.7.7.7.G > > x ^ .0.G G G 7.> > > > > G > > > 7.> 7 U 1.G G G G 7.G G 7.G G G G 7.G < k # K < G G G G G G < .^ J G G 7.G 7.> G > > > > 7.7.> 7.7.7 * x 7.7.7.G 7.7.G 7.7.7.7.G 7.G G 7.+ B ~ < 7.7.7.> < D M 7 G > > > G > G > > G > 7.> > G > > + U 1.G G G 7.G G 7.G G G G 7.G 7.7.G < k B + < G G G k # k < 7.7.G > G > > G > > > > G x k .R F A N R U 7 x 7.G 7.7.7.7.G 7.G G 7.G G < K # J $.8.) ( K < > > G G 7.G G > > > G G + M +.B M D B W ^ ^ # ( +.^ ) G G G G 7.G 7.7.G 7.7.7.x u ! & o ^ .x > > > > G 7.7.G > > > 0. .+.M K + ) < + D ) < J k * R +.D x 7.G 7.G G 7.G G G 7.e T =.& H +.+ < G G G 7.G > G G > G ~ ( B ~ ) G > G > 7 U < 7.7.G < J * B B 7 7.G 7.7.G 7.7.9 5.o Z s a ) D x > > > > > G > G G < K ( D 0.> G 7.> G 7.+ * < G 7.7.G G < + # ( + G G 7.G $.,.2 [.$ ).0.( k 7 7.G G G G 7.G G > 7.K +.K x > G > > G > > 7 D < 7.G G 7.7.G 7.) M +.7 7.< &.[.2 C &.7.7.7.* B x 7.> > > > > 7.7.G k +.* < > > > G > 7.G G 7 * < 7.7.G G 7.G G G ) M B &.[.o m &.7.G 7.G 7.) %.7.G 7.7.7.G 7.G G x B ^ ) > G > 7.> 7.> > > + D 7.G G 7.7.G 7.7.7.< w r #.{ , 9 7.7.7.G 7.G < ( > G G > 7.G > 7.7.* ( 7 G > > > > > G 7.1.z B F D 7 < G 7.G G G $.q o : I _ < > G G 7.G 7.G 7.~ 7.7.> G > 7.7.> x +.* 7.> > G > G G < k # # +.[ B N ( k G 7.$.&.2 2 C |.B D < 7.7.7.G 7.G 7.G < > 7.> G > G G > ~ +.+ > > > > > > < K R K + K M 3.K B W K } Z -.m &.< < Y W ) G G 7.G 7.G 7.G 7.> G G > > > 7.G # ^ ) > G > G > 7.~ # + < > 7 * < G J j d 4 { , $.G 7.G 7 F + 7.7.G 7.G 7.G 7.G > > > G G > 7.7.N * 7.> > > > > J D Y > G 7.3.D < ).$ 4 1 ' e 7.7.G G G ) # D < G G 7.G 7.G 7.7.> 7.G > > G > x +.Y G > G > G > Y ~.x G > > 7 ~.8.-.2 5.i A 7 G G 7.7.7.< D # x 7.7.G 7.G 7.G G < < x x < x x + ; * x x x x x ) ^ .1.) 1.) 5 r o t 6 0.K A D J ) ) ) J 7 .F k 7 7 7 7 J 0.0.x D D * * D U U # A ( * * * K * * N W U U * K X 9.<.D K K R ..N U * * * * U ( A D K K K K U * K ) 7 z z 7 7 z 7 K {.M 7 7 7 0.0.7 # B J 7 7 7 U R 0.7 7 7 D / D 0.0.7 0.J 7 .F + 0.J 0.J 0.J 0.< G > > > G > G < N K 7.> > G G > ~ D 1.G > > 3.U G G G G * A J G G G G 7.x D # x G 7.G 7.G 7.G G G G G > G > G < ( * 7.> > > > > J ^ K G G > + D 7.7.7.7 N ( < 7.7.7.G G ) B * < G 7.G 7.G 7.7.G G G > > > 7.G G # .) G > > G > > k u 0 7.G z U G G 7 ( F + < G G G 7.7.7 W + < 7.G 7.G 7.G G 7.> 7.G 7.> > > 7.~ B + > > > G G > x ~ # .+ ~ .7 D ; ; k G 7.7.7.G G G K W x G 7.G 7.G 7.7.G 7.7.G 7.> G 7.7.G < ( D < G > > > > > < z D # %.A +.B .7 < K = G G 7.7.J B D < 7.G 7.G 7.G G 7.x G G G > > > > G G K ( 7 > > > > > G > G 1.+ R N K 7 x G ` (./.7.G G < K ; J G 7.G 7.G 7.7.G 7.Y 7.G G > > G G G G x B M ) > > G G > G G > > + D G G 7.7.;.E 4.G 7.7.7 N K < 7.G 7.G 7.G G 7.< ; 1.> G G > > > ` ] %.+ L 3 (.S S +.> /.L ;.(.S y 7.G 6.3 6.= = y ;...B # ` ] @ *.;.S B 7.G G J A z G > > G 7.7.% = '.n ~.K %.= = = y *.u .4.= = {.7.c /.= = ..u M M B J y = E 6.!.b z G 7.< D W M ) G > > G G y = ..7.. . +.@ '.= @ V . . 1.}.= {.. G 7.6.= B . . . . 7.y = ..> . . . . G ) [ D [ + G G G > 7.S = a . . . . 4.E = z . . . G y = @ . . G (.6.a . . . . G y = .. . . . . < ^ W J N B ) G G G 7.y = .. . . 7.}.6.'.0.. . . G (.= %.. . ~ y = B . . . 7.G *.'.0 . . . G 7.7 [ K < + [ D < > > G % = R . . > > }.6.}.0.. . +.+.3 = {.. . B (.E W . . G G 7.y = K . . G 7.x +.( J G < D {.Y 7.> 7.y = u . . > > ..6.'.0.. . K U (.= %.. . + y = +.. . 7.G 7.y }.Y . . G < ^ F z 7.7.> x B ; + G > y = ( . . G > }.6.}.0.. . > G (.= {.. . G (.= {.. . G 7.G y = k . . < * [ U < G G > G J +.N + G S '.R . . > G }.6.}.0.. . G G (.= [ . . G *.= }.J . G 7.G *.= ~ . . ~ %.^ x 7.7.7.G > G 7 +.N z y E B . . G > ..6.'.0.. . > > 3 = {.. . 7.'.= = = (.3 p 7.y '.0 . . {.# ) 7.G G G G > G G 7 ( ; @ N ~.. . > > 4.W +.1.. . G 7.= /.B . . G > {.l 4.%.R G 7.@ /.+ . . M ) G 7.7.7.7.> 7.> > G 0.# %.^ . . . > > > > > . . > > > + D . . . 7.7.7.- - Q . . G < . . . . ) G 7.G G G G G G 7.> 7.7.) ^ F . . < G > > > G . . 7.G > 3.D 7.. G G G 7.7.. . . . x D F . . < 7.G 7.7.7.7.7.> 7.G G > G G < ~ ( [ B + < > G > > > > > 7.+ U G 7.7.7.7.G G 7.G x K W [ R + < G G 7.G G G G G > > > G > > > > 7.J D +.[ ; K x G 7.G 7.> 7.) z G G G G 7.7.< 0. .F F B ~ 1.G 7.7.G 7.7.7.7.7.7.G 7.7.> > G 7.G > 7.< M E | +.7 > > > > G > x ) 7.> 7.7.G G < k F % / ~ G G 7.G G 7.G G G G G G øA AHAxA˜Aø@ ø@*ø@Gø@Uø@ÀAèArø@A@AhA…ø@AÀAðA A¡ø@PAxA A®ø@ºø@ÈAøA AHAÊø@çø@õø@pAù@˜AÀAèAA@A{®Gáz„?ð?$@R¸…ë?@à?@@Change Packet Size: %d %cPing Bit Pattern: %d Type of Service(tos): %d Interval : %0.0f First TTL: %d Max TTL: %d Fields: %s %s Command: ?|h help n toggle DNS on/off r reset all counters y switching IP info press any key to go back...%2d. ???.123abc>??? My traceroute [v0.85]Keys: Help Display mode Restart statistics rder of fields quit %%%ds Host Last %3d pingsScale: %c:%d msSize Range: %d-%d, < 0:random. Pattern Range: 0(0x00)-255(0xff), <0 random. default 0x00, min cost 0x02, rel 0x04,, thr 0x08, low del 0x10... p pause (SPACE to resume) d switching display mode e toggle MPLS information on/off o str set the columns to display, default str='LRS N BAWV' j toggle latency(LS NABWV)/jitter(DR AGJMXI) stats c report cycle n, default n=infinite i set the ping interval to n seconds, default n=1 f set the initial time-to-live(ttl), default n=1 m set the max time-to-live, default n= # of hops s set the packet size to n or random(n<0) b set ping bit pattern to c(0..255) or random(c<0) Q set ping packet's TOS to t u switch between ICMP ECHO and UDP datagrams z toggle ASN info on/off [MPLS: Lbl %lu Exp %u S %u TTL %u] Packets Pings{®Gáz”?š™™™™™©?{®Gáz´?333333Ã?…ëQ¸Õ?à?š™™™™™é?ð?€?%s: memory allocation failure vhrwxtglCpo:B:i:c:s:Q:ena:f:m:uTP:Zby:z46mtr: wait time must be positive non-root users cannot request an interval < 1.0 seconds -u and -T are mutually exclusive. Warning: extra arguments ignored: %smtr: unable to get raw sockets. mtr: Unable to drop permissions. mtr: Couldn't determine raw socket type. usage: %s [-hvrwctglspniuT46] [--help] [--version] [--report] [--report-wide] [--report-cycles=COUNT] [--curses] [--gtk] [--csv|-C] [--raw] [--split] [--mpls] [--no-dns] [--show-ips] [--address interface] [--filename=FILE|-F] [--ipinfo=item_no|-y item_no] [--aslookup|-z] [--psize=bytes/-s bytes] [--report-wide|-w] [-u|-T] [--port=PORT] [--timeout=SECONDS] [--interval=SECONDS] HOSTNAME mtr: Unable to start net module. mtr: Couldn't set interface address. %s: fopen: %s %s: ferror: %s Too many fields: %s Unknown field identifier: %c Illegal port number. mtr MTR_OPTIONSmtr 0.85localhostFailed to resolve hostFailed to resolve host: %s mtr unknown address type mtr.c%s: fcntl: %s (ignored) : Space between fieldsL: Loss RatioLoss% %4.1f%%D: Dropped PacketsDrop %4dR: Received PacketsRcv %5dS: Sent PacketsN: Newest RTT(ms) %5.1fB: Min/Best RTT(ms)A: Average RTT(ms)W: Max/Worst RTT(ms)WrstV: Standard DeviationG: Geometric MeanGmeanJ: Current JitterJttr %4.1fM: Jitter Mean/Avg.JavgX: Worst JitterJmaxI: Interarrival JitterJinthelpreportreport-widexmlcursesgtkrawcsvsplitorderintervalreport-cyclespsizebitpatterntosmplsno-dnsshow-ipsfirst-ttlfilenamemax-ttludptcptimeoutinetinet6ipinfoaslookup€@°|@€€@°|@°|@°|@°|@°|@°|@°|@°|@°|@°|@°|@P€@8€@°|@°|@ €@°|@°|@°|@°|@°|@°|@°|@°|@°|@Ð@ @°|@°|@€@°|@°|@°|@°|@°|@X@°|@°|@°|@°|@°|@°|@@@0@@°|@è~@ ~@~@x~@~@°|@°|@ð}@ }@ˆ}@}@}@°|@ê|@0@ @@ð€@à|@Ø€@°€@ €@lockunlockCouldn't get fd's flagsCouldn't set fd's flagssetsockopt(IP_HDRINCL,1)Could not open IPv6 socket net_open bad address type socket()bind()getsockname()ioctl FIONBIOsetsockopt IP_TTLsetsockopt IP_TOSunknown AF?setsockopt IPV6_UNICAST_HOPSsetsockopt IPV6_CHECKSUMnet_reopen bad address type Gmtr: bad interface address: %s mtr: failed to bind to interfacesockaddrtop unknown address type $tIY@€„.AffÆÿÿÿßAào@p@malloc() of %u bytes failed: %s ERROR: Attempt to free pointer twice. ERROR: Corrupted free() buffer. (header) Unable to allocate IPv4 socket for nameserver communication: %s Unable to allocate IPv6 socket for nameserver communication: %s Unable to setsockopt() on IPv4 nameserver communication socket: %s Unable to setsockopt() on IPv6 nameserver communication socket: %s Resolver error: Query too large.Resolver: Lookup successful: %s Resolver error: Packet smaller than standard header size.Resolver error: Packet has empty body.Resolver error: Nameserver packet truncated.Resolver error: Query packet received on nameserver communication socket.Resolver error: Invalid opcode in response packet.Resolver: Received nameserver reply. (qd:%u an:%u ns:%u ar:%u)Resolver error: Reply does not contain one query.Resolver error: Reply too short.Resolver error: dn_expand() failed while expanding query domain.Resolver: Unknown query packet dropped. ("%s" does not match "%s")Resolver: Queried domain name: "%s"Resolver error: Query resource record truncated.Resolver error: Received unsupported query class: %u (%s)Resolver warning: Ignoring response with unexpected query type "PTR".Resolver error: Received unimplemented query type: %u (%s)Resolver error: Packet does not contain all specified resouce records.Resolver error: dn_expand() failed while expanding answer domain.Resolver: answered domain query: "%s"Resolver error: Resource record truncated.Resolver error: Answered class does not match queried class.Resolver error: Zero size rdata.Resolver error: Specified rdata length exceeds packet size.Resolver error: Unsupported rdata format for "A" type. (%u bytes)Resolver: Reverse authentication failed: %s != Resolver: Reverse authentication complete: %s == "%s".Resolver error: dn_expand() failed while expanding domain in rdata.Resolver: Answered domain: "%s"Resolver error: Domain name too long.Resolver error: Received unimplemented data type: %u (%s)Resolver: Ignoring resource type %u. (%s)Resolver error: No error returned but no answers given.Resolver: Received error response %u. (%s)Resolver error: Received reply from unknown source: %sResolver: Sent reverse authentication request for "%s".Resolver: Sent domain lookup request for "%s".Resolver: Cache record for "%s" (%s) has expired. (state: %u) Marked for expire at: %g, time: %g.Resolver: Send #2 for "PTR" query...Resolver: Send #3 for "PTR" query...Resolver: "PTR" query timed out.Resolver: Used cached record: %s == "%s". Resolver: Used failed record: %s == ??? Resolver: Added to new record. MD: mail destination (OBSOLETE)MB: mailbox domain name (EXPERIMENTAL)MG: mail group member (EXPERIMENTAL)MR: mail rename domain name (EXPERIMENTAL)WKS: well known service descriptionMINFO: mailbox or mail list informationqueried domain name does not existrequested query type not implemented%lid%luh%lum%lusNo nameservers defined. 127.0.0.1::1statmalloc() failed: %s Resolver: Lookup failed. %x.%x.%u.%u.%u.%u.in-addr.arpaquery class: %u (%s)rr class: %u (%s)Resolver: TTL: %sstatmalloc() error: %s Resolver: Host not found.Resolver: Socket error: %sUnknownQueryAnswerAuthority referenceResource referenceunknown classIN: the InternetCS: CSNET (OBSOLETE)CH: CHAOSHS: Hesoid [Dyer 87]unknown typeA: host addressNS: authoritative name serverMF: mail forwarder (OBSOLETE)CNAME: name aliasSOA: authority recordNULL: NULL RR (EXPERIMENTAL)PTR: domain name pointerHINFO: host informationMX: mail exchangeTXT: text stringno errorformat error in queryserver failurerefused by name serverunknown errorstandard queryinverse queryserver status requestunknownÏ@Ï@àÏ@Ï@Ð@@@@d %d %s p %d %d h %d %s -%d %s %s%s %d %d %d %d %d %d˜×@¨×@È×@Ø×@m×@è×@ø×@ˆ×@HØ@XØ@xØ@ˆØ@Ø@˜Ø@¨Ø@8Ø@Start: %s HOST: %%-%ds %%2d. %%s%%-%ds %%2d.|-- %%-%ds %s%s OKMTR.%s;%lu;%s;%s;%d;%s;%s;%dMTR.%s;%lu;%s;%s;%d;%s;%d, %.2f, %d [MPLS: Lbl %lu Exp %u S %u TTL %u] Select failedîë@Èë@@í@í@í@-î@î@ðì@ëí@´í@‹í@zí@Oí@@res_init failed @dn_expand failed@Broken DNS reply.@second dn_expand failed@Not a TXT record%s.origin6.asn.cymru.com%d.%d.%d.%d%s.origin.asn.cymru.comASipinfo hash@Broken TXT record (txtlen = %d, size = %d) ;ܺõþÿøPÿÿp °ÿÿ Ðÿÿ8` ÿÿ`ð ÿÿˆ  ÿÿ¨° ÿÿÀ ÿÿè` ÿÿ   ÿÿ8Ð ÿÿPð ÿÿhÿÿˆ ÿÿØ0ÿÿðÿÿ`Ðÿÿ ðÿÿ¸ÿÿÐ@ÿÿèÿÿ àÿÿ( ÿÿ@  ÿÿh €ÿÿˆ ÿÿ   ÿÿ¸ ÿÿÐ  ÿÿø ÿÿ Pÿÿ8 àÿÿh Ð*ÿÿ ð/ÿÿà 1ÿÿ P1ÿÿ( @2ÿÿX Ð3ÿÿ¨ 8ÿÿè °8ÿÿ Ð8ÿÿ ð8ÿÿ0 €9ÿÿX :ÿÿˆ 0;ÿÿ¸ ;ÿÿÐ `Aÿÿ8 BÿÿÀ PBÿÿè pBÿÿÀBÿÿDÿÿH Dÿÿ`@Dÿÿx`Dÿÿ€Dÿÿ¨ÐDÿÿÀðDÿÿØEÿÿð0EÿÿPEÿÿ pEÿÿ8EÿÿPðEÿÿpFÿÿˆ0Fÿÿ PFÿÿ¸pFÿÿЀFÿÿè FÿÿÀFÿÿàFÿÿ0GÿÿHGÿÿ`0Gÿÿx Hÿÿ  Hÿÿ¸ÀIÿÿذJÿÿø0Kÿÿ@Kÿÿ0`KÿÿHÀKÿÿpðKÿÿ€Lÿÿ¨°LÿÿÈàLÿÿàMÿÿÀMÿÿ `NÿÿhNÿÿ€0Pÿÿ¨ VÿÿøÀYÿÿ8_ÿÿ€ `ÿÿè€aÿÿ0cÿÿ(ÐgÿÿPhÿÿhðiÿÿ°pjÿÿØÐjÿÿøPkÿÿ mÿÿ@PmÿÿX€mÿÿp°mÿÿˆÀmÿÿ àmÿÿ¸ðmÿÿÐnÿÿènÿÿ nÿÿ@pÿÿPPqÿÿx`qÿÿ°qÿÿ¨ðqÿÿÀ°rÿÿØsÿÿð0tÿÿ0ÀtÿÿHÐuÿÿˆ0vÿÿ¨àvÿÿÀÀwÿÿØxÿÿðPxÿÿÀxÿÿ( yÿÿh@zÿÿ˜pzÿÿ°à{ÿÿø |ÿÿ|ÿÿ8ð|ÿÿPp}ÿÿˆ€‰ÿÿÈ ‹ÿÿ Œÿÿ@°ÿÿpÀÿÿÈ@ÿÿøà‘ÿÿ ’ÿÿ80’ÿÿPÐ’ÿÿx“ÿÿ˜°•ÿÿèà•ÿÿð•ÿÿ0–ÿÿ8`–ÿÿP—ÿÿ˜À—ÿÿà˜ÿÿø@˜ÿÿ`˜ÿÿ(€˜ÿÿ@ИÿÿXð˜ÿÿpà™ÿÿ˜ šÿÿ¸PšÿÿÐÀšÿÿРÿÿXà ÿÿpð ÿÿˆ¡ÿÿ p£ÿÿð€£ÿÿ°¥ÿÿXP­ÿÿ¨¯ÿÿà°ÿÿ p±ÿÿP ð±ÿÿˆ ð³ÿÿÀ 0´ÿÿØ µÿÿ!0µÿÿ!pµÿÿ8! µÿÿP!0¶ÿÿx!zRx $ïþÿÀ FJ w€?;*3$"DˆÿÿDN$\ÿÿ‰AƒVpk AA $„øÿÿ‰AƒVpk AA ¬`ÿÿ§G ŸÌðÿÿDK$äèÿÿÑM†[pŽŒƒj F 4  ÿÿÐA†AƒG0R CAA kCAD8ÿÿ;Dv\`ÿÿ"D]txÿÿDTŒ€ÿÿAƒPL¬€ÿÿBBŽB B(ŒA0†I8ƒD@Û8G0A(B BBB4ü@ ÿÿBŒ\†H ƒDPÖ GABL4ÿÿµBGŽB B(ŒA0†D8ƒI€  8A0A(B BBBG <„ˆÿÿÔBBŒA †A(ƒDP§ (A ABBI Ä(ÿÿDSÜ0ÿÿDSô8ÿÿ-Dh PÿÿEAƒC,€ÿÿGDs I L°ÿÿDP$d¸ÿÿ“M†ƒX@ŽŒiŒ0ÿÿØAƒD0ÑA¬ðÿÿÄèÿÿÜàÿÿrDi$ôHÿÿxA†AƒGPlAA ÿÿTAƒR<àÿÿMAƒK,\ÿÿA†DƒD W FAI $Œpÿÿá O†ƒN`Œ B L´8 ÿÿBBŽB B(ŒA0†A8ƒGðü 8A0A(B BBBA ,%ÿÿ A†AƒD AA4è%ÿÿF,L &ÿÿçBŒA†A ƒ| ABE L|à&ÿÿBEŽE B(ŒA0†A8ƒD@@ 8A0A(B BBBB <Ì (ÿÿ½BBŒA †A(ƒG° S (A ABBJ   ,ÿÿDS$¨,ÿÿDP<°,ÿÿDI$T¸,ÿÿ‡M†ƒL ŒH A ,| -ÿÿBŒA†A ƒ‚ ABA ,¬€-ÿÿA†AƒM°  AAG Üp.ÿÿ]dô¸.ÿÿÁBBŽB B(ŒG0†C8ƒG@Ä 8A0A(B BBBA S 8A0A(B BBBK 4\ 4ÿÿ BŒA†A ƒG ‰  AABA L”ØóþÿuBBŽB B(ŒA0†A8ƒGÐ3 8C0A(B BBBH $ä84ÿÿKAƒk D A O A `4ÿÿ$h4ÿÿB,< 4ÿÿ4A†C IŽMŒDƒ A l°5ÿÿ„¸5ÿÿœÀ5ÿÿ´È5ÿÿÌÐ5ÿÿPä6ÿÿü6ÿÿ 6ÿÿ, 6ÿÿD (6ÿÿ\ 06ÿÿt 86ÿÿZGG A ” x6ÿÿ¬ €6ÿÿÄ ˆ6ÿÿÜ 6ÿÿô ˜6ÿÿ  6ÿÿ$ ˜6ÿÿ<  6ÿÿT ¨6ÿÿl °6ÿÿ„ ¨6ÿÿ$œ °6ÿÿìAƒX À CD Ä x7ÿÿvÜ à7ÿÿNƒøü à8ÿÿãFƒ~ D š °9ÿÿuD] O D< :ÿÿT :ÿÿ$l :ÿÿUA†CƒI EAA” H:ÿÿ,Aƒj´ X:ÿÿˆÌ Ð:ÿÿ)Aƒgì à:ÿÿ0$ ø:ÿÿ¡N †ƒA A j F \, €;ÿÿ*DD ˜;ÿÿœBBŽB B(ŒD0†A8ƒDP}8D0A(B BBBŒ ð;ÿÿ%$¤ <ÿÿŸAƒJ° AB LÌ €=ÿÿhBEŽB B(ŒA0†A8ƒDG 8A0A(B BBBF <  Cÿÿ BIŒD †A(ƒGЋ (A ABBH D\ €Fÿÿ1BŽBB ŒD(†A0ƒGÀ# 0A(A BBBG d¤ xKÿÿ BBŽB B(ŒA0†A8ƒDPý 8A0A(B BBBK Y 8F0A(B BBBA  °LÿÿÔAƒ§ E b,pMÿÿªrŽŒ†ƒ$LOÿÿ’b &ŽŒ†ƒè F txSÿÿ?DŒ SÿÿàBŽGB ŒD(†A0ƒL¶ 0A(A BBBA $Ô8UÿÿuAƒN°dAüUÿÿSHƒY A ÐUÿÿuDe G D A $<0VÿÿÃKZ0Œ†ƒÏ D dØWÿÿ)|ðWÿÿ+”Xÿÿ-¬ Xÿÿ ÄXÿÿÜ XÿÿôXÿÿ Xÿÿ$Xÿÿ4<XÿÿA†AƒD0N AAJ > AAA $tèYÿÿDV F J F œÐZÿÿ ´ÈZÿÿOÌ[ÿÿ<ä([ÿÿ¿üÐ[ÿÿV<\ÿÿBŽEE ŒA(†A0ƒÀ (A BJBC Tø\ÿÿ<lp]ÿÿBBŒD †E(ƒG0° (A ABBF ¬@^ÿÿ^Aƒu J Ì€^ÿÿ¦ä_ÿÿÖüà_ÿÿI`ÿÿ2Aƒc L A48`ÿÿm<L`ÿÿÒBEŒD †A(ƒD0´ (D ABBA ,Œ0aÿÿBŒA†D ƒŽ ABA ¼ aÿÿ%D\DÔ¸aÿÿdBŽOB ŒA(†A0ƒQàÏ 0A(A BBBC àbÿÿ1DJ B \<cÿÿhFƒl F f\PcÿÿQ4t˜cÿÿzBEŒE †D(ƒH0[(A ABB<¬àcÿÿ M†ƒ] ŽŒ J ‡ A … K 6 E 4ì°oÿÿžBŒ[†F ƒ§ AJK ±AB<$qÿÿzBŒ[†F ƒ¡ AJI y ABL ,dXrÿÿ AƒG R AE d FF T”8sÿÿ BŽBB ŒD(†A0ƒD`  0D(A BBBI Ô0A(A BBB,ìðtÿÿuBŒD†A ƒfAB$@uÿÿMŒƒI0†P J D¸vÿÿ0Dk\Ðvÿÿ$tØvÿÿ›L†ƒI ŒI J œPwÿÿ.AƒaL¼`wÿÿ¥BBŽB B(ŒA0†A8ƒG ) 8A0A(B BBBD  Àyÿÿ&$Øyÿÿ<Ðyÿÿ9Hƒp\ðyÿÿ&DaDtzÿÿ¡DM G T L D L U K D L D L D L DD¼pzÿÿ¡DM G T L D L U K D L D L D L DØzÿÿ5{ÿÿ54({ÿÿL0{ÿÿd8{ÿÿB|p{ÿÿ$”x{ÿÿèM†ƒI0Œ[ G ¼@|ÿÿ4AƒF hDÜ`|ÿÿ!DX4ôx|ÿÿdBEŒA †A(ƒD0P(A ABBL,°|ÿÿBBŽB B(ŒA0†A8ƒG€ Ø 8A0A(B BBBA |p‚ÿÿ”h‚ÿÿ¬`‚ÿÿLÄX‚ÿÿcBQŽB B(ŒA0†A8ƒD ø 8A0A(B BBBA x„ÿÿL,p„ÿÿ"BBŽB B(ŒA0†A8ƒGàÀ 8A0A(B BBBE L|P†ÿÿ’BDŽB B(ŒD0†C8ƒG 8A0A(B BBBG 4Ì ÿÿ>BŒA†D ƒG°R  AABD ¨ÿÿrAƒZ A L$ÿÿUBBŒA †D(ƒD0ß (A ABBF z (A ABBH 4t‘ÿÿqBEŒD †D(ƒF0U(A ABB4¬`‘ÿÿõBŒA†A ƒGà6  AABK ä(“ÿÿ2$üP“ÿÿÝAƒD0± AI $”ÿÿ<”ÿÿ>Dd H I\0”ÿÿ$D_$tH”ÿÿ‰QŒ†_@ƒŽXœ°”ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿZmŒó¯Vm©è p6@ x÷@õþÿo˜@è@ø@  èoaˆè$@@$@¨ þÿÿo#@ÿÿÿoðÿÿoü!@°ma¦6@¶6@Æ6@Ö6@æ6@ö6@7@7@&7@67@F7@V7@f7@v7@†7@–7@¦7@¶7@Æ7@Ö7@æ7@ö7@8@8@&8@68@F8@V8@f8@v8@†8@–8@¦8@¶8@Æ8@Ö8@æ8@ö8@9@9@&9@69@F9@V9@f9@v9@†9@–9@¦9@¶9@Æ9@Ö9@æ9@ö9@:@:@&:@6:@F:@V:@f:@v:@†:@–:@¦:@¶:@Æ:@Ö:@æ:@ö:@;@;@&;@6;@F;@V;@f;@v;@†;@–;@¦;@¶;@Æ;@Ö;@æ;@ö;@<@<@&<@6<@F<@V<@f<@v<@†<@–<@¦<@¶<@Æ<@Ö<@æ<@ö<@=@=@&=@6=@F=@V=@f=@v=@†=@–=@¦=@¶=@Æ=@Ö=@æ=@ö=@>@>@&>@6>@F>@V>@f>@v>@†>@–>@¦>@¶>@Æ>@Ö>@æ>@ö>@?@?@&?@6?@F?@V?@f?@v?@†?@–?@¦?@¶?@Æ?@Ö?@æ?@ö?@@@@@&@@6@@F@@V@@f@@v@@†@@–@@¦@@¶@@Æ@@Ö@@æ@@ö@@A@A@&A@6A@FA@VA@fA@vA@†A@–A@¦A@¶A@ÆA@ÖA@æA@öA@B@B@&B@6B@FB@+ú@7ú@Dú@Qú@^ú@kú@xú@…ú@’ú@Ÿú@¬ú@¹ú@Æú@Óú@àú@íú@úú@û@û@!û@.û@;û@Hû@Uû@bû@oû@|û@‰û@–û@£û@°û@½û@Êû@×û@äû@ñû@þû@ ü@ü@%ü@2ü@?ü@Lü@Yü@fü@sü@€ü@ü@šü@§ü@´ü@Áü@Îü@Ûü@èü@õü@ý@ý@ý@)ý@6ý@Cý@Pý@]ý@jý@wý@„ý@‘ý@žý@«ý@¸ý@Åý@Òý@ßý@ìý@ùý@þ@þ@ þ@-þ@:þ@Gþ@Tþ@aþ@nþ@{þ@ˆþ@•þ@¢þ@¯þ@¼þ@Éþ@Öþ@ãþ@ðþ@ýþ@ ÿ@ÿ@$ÿ@1ÿ@>ÿ@Kÿ@Xÿ@eÿ@rÿ@ÿ@Œÿ@™ÿ@¦ÿ@³ÿ@Àÿ@Íÿ@Úÿ@çÿ@ôÿ@AAA(A5ABAOA\AiAvAƒAAAªA·AÄAÑAhAÐA8A A Ap AØ A@ A¨ A Ax Aà AH A° A A€ Aè APA¸A AˆAðAXAÀA(AAøA`AÈA0A˜AAhAÐA8A AApAØA@A¨AAxAàAHA°AA€A ð&A¨A¨AÐ…@L 'A'A'A€…@D('A;'A@'AÐ…@RE'AY'A]'A€‡@Sb'AØù@]'A ‡@Nr'AÜù@„'Að…@B‹'Aåù@„'A†@AŸ'Aáù@„'AP†@W²'AÇ'A„'A0†@VÌ'Aðù@„'A†@Gâ'Aô'A„'Ap†@Jú'A (A(Að†@M(A,(A(A0‡@X1(AA(A(A‡@IF(A](A(AP‡@LS NABWV€–˜P@€? Â÷@vb(Ahg(Arn(Awz(Ax~(At…(Ag‰(Al(AC‘(Ap—(Ao(Ai¦(Ac´(Asº(ABÅ(AQÉ(AeÎ(AnÕ(AbE;AaÞ(Afè(AFñ(Amù(Auý(ATi(AP)AZ )A4)A6)Ay)Azàé€êàé€êàé€ê 耀@:’@:’@:’ï¾­Þ¡:A©:A¯:A¶:AÊ:AÝ:Aë:Aü:A;A;AÝ:A0;A=;AM;AP8Ak;A‰;A›;Ap8A˜8AÀ8A±;Að8AÎ;Aç;A9Aÿ;A z¯uref±Å# Ÿ²Å#get³+#Çs€ Æ0Áá ØÃW# D Åm# Æ# ‹ÉŸ# ôÌá# ô!Í1#(7ˆó3uCT"%¯þ%á ׿oqQþQf<qmþ]qþá¯sŸþ“Ä=< (» ; 7òstr9#len:># k;>#ì+ý ëpl4 of# [ pŠ # !r# ‰sË# ØtË# u#( äv‡#0 µx>#8 ­y #@ ¥z #H _{ #P W|– #XX €‡#\[‡#\–‚‡ #\å&ƒ‡ #\s„‡ #\<…‡ #\ L‡¯#` ‹!ˆ¯#h!,? !@޼ ÆÖ # Q• # bš% # Kž@ # Ä [ # Z¢m #( z£ #0 x¦£ #8HÝ uwf:M¼ P –Ÿ:Tè W; ¿&h' Ä$óR Ó ^ a ó½·À/"’çQjF 4 ° P¦ 8òÝ Ð ¦ >Ð w>¬ Ý ¦ ×>Ð wÜ Ý % ¦ ( w Ý @ ¦ w+ þ[ ¦ ; F m ¦ a Ý ¦  ws  £ ¦ “ NU V?(. ){ûý!Û{ݱ$=Î,®"€½#/‚‡ƒ£„J … †¶‡ˆÄ‰œ Š—‹W#Œª¹Žâƒ>™…z ˜l£ ûob # î0|x #½ˆ¯ ¼™Ì ûœb #" ŠØ ! £õ [¦õ #£ n  n rx Ösf£t‡vu[Õv|¡w(Zx3Ôy’úz¤. {¯ ˆ 8Ó ‚%Ào%f ½ —À=€³ €€€€x(!LÞ '! ”¿—Q#×"˜Q#™Q#þ#šQ #V ›Q#*œQ#Ý Q#ŸQ#Z¡Q#¢Q# Ü"¤&# î0ª¯# $¬V#î$MÊ í$†ó î0ˆ¯# 2;‰þ#}Xo…a  ¯ Ó ,Q û ‡ ¯¯‡¿w—}Š'V_!äê ´ÀÆ €’¬—#V'Ï'•—Ü ¸Â Û òù äôÌ # ÷Q# ñ&øU #9ºÂˆâʼÀä% -ã%5B>4"³& U²&J—El –È­xÊf#yËf# Ìf# Íf# 5P¸¾4ufÏ t .  0#red1# Œ$2# ´3#˜ g — 8Dr * G·# “Jf# Kˆ# %NŽ#( P¯#0„ i} ƒ 1´ ý 3# ð 4f# V 5f#“ j¿ ’ 0!½  * !¿·#  !Áf# ¾ !Âf# õ!Ãf# !Äf#$ !Æ`#(8"l+7"‘m< P"M * "O·# ý"Q¹# e"Rf# Ì""Sã# D"Tf#$ "Uf#( Ò"W#, ="Xf#0 {"Yf#4 q""[#8 @!"\f#< )"]f#@ \ "_#D ¤"`f#H ™"af#L Ù!#56 * #7·#qa&ràtWß0$.Î * $0·#Ã$2‡# )$4'# r$5'#  $6'#  Ç$8=#  Ò $9I#¨wã?˜zÎ}ß#þ*Ñ‹ VÀS€€¤ €G €»"€j€ 0€€€ ‰€€€Àက€€(€€€€Æÿ¿€àä™îÄ1A %-¥ Ÿ%UÎ Æ%W‡# ù %X}#Ý%.Ù Ü%[use%]1#min%^¤#max%_¤#&%/ %H%b¦ * %d·# â%g# M %hÇ# ô%ií#$ £%jq#( a%lf#, e%m<#0 a%of#8 e%pB#@%;Çyùë%@¦%CíÞ ™Ôq'%GÒ%J1ñ2=´l‹¾O%SøÎš("&4S'"P&9ý&;#=&<”#K&=ñ#&>#x&?¤#y&@¤# e&A#(“&B‡#0 &C‡#4Œ&D#8Z&E¤#@ç&E¤#H&tý"çkÃM]` ›žÆ a Î œ' Ð þ¯"ƒÔ&Õ $* w&ðbë5R¸ j I!ù"c#æ$%&&œ ¤L 77 8´ '¬Nr6C ,¤&.Œ" /l"8¹ '%cŒ  #r B""?Œ(2à_"®R(†¤ÍÉ6c (Í¥í (Ý4<=q(à )· ! )qñ )s‡# Í)t}#·)u‡#Ê%)?ü É% )»3key)½¬# -)¾ # ÷)¿"#@ñ*1J  +ks * +mù# F5+t# ,0~ P,3í * ,5?# T1,7¤# æ/,8¤#( ¼?,9¤#0 D,:¤#8 P",;¤#@ Ž,<¤#Hsµ-6þ´Ø-I * -K·#fg-O©#bg-P©#T ù-Q©# ‚$-R©#Ìmid-S©#ˆ &-T©#Ä &-U©#€ 5-V©#¼ ¯-XÄ#ø ‡-YÄ#„ -ZD# -\f#˜ Œ -]f#œ M-_¹#  P'-`¹#È -a¹#ð _-b¹#˜ u-c¹#À %-d¹#è ß-e¹# ¤-f¹#¸ y%-g7#à Ý-h7#è ±-jÉ#ð #-nf#˜ e-pf#œ -q`#  ²-rT#¨ ˆ-sD#° B -vÙ#¸ F-x=#À 9-y #È È-z=#Ð'-9~'€.<ú * .>·# â.B# .C# .DD#H f .F'#Pfg.G©#dbg.H©#  &.I©#Ü &.J©#˜ .Lf#Ô Œ .Mf#Ø .P #à Ò.S=#è È.U=#ðí#.W‡#øÒ-EÑ`/©ÿ /?#G /!# “/&ü#"/.ü##â/6#(E /?ß#0›$/C7#8Œ#/G"#@=/M”#P/Qå#X Ĺ 8 7É 8 ZÙ 8óú.5 næØ.:ë ' 8 7 8-/ÞC,/o / f#/ f#™/ã{˜ÿ /å þ ð06"bin08¸"# Í$0:#x |0;#€ D%0<#ˆ (0=# 0?å#˜ S0@å#  r 0A1##¨ '0B7##° *0C”#¸ †0D=##À ±%0F#ȉ0G‡#Èg0H‡#ÈO0I‡ #ÈV0P‡ #Ȧ0Q‡ #È  0R‡#Èý0S‡#ÈË 0T‡#È 0U‡#È0W‡#È0X‡#È&0Z‡#̨0]‡#Ì?0^‡#Ì80_‡#ÌÇ0`‡#̘"0b‡#Ì9 0e‡#Ì0g‡#Ì÷&0h‡#Ì '0j‡#Ð 0k‡#Ô {0l‡#Ø t0m‡#Ü œ%0o‡#à ï 0q}#ä Ð0r!#è/òaH! 13:" p16¸" T18ú# '1:å#`»1<‡#h 1?‡#h&1@‡ #h\1A‡ #h±1B‡ #hM20Ã" Lx23ì" Ó25/"# W$27å#pµ 02÷"´ "$03# !$ 0š1# * 0œ·# ·0ž=#ì"ý"ð30N# ïp33¡# T35ú# ñ37’#` š38’#d 3:#h ¯(3;#j›40¬# š˜43Ž$ Ó45/"# ’$47Å#p ¯!48å#x «49å#€ 4;‡#ˆ 4<#Œ÷,4>‡#T4?‡#]$4@‡#Ì!4A‡#¡4B‡#·4C‡#ë4D‡#251™$1(5¡## E5@å#˜ «!5Aå#  €5C3#¨ 45D#° ñ 5Eq&#¸ B 5F¯#À ÿ5H‡#È “%5Må#Ð •5Oå#Ø 5På#à ’&5Qå#è Â5Rí#ð  5T”#ø ¯5U”#€ Ñ#5Wf#ˆ Ë#5Xf#Œ ¦5Yf# U 5Z‡#” /'5_#˜ ï5`‡# ý5b‡#¤ö5c‡#¤Ô5g‡#¤À!5i‡#¤¹5k‡#¤l5l‡#¤ê5m‡#¤5n‡#¤Z54|&‚&¢&¢&QQ¨&¯Ž$qš61¹& ™¸66( ”68C## Ý%6;#p!6<‡#x]6=‡#xm6>‡#x™6?‡#xc 6@‡#xÜ6A‡#x26B‡#x'6C‡#x!6D‡#x¢"6E‡#xi6F‡#x ½6H‡#| &6J#€ t6K%(#ˆ j6L%(# 6N[#˜ K6På#  46Q1##¨ ÷ 6S+(#°ú%64(ù%3(à71<( ߀74„( Ó76/"# ’$79Å#p £!7:#x«7;‡#xá80( à83x)bin85¸"# §#87”#x ‡&89#€ <#8;‡#ˆ- 8=‡#Œ8>‡#Œ 8?‡#Œ„ 8@‡#Œm8A‡#Œx8B‡#Œå 8C‡#Œ›8D‡#ŒR%8E‡#Œi9%ƒ)hx)C&:7š) B&8::€* :’# š:?’#$ :Af#( :Bf#, :D#0 ¯(:E#2ô:G‡#4Ý :H‡#4í :I‡#4¤ :J‡#4:K‡#40:L‡#4‹ :M‡#4);+‘*  ;9Ö* Ý3;;f# a%;<¯# ®;=¯# ¹;>¯#È&;,á*Ç&T&;.ò*S&ç*Ö*†*e<0++f:+ø*++¯=.U+<ãÿ=2:+À=4k+ ¿¸=>- =@?# L=Bå# =Cå#( W$=Då#0 =Eå#8 b=Få#@ ==G”#H ‰=H‰)#P ñ=I’#X ë=J‡#\ £!=Kf#` Æ =OU+#d ÿ=Pf#h ¥=Qf#l h=Rf#p =Sf#t “=Tf#x %=Uf#| ©=Vf#€ ú=Yf#„ =Zf#ˆ Í$=\# 5=]Å#˜ ==`‡#  ë =a‡#¤ +=bf#¨ b=c4#¬Ý =f‡#°á=g‡#°Š =h‡#°3&=i‡#°¯ =j‡#°•=k‡#°&=l‡#°d=m‡#°Í=n‡#°`+J>0®- I˜>3ÿ- >5„(#÷,>7‡#©>8‡# >9‡#oå?/.ä± @*!. ° @-<. * @/·#.DA*M. CxA-!/ A/·# Ý3A2f#seqA3¯# GA4¯#( jA5Å#0 nA6f#8 +A7f#< Ñ"A84#@ ŒA9!/#H ôA:f#P øA; +#X ÞA<¯#` A=º#h+&A>‡#pb B?2/ ÐBBÞ1 TBDú# &BF#`+BH‡#hÝ BI‡#hà BJ‡#hBK‡#h tBN#j µ BO#l HBR”#p ABS<.#x ÜBTå#€ ñ"BVf#ˆ sBWf#Œ  BY[#“B[‡#˜(B\‡#˜&B]‡#˜¾B^‡#˜‡B_‡#˜'B`‡#˜ Ba‡#˜ZBb‡#˜ÝBc‡#˜~Bd‡#˜ªBe‡#˜gBf‡#˜vBg‡#˜ Bi‡#œ çBj‡#  ÆBk‡#¤ Ñ#Blf#¨ ð Bmf#¬ VBnf#° Bp#´ ­Bq#¶ A'Bs#¸ ¤ Bt#º œ Bvf#¼ „Bxf#À ‘Byf#Ä ýB{¥#È 0B}f#Ì@C7é1 ?xC=2 C?/"# ˜CA#2#p2$C921$2UD442 TD7ç2 ÓD9¸"# D<å#x HD=å#€’ D@‡#ˆiDA‡#ˆÒ DB‡#ˆ&DC‡#ˆ{DD‡#ˆM#DE‡#ˆ E$DG#ŠE6ü2"h$­'E9ç2ª EG3© EK*4 ‚EM'/# ÊEOí#Ð ÞEQ”#Ø ãES#à 0 EU¤#è REV¤#ð U EXü2#øä EZ‡#üQ$E[‡#ü E\‡#üÞE]‡#ü E^‡#üúE_‡ #üE`‡ #ü]Ea‡ #üÜ Eb‡ #üL!F854 »-GÆP4 Ç'GÏq4#0H1?ôH2F´#H4MGÈ›4x!GÊ›4ºGÌ«4k&GÍ»4 P4«4 8 [4»4 8 f4Ë4 8 S Ie5 àIgˆ#  Ih# íIib# òIjb# † Ik#§$Mb[5Ì U Ö^Ý4 Žk5 8ÿ&·5à ÛcÁ 9&T ”•Ì l 4¤q6!æ ¤å!P¤)""ܦå"y§å"¨å":©þ*#  b>6$__s ˆ%A  Ò&'æ!Òf6%Òå%î0Ò¯(¿-Ô6)*posÝbË4#9 >b»6$__s>ˆ$__n>-%A >Ò&+³Jq°I@ÃI@7,J¦ L,åJ; o,î0J¯’-åIÐI@YJ@µÒ7,I-?,ÍJ€*b,·Kø*«,s!L+á,î0M¯.fO’‘œ/&PÒ7‘ 06J@R116 ¤÷@Ÿ1&6‘ Ÿ Pâ7 8?--<`J@éJ@M¢8,<-×,Í=€*ú,·>ø*C,s!?+y,î0@¯¯.fB’‘œ/&CÒ7‘ 06—J@0E116 i?AŸ1&6‘ Ÿ2#|fðJ@—K@åõ83¿|å23î0|¯U4 ~õ8‘ } 9 8)2×\f K@°K@xI93`\åÄ3î0\¯ç5·5°K@M@ ê96Ê5l6Ö5¢7â57î57ú5768·5L@M@¤6Ö5þ9L@M@:â54:î5j:ú5 :6Ö;Ê55>6M@`N@z:6P6ü6[6E:f6h<>6ðM@WN@Ò6P6ž9ðM@WN@7f6;[69ðM@WN@=r6‘\>–:`N@›N@Áª:?dtA C N@ÂN@C ÿ:3DCÝ 3¯Cÿ:² 4?Eb L†a2{ ObÐN@ìN@Õ I;3DOÝ! 3¯Oÿ:D 2 æZðN@ O@g ~;3 æ³ >¯îO@R@ü Ü;3¸îå9 @¿ðåo @ñå @òíM -m V R@/W@ƒ <AX€*HA#Y-ˆ-| Á0W@åY@ÛÆ<BrowÁb-,s!Á+vA¿-ÃÆ<¿.strÄ[5‘°}AâĈ8…6ŽY@ÐY@Ê6®6Ö6£66˜6(*4-[âðY@ÄZ@t/=Cmaxäbv/s!æ†*‘°Crowçb¿AS?èqg+™ XqÐZ@èZ@Æ=,X¦ ,åX; 2,î0X¯U+: QqðZ@[@xÝ=,Q¦ Ä,åQ; ç,î0Q¯ +Û?f[@=[@->,î0?¯y2c Çf@[@…[@œX>DAdjÇíè3¿Çå 2ðmf[@×[@A±>3¿må¡3î0m¯×4îob P†a2|"dfà[@õ[@ õ>3¿dåY3î0d¯|-^û\@“]@ŸX?,`ûåìAžýå"A¸þåkAÝ)ÿå¡-r  ]@x^@׸?AUfK/Db‘l/ª¸?‘P/¯‘` ˆÈ? 8Eá4€^@‚^@wFø9b^@“^@w-K a ^@_@nI@Ac¦ ºA‡c¦ Ý+Í— _@˜_@Ÿ@,:—þ*°/s!™†*‘°/âš‘X+&‚q _@ô_@æ(A,T‚å2,î0‚¯UAé-„xA:…þ*U9±_@í_@A‰ÿ-®+Ksq`@M`@äA,Tså0,î0s¯SAé-uvA:vþ*SG( J¥¦Gæ$J¦¦G|F?bGK~*4 ˆÓA 8³4QLÃA vaG6,2ˆG…3Haf4bItag5b H†a4¹6å `†a47å h†a48å X†a/-##å x†a/Ô$ŽB p†aB.G( J¥¦Gæ$J¦¦G|F?bJK~*4 äG6,2ˆG…3Haf4b¥÷8Ÿ(ÈP`@ây@O D.Ô8s#Ó$intSXúñx#ót M#{­Ž{?,•{XFHA,L˜n#XÚ 80 1_ô 2?´# 4f  !À - ­+ ( g( µ, k, ì+ $+ #* ^+ B( )(! ý*) ¥,+ ¤), Å*. %,/ k)2 š,3 ˆ): »(; -< ð'Ü Y(â (ç +)ì —)„ È+ˆ F+ÿ °*€  Èê x! Êê º Ìú k& Í Úú 8å  8ð 8»- Æ5Ç' ÏÀ#´( 8cØ  E5 F#§ ¥#ä" ¥# ¥#¥ ¥# k% ¥#(L ¥#0º ¥#8š ¥#@× ¥#HÎ ¥#P€ ¥#X8 "K#`º $Q#h &F#pÜ *F#tk ,‚#x 0?#€1! 1m#‚ˆ 2W#ƒ© 6g#ˆo ?#ü H£#˜ I£#   J£#¨ K£#° L-#¸ó NF#À€ Pm#Ä ´« ºKÆ- »K#Q ¼Q#ø" ÀF#@Xg 8 X} 8Ý U‰)` †,e) ˆt#_) ˆt#X+ ‹t#R+ ‹t#e, Œt#_, Œt# E5 Žt# s ‘,#ø+ ’5#½+ • # “, – #!Ò* — #"Ü) ˜ ##é' ™ #$š+ š #%R( › #&) œ #'¨(  #(Ú, žF#,á,  ­#0#) £t#8I* ¤t#:„* §F#<Š* ¨F#@ ©³#H¡+ ±8#P, ³t#\ç( W5M( ¬ ( ®t#z( ®t#¼* ¯t#Â, ¯t#6( °t#Ø+ °t# :+>*§}ë _L! 8 & ) Ñ( ( Ì, Ý' + , * õ) î( È( ½) * ü(0m‡keyn‡#@+oM#Í$pM#s+qM#ôrF# J)s—#(_F—Œ*`îÝ%‚î#expƒþ#@ttl„þ#Hs…Ê#PX,†X#X8þ 8¹ 8§$bK Ì U  Ö ^ Ý  4µ)¿Fi__c¿F5+F‰Û*M0+©©Û*MD1gFÐA gMÕ)g¥úŸ*g¥t(gM  F% __s ¥A  Mj+VP`@Ñ`@¬o strV¥\ !S+XF"cxYF¸ #T*cFà`@Ák@!§ "ceFz!"ifFU%"fg§ 7'$bufh® ‘°%` & +pFº''K3a@p(] (%À6 & +tF½)'Ka@t(]à))´a@Ía@| & +‡F[+*K´a@Ía@‡(]·+)èa@óa@¾ & +²Fö,*Kèa@óa@²+],‰+c@@¼ß (œž-,i e@pÎ (|ê-,if@°¬! (|6.,iEf@ðÞB (|‚.,iZi@0žc (|».,iši@p‘„ (|/-?j@\k@.þ,!FS/ÖX¾ 8/‰+CÐk@íp@‹/ 0ó*CFÝ01maxEF11atFFM1.o5G Ÿ1.7G û1.¿-H W2.$8H 21yIFë2.âJ¥31iLF31jLFÚ31kLF&4.ˆ(MFª42bufN ‘°w3ú m@°uÞ + ( ô44ú¯m@x+ ( &5ÄX 58ÿ/i*²ðp@ýq@X5¤ .C*´«ô51i´F61max´F71at´F976í*µFˆ†a”„†a”Ÿ7þ+Ór@Fr@wã 8msÓF\71iÕF’7//*áPr@7s@¶7C8atáFf80ç+áF‰8.C*ã«¿81iäFâ8/ä)ý@s@Ðt@9Ó0ó*ýFW:0ç+ýF :1maxÿFé:1atÿF2;1yÿF¡;.¿- Ä;.⥠</8)%Ðt@y@V</.S+'FX=.ó*(F¡=.P,)FÄ=2t*¸‘Øv9i,F1j,Fü=.ˆ(-F>2buf. ‘àv2fmt//‘°3úw@@[¦( j>( –>3úBw@€\Ñ( ¼>( â>:À2msgi?‘à~.Ø7jF?.ã+oFr?4údx@ðr( ¨?( Ô?X? 8XO 8O;(‰y@¬y@6@;ÿ)“°y@Éy@‚@;‰,šÐy@ây@Î@<( ¥Q<æ$¦Q=) N³<Ü( =F<| ?F<ó,{:X]>[# y-?u#S0@ü#Ì-Aï# Ä-B#(Ñvg1cØàE5[#§ ï#ä"ï#ï#¥ï# k%ï#(Lï#0ºï#8šï#@×ï#HÎï#P€ ï#X8 "#`º$$#h&[#pÜ*[#tk,«#x08#€1!1M#‚ˆ2*#ƒ©6:#ˆo?¶#üH×#˜I×#  J×#¨K×#°L#¸óN[#À€P@#Ä ´«ºÆ-»#Q¼$#ø"À[#ç õ: Fà õP FVõ[ 1½ ã/€ Q1€ ¢0€ à1€ ž/€ ó0€À 6.€€ [-€€ Ñ0 ì/ / â0O2 §.©T#¨1ªT#1¬«#ò1­«#Ì1²Á#©/.ï{00i#þ15Š#A0= #±1>•#T.@t#S/A# 0C[#$‹.Ei#(l/J«#0d-NÙ#8o-Pä#@Ú0[#H²-\#X2-]#hJ0jï#x bÿ FL!8Z|/ iO âkP#.n[#!o[#valp[# ˆ 1 “1 ú- ~. Á1 a/ ;/ '2 §$bÅ Ì U  Ö ^ Ý  4uÊü(0m2 keyn2 #@+oP#Í$pP#s+qP#ôr[# J)sB #(1[B 7 Ë0vq âwï#Ç-xq #H t/yH C1`[­ )-`­ A `PÁ0‰â 0‰P·E‰Pâ‹â w ¨/Õ[ 0Õ[2Õ ø1õïO __sõï__nõ[)-õ­ 5+[o Û*P0+  Û*PÕ)gïÀ Ÿ*gït(gPD1g[à A gPæ-Y[ ¹/Yï“.Y'.`3 Ÿ*`×m1` ³ ðy@wz@AÔ !À zA!Ë ÃA"Ö B#³ Rz@wz@‰$À V%Rz@wz@&Ö 'Ë #‚ Rz@mz@$  ˆ"AŸ'• (™/}ï€z@{@ƒB! )s}ï3C*pïC*l€[ëC+Ô/–{@,|@¡Dˆ,0–PSE,K.–PœE*in˜­ åE-â,™ˆ‘Ð{.7{@@{@Ü /›/-.›.F%7{@@{@/U2›™fF/é1›[¯F.`{@s{@/â§ïüF0 s{@ƒ{@¦8!C G!8 UG!- ‘G1‚ æ{@0¡^!  ÝG'• 2‚ ñ{@`¬$  &AŸ'• õ™3Fÿ2 4z1î0|@|@wÍ*ið[ H591ý|@Q‚@TH ,Dý[GJ,¯ý£J*optÿ[ÿJ6i[IK7F/  Àa8– l}@ˆ}@”n!´ mK!© K9O  }@ }Œ'b 8o ~@~@f®'‚ 8O  ~@µ~@qÐ'b 9O @ÐVî'b 8O X@k@¼'b 8O  @³@œ2'b 8O Ð@ã@µT'b 8O P€@c€@—v'b 8O °€@À@̘'b 8O 0@I@Zº'b 8‚ Â@Ø@å!  ¼K'• :‚ â@ý@‹!  èK'•  F;/0ä`‚@ƒ@L¥fd¼[>buf½ª¾½?[.ª õ F¡1×j0×Pf×­ >fdØ[>bufÙªÚ½?[.z¡1 õz Fj@U:û[PB@ÅH@÷M”U!'tUA€";ÒUBE‘À}BP  ‡aB[ e+A1è &G@ÐåM! V!û ÒU2‚ ÑG@ç!  jV'• :À H@1H@9!Ó –V# ïª FC( ¥$Cæ$¦$Cs1§$CÙ1:ïCZ/H[CÜ(=[Ddns>[C|?[Cw*+[ Ñ / FC÷(v [L FÿCw)z< 1i F'Có,{YCw,|@C:-[Cg0>[C‚0@[CÇ/A[C«0B[CÞ-C[CÙ-D[C…EëÖC6,FïC1Gï õ FC1,H Cç,L[Câ*M[DtosN[C 0O[DafP[CH,Q[C¦+T[CÎ)V[C&/X[CE#Y[-Ë0zâ ø†aC( ¥$Cæ$¦$Cs1§$CÙ1:ïCZ/H[EÜ(K[ ІaFdnsI[  aE|J[ Ô†aEw*?[  äE÷(b  {aEw)^< ÀäEó,]Y `aEw,_@ ÀèE~ÿ äC:-[Eg0>[ ¤äE‚0@[ ¬aEÇ/A[ ð†aE«0B[ ì†aEÞ-C[ ¨aEÙ-D[ è†aE…Eë ¤aE6,Fï à†aE1Gï ؆aE1,H  àèEç,L[ œaEâ*M[ ̆aFtosN[ ȆaE 0O[ ĆaFafP[ À†aEH,Q[ ˜aE¦+T[ ”aEÎ)V[ aE&/X[ ŒaEE#Y[ ˆa¢(u 8®5ȃ@e«@Áø58ñÓ$x#s#ót intM#i­Ži?,•iž6—i‰2´i¯úì.ÀFú5"-‹2nžD.ÔM‹4K 22M†#"5N‘#5 7i € C-ã3 K-# = MU8 Nn#H ¯f Mî. #¶ ª. (· ¸. —0 ©- . o. . Z1 ,1€€ !0€µ0 ?€2 ²ëD- ´·#ë0 µë# ¯û M à7€ ¿2ò2 Á·#>4 ÂM#Ó7 Ã2# ¯B Mo 8R M0 18ô 2?´# 4Fù7 8M !C - ­+ ( g( µ, k, ì+ $+ #* ^+ B( )(! ý*) ¥,+ ¤), Å*. %,/ k)2 š,3 ˆ): »(; -< ð'Ü Y(â (ç +)ì —)„ È+ˆ F+ÿ °*€E2 a]1/ h- ŽtÒ1 N# Èžx! Êžº Ì®k& ; R® M ]¾ M hÎ M»- ÆéÇ' Ït#Ä. á.„- ã·#Ð. äC#- åY#ø. èB#N- ï[0 ñ·#â. òC#2 óh#º- ôÎ#œ. õh#‡¯g1—cØdE5b#§ ©#ä"©#©#¥©# k%©#(L©#0º©#8š©#@ש#HΩ#P€ ©#X8 "¢#`º$¨#h&b#pÜ*b#tk,p#x0?#€1!1T#‚ˆ2®#ƒ©6¾#ˆo?{#üHœ#˜Iœ#  Jœ#¨Kœ#°L×#¸óNb#À€PÄ#Ä ´«º¢Æ-»¢#Q¼¨#ø"Àb#k— ¯¾ Md ¯Ô MbàÖë 8& ?ê,FL!8ΩS etàg©# h#íib#òjb#† k#Â*`ËÝ%‚Ë#expƒÛ#@ttl„Û#Hs…V#PX,†¯#X MÛ M ïë M §$b( Ì U  Ö ^ Ý  4é. 82†ý3ï#BA4ï#E65ú#id6ú#a87ú#4;ËZ2<ú#Þ8=ú#ô>ú#E6?ú#R5C Z2Dú#Þ8Eú#seqF#p8 JU N6K#T6L#ü.Mï#<2Nï# lenOú# 9Sí “7Tï#tosUï#lenVú#idWú#³7Xú#ttlYï#<2Zï# D [ú# N6\# T6]#ñ7Xn3 ¿-o#$8p3 #½5qb#È8rb#”Í5sb#˜uptb#œvaruO# 3vb#¨8wb#¬.8xb#°avgyb#´Å2zb#¸Ž6{b#¼Ô3}b#Àû8~b#Ä—2b#È9€b#ÌC*C #Ð4‚b#ðo5ƒz#ø7„S #Ø C M bS MÇ zc Ma8(ˆ¶ {)‰b#9Šb#è2‹b#Œâ#§8b# n4JÜ fdJbq2MbŒ7Mœ Ÿ*MœÈ5Mbm1M×E6ábN î0áœszábchãN sumäF?C1`b )-` A ` Œ+38œº Ÿ*8œt(8Úm18×I4v©ï Ÿ*v©t(vm1v×!8•b- a•©b•©af•b"rc–b†81œb Ÿ*1œt(1Úm11×#æ8§‘ a§©b§©af§b#è5pÏ atpbseqpbmspb"idxrb#6¶anum¶b$8¶©$o5¶a$p¶b"i¸bË2¹Fƒ4¹F5¹F/5¹Fª2ºÁÑ8ºÁz¾6A̽0Ab¹/Aœ__nA×D5AbÙ6Bt48B½f%¶ ƒ@Kƒ@ÂVó&Ä ^W'Ï ºW(/4ØbPƒ@iƒ@w')t5ØáX* pƒ@²ƒ@wh&# &X&. IX'8 …X'B ÐX+A6ôbÀƒ@ô„@Yo)Ÿ4ôœŽY)-7ôœ×Y)g ôb Z)L5ôbVZ,í,öFyZ-‚œZ,8÷oÉZ,\5ú‡[,à6û‡^[.•8”[.5Ê[/ ‹„@` &. \&# <\0'8 |\'B ò\ ¯‚1MØM †2$7eÆ…@…@wÆ3atebU2 8kÆ …@>…@w4atkb<]4ikb_]2k5pœ@…@Q…@wB3atpbU27uœ`…@~…@wƒ4atub‚]3iubT2î8zb€…@Ð…@w¸4atzb¥]2;5ƒbÐ…@í…@wí4atƒbÈ]2ü2‰bð…@†@w"4at‰bë]2}8b†@!†@wW4atb^2*8•b0†@A†@wŒ4at•b1^2*6›bP†@a†@wÁ4at›bT^2Á2¡bp†@†@wö4at¡bw^5T7§b†@ê†@š^,4at§bú^2Š6±bð†@‡@wa4at±b_2÷8·b‡@!‡@w–4at·b@_2Ð3½b0‡@A‡@wË4at½bc_2“2ÃbP‡@a‡@w4atÃb†_6 6Þbp‡@z‡@w2Ä8äb€‡@‘‡@wV4atäb©_2e4êb ‡@±‡@w‹4atêbÌ_2ú6ðbÀ‡@ч@wÀ4atðbï_2k7öbà‡@ñ‡@wõ4atöb`6¶4ü©ˆ@ˆ@w79ˆ@.ˆ@wG8atb5`5Ç6[b0ˆ@‰@Y`}9ò6]b‘l68ƒb ‰@–‰@w:“4ó ‰@²Š@á`Ú8atõb-a"iöb53bÀŠ@£‹@QaH;1©Åa8lenbbÉ7B°‹@%Œ@rb6³6Qb0Œ@7Œ@w2£7WÔ@Œ@QŒ@wº3atWbU:}3]`Œ@µŒ@æbì8at_b‚c:´5hÀŒ@ìŒ@¹c4athbd7\8 ðŒ@x@w`;{) b;d4seq b^d5¬3b€@©@d½;{)bÍd9–5b ôƒa8seqbðd*‘ °@à@wü&  Ae&« de?· Q' ‡e:r7{à@Ž@ªeo;N6{tFf;?8{©¤f4len{×g8sa4|(‚g8sa6~.¥g*ï Ž@ºŽ@wô& Ýg& h& Ih@! <ï  Ž@°Ž@•& h& ¢hA Ž@°Ž@B! = 5{4ÉbÀŽ@\@Åh:8atËbj8maxÌb&j*b `@…@wl?q U?{ T?… Q5Ç3¢b@/‘@]jÔ;9¢Ôçj9Ü5¥û‘à~9â©t‘à~Ÿ8lenªf0k!:¸750‘@˜—@jkÑ4seq5b¼lCo55z‘;¿-5œm3now5â‘.{)7b(m.B38b€m.¬69b¶m.à2:bäm"i;b9÷3=Ñ‘ /‘ ,”@Àž&· n=« &  Hn0' ‚n ¯á M:^7* —@Àš@¸n;{)*bºoDttl,b‘´}8s,bpDopt-b‘¸}.ç..b_p9Ó2/û‘À}930û‘À~9d51(‘À}Ÿ9Ù22.‘À}Ÿ9J33(‘À~Ÿ9R34.‘À~Ÿ8len5f»pE`ï8__v†?q8__x†?{qA™@Š™@8__vO? q"__xO?:33—Àš@ñŸ@Ãq™;{)—bír98Ÿ™‘Ð\8ip ª‚s.l2¡°÷s8udp¢jt.*5£‡*u.j8¤ú±u8rv§bÔu9Ó6¨b øƒa8ttl©b v.›7©bDv.•6©bÊv.Â5©bcw.p¯béwFÜ :›@µT& #x=ú &ï FxEÀxD__vÈ?P"__xÈ?F Q@ð»&. »x&# äx0@ '8 y'B eyGÄ@È@í8__vø?œy"__xø?Gè@ì@#8__vû?Óy8__xû?öyGž@ž@Y8__vÿ?-z8__xÿ?Pz/ už@ ì&. tz&# ¿z0Ð '8 âz'B @{ ¯ªHMuU 4526 b @ ¡@w{û.¤5 bj}8i bµ}:}5Õ ¡@t¢@ë}=;¿-ÕÔ_~8at×b¨~*Ï €¢@*¤@w- ?Þ U&ê Ì~&ö &%B'r'$¤'0æB<BHBT<Ï ô¢@¤@¶&*€&ö w€&ê š€&Þ ½€Aô¢@¤@'à€BB$B0'<*'Hb'T‹:Z6¦0¤@¨@Ç"98¨™‘àZ97ªû‘à}99«.‘à}Ÿ92¯t‘à}Ÿ9 9°(‘à}Ÿ.í4±f)‚8num²bx‚. 4³°Fƒ.j3´3„.4µ" …Dnow¶â‘ÀZ. 3·Æù….¹3¸bª†.37¸bD‡.3¸bPˆ.a8¹býˆ9o5¼z‘à~Ig¡¤@À¤@Óµ!&±ª‰&¦æ‰&›"Š&ZŠ&…–Š&zÒŠGx¥@¥@ë!8__v[?ýŠ8__x[? ‹A4¦@<¦@8__v6?D‹8__x6?g‹Ë7Ä4ÝШ@©@w€"C8Ý€"UC4ÝÔT8atßb‹‹8fdßb¯‹=:D7ë©@ðª@ç‹%#;8ë€"8atíbZ8fdíb·8ríbŽDnowîâ‘Ð~.5ïs7Ž.%3ïsmŽ9o5òz‘à~:Z3ðª@e«@½Ž“#98=‘Ð~94b‘lDtvâ‘P0 Ò5b×5bJ( ¥¨Jæ$¦¨Js1§¨J~Kë6šb Dß í ì# MÿK9œÜ# @‡‰ c $HMÿÿKa8$ @‡aK0žâ PßJÙ4¡bJb2¢bJ|6£bJQ4¤bJã4¥bJm6¦bJ!4§bJ[4¨bJÐ4©bJt3ªbJ®8­ûJ6®ûJP8¯.JF8°.Jz2¶tJ§4·tJK8¸(Jþ4¹(J~7»ÆJˆ5¼Æ ¯P% M-Jº4À@%K¸2Èb HßKî3Éb ðƒaJ¦+ËbJÎ)ÌbJç,ÍbKè,Îb @ßJâ*ÏbLtosÐbLafÑbJH,ÒbJ&/ÓbJE#ÔbJ( ¥¨Jæ$¦¨Js1§¨M~ äMÙ3 b ¼éMÙ4¡b ÀéMb2¢b léM|6£b ëMQ4¤b °éMã4¥b `éMm6¦b ¸éM!4§b déM[4¨b `êMÐ4©b ´éMt3ªb héM®8­û €êM6®û àéMP8¯. èƒaMF8°. àƒaMz2¶t ؃aM§4·t ЃaMK8¸( ȃaMþ4¹( ÀƒaM~7»Æ hêMˆ5¼Æ ëMº4À@% €éJ¦+ËbJÎ)ÌbJç,ÍbJâ*ÏbLtosÐbLafÑbJH,ÒbJ&/ÓbJE#ÔbŠ1·8[<Èp«@(Ó@9!ø58ñVA JÓ$ã;!\x#œA"ns#ót intM#Š­ŽŠ‰2´Šºúì.À\ú5"-XA#?å;$QžA%c‹2n©D.Ônº>ÊJû@Ë\57Š€CFã3KF# $V nU8N/n#Hî. #Á ª. (À ¸. —0 ©- . o. . Z1 ,1€€ !0€µ0 J €2 ²ôD- ´À#ë0 µô# º n à7€ ¿;ò2 ÁÀ#>4 Ân#Ó7 Ã;# ºK no0 18ô 2J´# 4\E2 aV1/ a - ŽÒ1 w# ÈÇx! ÊǺ Ì×k& Íç K× n Vç n a÷ n »- ÆÇ' Ï# Ä. áW„- ãÀ#Ð. äl#- å‚#ø. èW# 8g n N- ïº[0 ñÀ#â. òl#2 óa#º- ô÷#œ. õa# §$ b÷ Ì U  Ö ^ Ý  4ýÌ ºn ¡< ±D H< !? ¾; -; A „9 —? ¾± 5= D9 ¢? L: ä> †@ í@ Ú? 3A Ö; Ý= `> €; %9 D; ¼A8 8Ènÿ ~A ü : û< s? Ì> Ô> ; B Ä> Ü> û> B: Q9 Š= < 9 ? = Ø@ J@ çA \B à@ n< ê= @ ;9 ç? Ð? —: ³= Ó: ðA x9 o9! Ñ<" u;# ,>$ ;>% ¶:& 2:' B( x:) <* Bù ?ú e9û ‚Bü `@ý U@þ Ÿ;ÿ V;€ `;€€ô: AY L? «A fB Z: vA ÒAþ ùAÿ ³A€€´ S e²àg´# hY#íiƒ#òjƒ#† kY#Ëg1ÃcØE5ƒ#§ ´#ä"´#´#¥´# k%´#(L´#0º´#8š´#@×´#Hδ#P€ ´#X8 "Î#`º$Ô#h&ƒ#pÜ*ƒ#tk,‘#x0J#€1!1u#‚ˆ2Ú#ƒ©6ê#ˆo?œ#üH§#˜I§#  J§#¨K§#°L#¸óNƒ#À€Pð#Ä ´ «ºÎÆ-»Î#Q¼Ô#ø"Àƒ#—à ºê n º n ºG2 Û< :B = {? ©=$@H V=JH N 2 w w ˆ Ž ” ƒŽ } ‚ ÷ƒÌë;Q¥ « 2 Ô Ô ÷ƒ” ƒŽ Ú y ¿-z‚#Ö{#8†o EB‡#Aˆo #@‰ #A@Š#³>‹#É<Œ #¡:‘¥ #0  n ƒ n Ÿ Ÿ ng \µ n8„Ô pad…Ô ­<“ ºä n3²<8h! ¹9iƒ#ç<jƒ#ƒ1kí#EBlƒ#i;n! #idp×#Di>r1 #H>sA #€@Atí#€P;u\#ˆÂ@v\#ˆa<w\#ˆL0x\#ˆj|Q #Œ_=~= #àô;š #èB=€ƒ#ðË:ƒ#ôE5‚â#ø_u”µ #€ 1 n ´A n ºQ nÿ ß a n è@38 <4J <5nL!8÷ ;hfN Ç-gN #-?hN #%>iN #";jN #4>kN # 9;lN #(š@mN #0¾:nN #8ÜAoT #@é-p´#Hipq‚ #Pidrl #`“sa #b Ö ÁÅ idÂl #¨;Ãa #³;Êa #‚=Ðl #L>Ñl #EBÒl #S<Ól # ç:Ô[ ù÷ £@ Y? ‰> —> ¥>C1`ƒ")-`"A ` ¸ x<a§^!“a"pc§#ï?d  ƒ‰$__s ´A   ÿ:Þƒ¾%sÞ´%dstÞ¾%afÞƒ‚ Œ7M§ùŸ*M§È5Mƒm1M ,<Cw %idCl  ;aw D!9a´#¸?cw &š<ã_%rpãN 9 >ƒ•$__s>´$__n>A > &uBî¼%rpîN %ttlîŠ °DWƒæ%xWæ!ÏDWíæBŽ´Ÿ*Ž´t(Ž Õ)g´GŸ*g´t(g &MBút%sút%lúƒ"rpüN "hpýz"eobþt"cÿt"ttlŠ"rƒ#È=ƒ"rrl #29l #]l #19l #`Al #)=a '"__vJ"__xJ';"__vJ"__xJ'Y"__vJ"__xJ("__vJ"__xJa Å ¾6AøÖ0Aƒ¹/A§$__nAD5AƒÙ6B²48BÖo&í<¶%rp¶N !ý¶ƒ)(p«@ë@2¢*;’+GÛ+Q&,(’«@ë@a-;S.’«@ë@/G/Q0÷ ž«@@ k- @-AŸ1 2ú?}Ы@E¬@uÓ3p}§ý4„?Ÿ´P¬@®@[‘!3dŸ´»‘5o=ŸŠ’6u=¡w `’6Õ=¢w Á’6p>¢w ÷’6¥A¢w -“6=:£Šc“7^H­@p ³’*|Ä“*qð“8^­@À­@±Á*|+”*qW”8^Í­@ð­@¯ð*|’”*q¾”,^ð­@®@«-| 9AŸ-q]9°?ºƒ ®@I®@wb:setºbU:fdºƒTV;²?ÀP®@{®@w¥:setÀbU:fdÀƒT;NAÆ€®@­®@wâ:setÆbU:fdƃT;“=̰®@¼®@w>3setÌbù”.°®@»®@#Ò5΃#×5΃9¬:Ò´À®@Ø®@w‰3ipÒ¾•<ú;Õ‰ àß º™ n-=‰à®@ð®@wÑ*œR•*¦ˆ•*²¾•9ñ9èð®@õ®@w5âè ô•#9ê_>®9óƒ¯@¯@w>k@øƒ¯@¯@w2<ÿ ¯@1±@–¯6|/ƒ—"iƒ8‰ÿ¯@°@)Ï*²O—*¦s—*œŸ—8‰°@'°@+*²Ë—*¦ï—*œ˜8÷ ²°@º°@ 2*G˜1 7÷ º°@  Y*s˜1 8÷ ö°@þ°@„*Ÿ˜1 0÷ þ°@Ð #- ˜.AŸ1 4;5N @±@H²@˘?rp7N S™,÷ %²@@²@;- È9AŸ1 =ùP²@Y²@w7- U9e=Iw `²@¯²@w¨3ipI¾‰™?pK´¿™?iLƒâ™?lenLƒš6¸?Mw ]š=°²@ì²@w×*+ºš+7›;´@mð²@¯³@wF@|BmN U?rpoN b›<:pw T,ùô²@ý²@r- uà;²@Œ°³@´@w¥:rpŒN U<:Žw P,ù°³@¹³@- uà28<š´@!µ@Å› 5|BšN Åœ?rpœN A#:w 0´@ Ÿ*+—A0 +7÷;6<¹0µ@½µ@wŠ3rp¹N Až#:»w 07µ@` ½*+ŠžA +7ýž2Ê@ÈÀµ@Ŷ@ZŸÜ5|BÈN Z ?rpÊN à6:Ëw ¡2È@ëж@.·@b¡3rpëN ¡6:íw ¢;?ù0·@Ö·@w]:rpùN U?irpûN A¢;×9à·@¶¸@wœ:rpN U?irpN d¢;4@6À¸@ ¹@wË:rp6N U2?D¹@B¹@‡¢ý3rpDN û¢9@NN P¹@½¹@wU3idNl W£?rpPN £<:Qƒu ÿŸ4ÉAdN À¹@’º@ð£Ø5é-d´ð¤?rpfN 9¥6:gƒ¥0¹@À i*+Å¥Að +7#¦4“@{N  º@=»@€¦-3ip{¾0§?rp}N y§6:~w ϧ2mB“@»@e»@¨^3s“´d¨2ˆAšp»@Ô¼@‡¨é3s𴱩5ýšƒç©3idšl ª?hpœz@ª?rƒvª?iƒåªBbufž·‘À{)Dà¼@½@C«.*S·«0Dð¼@ ã*Sí«)• ½@ˆ½@¬Ç*¤„¬*¯ͬ0•X½@P î*¤ð¬A€ 1¯,_X½@}½@ô-ˆ /AŸC}@-r ö‘Ÿ=¼½@á½@w*Ï­-ÙU0¼¨½@° W*ÙI­*Ï­2:Ãð½@j¾@¢­µ3ipÃ¾Ž®3bufô±®?pıޮ?bÅ´ç®?iƃX¯0^¾@à É-| û9AŸ*q|¯)Gp¾@sÊ@ǯW%*V¤°*`x±/j/u/€/Œ/–/¢/¬/¸/Ã/Ï/Û/ç/ó0G±¾@ ú*`ú±*Vi²A€ +j*³+ui²+€þ³+Œ†´+–;¶+¢™·+¬Ƹ+¸ ¹+à¹+Ï»+Û¥»+çò»/óDà Ý +,¼+é¼D ù +"q½+.¾DP!+@£¾+LM¿D€1!+ZÕ¿+fÀ8_EÀ@tÀ@Ui!*ˆÁ*}3Á*rYÁ8_ÚÀ@ÿÀ@¡!*ˆ…Á*}±Á*r×Á7_ Â@°-Õ!*ˆÂ*}/Â*rUÂ8_ÂÂ@çÂ@g "*ˆÂ*}­Â*rÓÂ8_Ã@BÃ@uE"*ˆÿÂ*}+Ã*rQÃ8_õÃ@ÿÃ@ê}"*ˆ}Ã*}©Ã*rÏÃ7_ÿÃ@àñ±"*ˆûÃ*}'Ä*rMÄ8_¾Ä@êÄ@‹é"*ˆyÄ*}¥Ä*rËÄ7_ÝÅ@«#*ˆ÷Ä*}#Å*rIÅ7_JÆ@@¸Q#*ˆuÅ*}¡Å*rÇÅ8ó‹Æ@Æ@»€#*óÅ*Æ7^ÅÇ@p?«#*|BÆ*qnÆ8_øÇ@È@\ã#*ˆšÆ*}ÆÆ*rìÆ8_.È@ZÈ@Ñ$*ˆÇ*}DÇ*rjÇ8_¦È@ËÈ@˜S$*ˆ–Ç*}ÂÇ*rèÇ8_òÈ@É@›‹$*ˆÈ*}@È*rfÈ8IÉ@bÉ@Úº$*;’È*0¾È7_–É@°Àî$*ˆêÈ*}É*r<É8_ Ê@0Ê@²&%*ˆhÉ*}”É*rºÉ,÷ PÊ@kÊ@à1 - T:AŸ2A-€Ê@Ì@æÉ`&?r/ƒÒÊ?i/ƒ.Ë<ú;0‰  à7€‚Ê@à2&-Ê „aŸ*¿ŸËE´C©-ž @ëŸ*“ÊË8_ÓË@ÙË@H;&*ˆõË*}!Ì*rGÌ0_ìË@ P1ˆ1}1r2w@  Ì@šÍ@sÌ_'?rƒsÍ?iƒâÍ7€"Ì@Pö&-Ê „aŸ*¿fÎE´C©-ž @ëŸ*“‘Î7_LÍ@('1ˆ1}1r,_Í@•Í@"-ˆ P6AŸC}@-r ö‘Ÿ)Ü Í@©Î@¼ÎK(*ë€Ï*öÜÏ7ÜÀÍ@À¶(*öKÐ*ë—Ð7_üÍ@Ðà'1ˆ1}1r0^yÎ@@Â-| :AŸ-q ö‘Ÿ,_]Î@pÎ@»*ˆàÐ*} Ñ*r2Ñ2Z9d°Î@½Ð@^ÑÍ(5ÏDdíÓ?rpfN \Ó6GAfN æÓ0_]Ð@n*ˆ0Ô*}\Ô*r‚Ô2ï<×ÀÐ@5Ñ@®Ô)3rp×N JÕ5ý׃“Õ4¢9’´@Ñ@ÝÒ@ÜÕ¸)3ip’¾<Ö?rp”N …Ö7_ÄÑ@À¡‡)*ˆôÖ*} ×*rF×0_Ò@ðš*ˆr×*}ž×*rÄ×4>¸´àÒ@Ó@ð×ü)3ip¸¾<Ø?tº´_Ø9˜9ÒÓ@(Ó@wQ*5¿-Ò ‚Ø3afÒƒ¥Ø?lenÓƒÛØF( ¥ÔFæ$¦ÔFs1§ÔGdns>ƒFN=@ƒF~‚ GafOƒF>„1  ´È* nF6?¸* ´å* nFø=¥Õ* w + n€Hx>ò* N !+nÿH/<+Hh=+H ;+HgAN H¼= N Iz=Hñ> ‚ H@‚ HÜ:‚ H’AæH@ƒJmemw H&Bw He:w Hf?w Hƒ< w H A!w HÂ?"w H:#w H <$w Hœ=&w H˜;(ŠH<)ŠHÉ9,HÐ;-Ÿ HÊ;2‚ HÂ63²Hƒ>5ƒHE>7ƒH?9o ºÎ,n@H=;½,H¾<<H':=HT>>HŒ:@ÚH=Hä F( ¥ÔFæ$¦ÔFs1§ÔGdns>ƒKN=Bƒ „aL~‚  äGafOƒ ´Ÿ- nLý9|-  …aL>„1  `…aL6?¸* À„aLø=¥Õ* €„a ´. nLD?®÷- @„aKx>ò* @ëK/<+ àõKh=+ à>’K ;+ à>“KgAN  ØßK¼= N  ÐßKç9 ¾. Èßg+KÁ9 ¾. ÀßKñ> ‚  0ëK@‚  ÀõKÜ:‚  0:’K’Aæ  ëK@ƒ ¸ßMmemw  °ßK&Bw  ¨ßKe:w   ßKf?w  ˜ßKƒ< w  ßK A!w  ˆßKÂ?"w  €ßK:#w  xßK <$w  pßKœ=&w  hßK˜;(Š  „aK<)Š HïKÉ9, @:’KÐ;-Ÿ  „aKÊ;2‚  „aKÂ63² „aKƒ>5ƒ àõ‘KE>7ƒ 6’K?9o „aK=;½, ö‘K¾<<  6’K':= `ïKT>> À:’KŒ:@Ú `ßK=Hä  €óuÓ8 BÈ0Ó@þÓ@ -ñÓ$x#s#ót intM#^­Ž^ƒúƒD.ÔBHn#cØ{ E5W# § }# ä"}# }# ¥}# k%}#( L}#0 º}#8 š}#@ ×}#H Î}#P € }#X 8 "¹#` º$¿#h &W#p Ü*W#t k,e#x 04#€ 1!1I#‚ ˆ2Å#ƒ ©6Õ#ˆ o?p# üH{#˜ I{#  J{#¨ K{#° L•#¸ óNW#À €PÛ#Ä  ´ «º¹ Æ-»¹# Q¼¿# ø"ÀW#‚® ƒÕB{ ƒëB01-ô24´#4;È6x!Ê6ºÌFk&ÍV ëFB öVB fB »-Æ Ç'Ï #L!8f§$ bÉÌ U Ö^Ý4D1gWéA gŠŒB20Ó@ËÓ@ÿØ92W_Ù»B2W¨Ùâ4}ÚÉ`Ó@uÓ@=\Ü:ÚɪÓ@ :Ü €=AŸ¦BBÐÓ@þÓ@fÚé9BW²Ú˜BBéèÚÉÛÓ@ñÓ@DÜ ’=AŸ( ¥¿æ$ ¦¿dns>W W&Bÿ ²B$ `à( ¥¿æ$ ¦¿dns>W! ~ ä 8 CÈÔ@)×@ˆ.ñÓ$x#s#ót intM#^­Ž^ƒúƒD.ÔBHn#cØ{ E5W# § }# ä"}# }# ¥}# k%}#( L}#0 º}#8 š}#@ ×}#H Î}#P € }#X 8 "¹#` º$¿#h &W#p Ü*W#t k,e#x 04#€ 1!1I#‚ ˆ2Å#ƒ ©6Õ#ˆ o?p# üH{#˜ I{#  J{#¨ K{#° L•#¸ óNW#À €PÛ#Ä  ´ «º¹ Æ-»¹# Q¼¿# ø"ÀW#‚® ƒÕB{ ƒëBL!8ö »-Æ Ç'Ï2#0 1-ô 24´# 4;È\x!Ê\ºÌlk&Í| lB |B 'ŒB ã)Ñ((Ì,Ý'+,*õ)î( È( ½) * §$b Ì U Ö^Ý4 ƒ0Bÿ´( BÝ UG)` †ê e) ˆP# _) ˆP# X+ ‹P# R+ ‹P# e, ŒP# _, ŒP# E5 ŽP# s ‘ê# ø+ ’0# ½+ •^# “, –^#! Ò* —^#" Ü) ˜^## é' ™^#$ š+ š^#% R( ›^#& ) œ^#' ¨( ^#( Ú, žW#, á,  k#0 #) £P#8 I* ¤P#: „* §W#< Š* ¨W#@  ©q#H ¡+ ±ö#P , ³P#\ç( W0M( ¬^ ( ®P# z( ®P# ¼* ¯P# Â, ¯P# 6( °P# Ø+ °P# :+>*e;D1gW—A gŠ9 >WÍ__s>}__n>•A >Š  Wø__s }A  ŠÕ)g}"Ÿ*g}t(gŠàBHÔ@¥Ö@ Û|maxJW]ÜatKW¦Ü¿-L|ÝùBM ‘°{iNWrÝw@Ô@PZ¬ŠëÝ €:!strd ‘°}âd}Þ—ïÔ@ÀlÀÂÞµîÞªß"—PÖ@Ö@hÀ:ßµfߪŒß @Z#/u•#-.u•"wÀÕ@ØÕ@{вßë$C†°Ö@ÖÖ@w°iˆWÞß%íB“àÖ@âÖ@w&ÐB›WðÖ@)×@à c¬ƒNà'ÿÖ@×@ +²WQ(( ¥¿(æ$ ¦¿(|?W( ~ë)) Nq*af;W ƒ‚ BÿBÿ(ÊBAl (ÀBBW(( ¥¿(æ$ ¦¿(|?W+ ~ë ä)) Nq*af;W+ÊBAl  ?”+ÀBBW à>”Íã8cCÈ0×@åÙ@Ü0D.Ô8s#ñÓ$x#ót intM#i­Ži?,•i™úcØmE5b#§ “#ä"“#“#¥“# k%“#(L“#0º“#8š“#@ד#HΓ#P€ “#X8 "«#`º$±#h&b#pÜ*b#tk,p#x0F#€1!1T#‚ˆ2·#ƒ©6Ç#ˆo?{#üH‘#˜I‘#  J‘#¨K‘#°L-#¸óNb#À€PÍ#Ä  ´ «º« Æ-»«# Q¼±# ø"Àb#t  ™Ç 8m ™Ý 8bHA,L†n#L!8 »-Æ" Ç'ÏC#01?ô2F´#4MÈmx!ÊmºÌ}k&Í "} 8 - 8 8 8 Ö 1“1ú-~.Á1a/;/'2mCC0×@V×@„àDCÝÐà¯Cóà“|CR`×@Ø@á–CsØ@±Ø@zâpnowsêÞãDC“ÀØ@õØ@w$C¦bÙ@5Ù@wSC¶@Ù@UÙ@wë9¶bsä»B¶b–äCÈ`Ù@uÙ@w*9Èb¹ä˜BÈ*Üäü‰CÚ€Ù@ÂÙ@w6CíÐÙ@åÙ@w( ¥±æ$ ¦±:- bg0$b( ¥±æ$ ¦±:- bg0$bQ8øCÈðÙ@¢æ@Œ2ñÓ$x#s#ót intM#^­Ž^?,•^ŽúA,L{D.ÔBn#HŽÉB cØ– E5W# § ˆ# ä"ˆ# ˆ# ¥ˆ# k%ˆ#( Lˆ#0 ºˆ#8 šˆ#@ ׈#H Έ#P € ˆ#X 8 "Ô#` º$Ú#h &W#p Ü*W#t k,e#x 04#€ 1!1I#‚ ˆ2à#ƒ ©6ð#ˆ o?p# üH†#˜ I†#  J†#¨ K†#° L #¸ óNW#À €Pö#Ä  ´ «ºÔ Æ-»Ô# Q¼Ú# ø"ÀW#ÉŽðB–ŽB Ž01-ô24´#4; È\x! Ê\º Ìlk& Í|lB|B'ŒB »- Ƨ Ç' Ï2#ˆ S e à gˆ#  h§# í iW# ò jW# † k§#ë -L! 8Œ ü(0 mwkey nw# @+ o# Í$ p# s+ q# ô rW# J) s‡#(-W‡| *` Þ Ý% ‚Þ#exp ƒî#@ttl „î#Hs …¹#P X, †Ž#XBîBþB9 >W4__s>ˆ__n> A >D1gWTA gÕ)gˆ~Ÿ*gˆt(gBŽˆ¨Ÿ*Žˆt(ŽáCD èdstDˆ DD ¿-Dè9Gî ­¨ðÙ@ØÚ@ÿän¹_åϨåÄQpÛñåþ¨Ú@ÑÚ@J S ' ú@ŸQ!;D5ˆàÚ@Û@'æ°"now7•›æ"t8ˆÒæ#KD? Û@AÛ@çö$4)Û@ A G @>AŸ#0DQPÛ@´Û@gçQ%o5QQSè"kRW‰è$4tÛ@ÐTGÀè#­CXÀÛ@Îá@ìèµ "iZW>ê"jZWvê"atZWÕê"maxZWbë"zZWÕë"wZWøë&o5[Q.ì&7[Q{ì&¿-\èÄì&D]è í'â^µ ‘À~(buf_Å ‘Àv(fmt`Ö ‘ "lenaW‘í&îCbWïí&DtWÉî)þ(Ü@~’'Qï™ïÑï)þGÜ@0‚Å' ðIð…ð)þàÜ@`ˆø'äðñ4ñ)þÝ@ ‰+ 'Zñ€ñ¦ñ)þÅÝ@à—^ 'Øñò(ò)þÞ@˜‘ 'Nòtòšò)þ˜Þ@@§À *'½òãò)þ%ß@ªï *'ó;ó+À) &WD·Wmó4à@+à@ÈG¥ó,þ´à@Øà@›` 'íóô=ô)þÜà@𜓠'cô‰ô¯ô-má@Šá@&DkWÒôŽÅ BPŽÖ .BÿŽæ B/]DûÐá@Òá@w0Dàá@åá@w0¤Cðá@òá@w1&D â@cä@õô‚ 2iWGö2jWkö2atWŽö2maxWýö3¿-èF÷4âµ ‘à~54â@ â G …>AŸ649â@Pâ@ G ˜>AŸ64^â@oâ@5 Gi÷64€â@‘â@[ G•÷64‘â@¨â@ GÁ÷54Æâ@`&£ G ø54ã@0Å G5ø54$ã@À5ç GXø5~Oã@ð, *œ‘{ø6~€ã@’ã@-= œ±ø‘ùø54"ä@0_ G/ù74Hä@^ä@G[ù0ºCApä@rä@w1×CE€ä@¢æ@‡ùí8nowE•Ùú2iGWû2jGWIû2atGW¾û2maxGWáû3¿-Hè*ü4âIµ ‘à~`33VWsü9å@wå@…3ÃCXˆÑü:4:å@ ZGý54å@Ðg§GHý64æ@æ@iÍGtý:4`æ@]G ý;( ¥Ú;æ$ ¦Ú;Ü( =WW;| ?W>B;÷( v.WV=;w) zK-n=;ó, {c; ~ ;:-W;ËCWŽ­=;1,)¢;6,*ˆ;ç,-W;â*.W ~  ä;:-W;ËCW;1,)¢;6,*ˆ;ç,-W;â*.WW‡rv?W½0€Ò5HW×5HWBç@Lç@Ò5IW×5IW( ¥;æ$ ¦;Ü(=Wdns>WN=@Ww* +Wz+ ,W:- WÂD W‚0'WÞ-(WÙ-)W…*gÍD+nH,,WŽD.¶ pä( ¥;æ$ ¦;Ü(=Wdns>WN=@Ww* +Wz+/W `ä~u ä:- WÂD W‚0'WÞ-(WÙ-)W…*gÍD+n ?•H,,W»€8 EÈPî@”ö@<ø58ñÓ$x#s#ót intM#i­ŽiŽúD.ÔMg1«cØxE5b#§ ˆ#ä"ˆ#ˆ#¥ˆ# k%ˆ#(Lˆ#0ºˆ#8šˆ#@׈#HΈ#P€ ˆ#X8 "¶#`º$¼#h&b#pÜ*b#tk,p#x0?#€1!1T#‚ˆ2Â#ƒ©6Ò#ˆo?{#üH†#˜I†#  J†#¨K†#°L•#¸óNb#À€PØ#Ä  ´ «º¶ Æ-»¶# Q¼¼# ø"Àb#« ŽÒ Mx Žè MîŽHú5"-º>Ê?n# Ž' M Ž7 M=§$ b{Ì U Ö^Ý4ú8 8Mÿ~A üì:û<s?Ì>Ô>;BÄ>Ü>û> B: Q9 Š= < 9 ? =Ø@J@çA\Bà@n<ê= @;9ç?Ð?—:³=Ó:ðAx9 o9!Ñ<"u;#,>$;>%¶:&2:' B(x:)<*Bù?úe9û‚Bü`@ýU@þŸ;ÿV;€`;€€ô: A.L?«AfBZ:vAÒAþùAÿ³A€€0 18ô 2?´# 4F Èyx! Êyº ̉k& Í™ .‰ M 9™ M D© M »- ÆÄ Ç' ÏO# @Ù¼E$ ‚ Fkey Hˆ# î0 I†#øD KÙL! 8©iEA# ˆ3 MC1`b^)-`^A `è Œ7M†™Ÿ*M†È5Mbm1M•†81†ÎŸ*1†t(17m11•D1gbîA gèI4vˆ#Ÿ*vˆt(vèm1v•  bN__s ˆA  è9 >b„__s>ˆ__n>•A >è!Eb:EGˆPî@Žð@ó S:GèÍÎ=HŒ‘Ðz ptH†)9I ‘Ð~ txtJˆH lenKb‘ expKbÇ!“Kb#!|EKbl!ýKbÈ"âî@ïî@r!þDd{Ð"%ï@2ï@—!þDp{0#€°!þDw{Œ"Çï@àï@ä!m1Y•Û!ƒEYˆÿ$Î`ð@qð@|%á"  Ž ME”ˆð@ñ@N c &s”ˆ®  l•bä  p–ˆ -EŸˆñ@eò@x Ð 3EŸˆð !*'¯ˆ_ !Ç-°ˆá  i±bz  j±b× '[EÉpò@áò@ W ¿-ÉW ù—EɈ/ iÊbe bˈ‰(#Žò@°Í)A û9AŸ%6Ò©qEÒˆðò@åô@” ¿-Ò” ÷*keyÖš ‘Ð}¦Eך ‘Ð~ valêˆ@!·EëË#ðK —E⪠‘P+N&ó@@ä %w"%lN%as$N|ó@¦ó@æ%w–%lÂ%aç+NEô@Ü~ %w %l9%a^,À!±Eòº   Žª M~ 8º M-„ðô@"õ@w.ŒEˆ0õ@ ö@¤ª /¿-” ,0uEˆO1fmt‘`2„Jõ@ð3Nrõ@0u %w«%ló%a+4N£õ@Íõ@%w %l%a<5PEbö@)ö@w6E"0ö@nö@„6œE,pö@”ö@ø7( ¥¼7æ$¦¼7s1§¼7:-b7ÂDb7ËCb7Eb7ÃC:'8af;b b‹ M7%E>{ 7HEB73EC 7ÁED¿ 7( ¥¼7æ$¦¼7s1§¼9:-7b è…a9ÂD8b ä…a9ËC?b È…a9E9b €ä9ÃC:'  ?•8af;b9%E>{  Ð…a9HEB À?•93EC  @?•9ÁED¿  À…a% : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ &I' I : ; I8 ' < ' I : ; I 8  : ; ( : ;I : ;  : ; I5I : ;  : ;I8  : ; : ;  .? : ;' I !: ;I"4: ;I#.? : ; ' I 4 $: ; I%: ; I&'.? : ; ' I (4: ; I) *4: ; I+.? : ;' I@,: ;I-.? : ;' @.4: ;I /4: ;I 01RUX Y11 2.? : ; ' I@3: ; I44: ; I 5.1@6174181X Y9 :41;1<1X Y =41 >.? : ; ' @?4: ; I@4: ; IA4: ;IB: ;IC4: ;ID: ; IE.? : ;' @ F.? : ;' I@ G4: ; I? < H4: ; I? < I4: ; I J4: ; I?  % : ; I$ > $ >  I&I I !I/  : ;  (  : ;  : ; I : ;  : ; I8  : ; : ;I8 : ; : ;I<  : ; I8 I : ; .? : ; ' I : ; I.? : ;' I : ;I.? : ; ' I 4 : ; I.? : ; ' @ : ; I!4: ; I"4: ; I#.? : ; ' I@$4: ; I % U&4: ; I'1RUX Y (1) *1X Y +1,1RUX Y - .4: ;I/.? : ;' @0: ;I14: ;I24: ;I 31RUX Y41RUX Y5!I/64: ;I 7.? : ;' @ 8: ;I94: ;I: U;.? : ;' @<4: ; I? < =4: ;I? < >!?4: ; I? < @4: ; I A4: ;IB4: ; I?  % RU$ > $ > : ; I  I : ;  : ; I8  : ;  ( I !I/  : ;  : ;  : ; I : ; : ;I8 : ; &I : ; I8 I.? : ; ' I 4 : ; I.: ; ' 4: ; I.? : ;' I : ;I: ; I.? : ;' I 4 .? : ; ' 4  .1@!1"41#1X Y $1 % &41'1(.? : ; ' I@): ; I*4: ; I+.: ; ' @,: ; I-4: ; I . /4: ; I01X Y 11RUX Y 21RUX Y 3!I/4.? : ; ' @ 5.? : ; ' @64: ;I74: ;I 81X Y91RUX Y:1X Y;.? : ;' @<: ;I=4: ;I>4: ; I?4I4 @.? : ;' I@A UB41 C4: ; I? < D4: ; I? < E4: ; I?  F4: ; I?  % : ; I$ > $ >   I : ;  : ; I8  : ;  I !I/  : ;  (  : ;  : ;  : ; I&I : ; : ;I8 : ; & : ; I8  : ; .: ;' : ;I4: ;I.? : ; ' I 4 : ; I.? : ; ' I : ; I4: ; I !.? : ;' I "4: ;I#.? : ;' $: ;I%.1@&1'41(.? : ; ' I@ ): ; I*.1@ +.? : ; ' I@,4: ; I-44 I.4: ;I/1RUX Y0 U1!I/2.? : ;' I@ 3: ;I 4: ;I5.? : ;' I@6.? : ;' I@ 7.? : ;' @ 84: ;I94: ;I :.? : ;' @;: ;I<1X Y=1>.? : ;' @?1 @41 A B41C: ;I D4: ;I E UF1RUX YG H!I/I1X YJ4: ; I? < K4: ; I L4: ; I? < M4: ; I?  % : ; I$ > $ >   I : ;  : ; I8 I !I/  : ;  (  : ;  : ;  : ; I&I!I/ : ; : ; : ;I8 : ;  : ; ' II : ; I : ;  : ; I8  : ; I 8 .? : ; ' I 4 : ; I .? : ;' I !: ;I"4: ;I#4: ;I$: ; I%: ;I&.? : ;' ' ( ).1@*1+41,1X Y-1 . /4101RUX Y112.? : ;' @3: ;I4.? : ;' I@5: ;I64: ;I71RUX Y81X Y9.? : ;' I@ :: ;I ;.? : ;' @ <4: ;I =.1@ >.? : ;' I@ ?4: ;I@: ;I A UB4: ;I C1D UE1 F4: ; I? < G4: ; I? < H4: ;I? < I< J4: ;I? < K4: ;I?  L4: ; I?  M4: ;I?  % $ > $ > : ; I  I&I : ; : ;I8 : ;  : ;  : ; I8 I!I/  : ;  : ; I : ; ( .? : ; ' I 4 : ; I.? : ; ' @: ; I4: ; I1X Y 11RUX Y 1 1X Y 4: ; I? < 4: ; I? < 4: ; I !4: ; I?  % $ > $ > : ; I  I&I : ; : ;I8 : ;  : ;  : ; I8 I!I/  : ;  : ; I : ; (  : ; : ;I< .? : ; ' I 4 : ; I: ; I.? : ; ' @4: ; I4: ; I4: ; I 1RUX Y 1 U!4: ; I "1X Y #4: ; I$.? : ; ' @ %.? : ; ' @ &.? : ; ' I@' (4: ; I? < )4: ;I? < *4: ; I? < +4: ; I?  % : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/  : ;  : ; I : ; ( .? : ; ' @: ; I.? : ; ' @: ; I.? : ; ' @ .? : ; ' I@ .? : ; ' @ 4: ; I? < % $ > $ > : ; I  II!I/  : ; : ;I8 : ;  : ;  : ; I8 &I : ;  : ; I : ; I8 I.? : ; ' I 4 : ; I: ; I.: ; ' I  4: ; I.1@11  U411X Y 1 !.? : ; ' I@"4: ; I#.? : ; ' @$1RUX Y %: ; I&4: ; I'4: ; I (4: ; I )1RUX Y *1+ U,1X Y - .!I//.? : ; ' @ 0.? : ;' @ 1.? : ;' @24: ;I34: ;I44: ;I 51RUX Y61X Y71X Y8: ;I9 :1RUX Y;4: ; I? < <4: ; I? < =!>4: ; I?  % : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ 4: ; I? < % $ > $ > : ; I  I : ; : ;I8 : ;  : ;  : ; I8 I !I/ 4: ; I? < % $ > $ > : ; I  I : ;  : ; I8  : ;  I !I/  : ; : ;I8 : ;  : ; (  : ;  : ; I : ; .? : ; ' @4: ; I 4: ; I4: ; I U4: ; I 4: ; I? < 4: ; I? < 4: ; I?  % : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ &I& : ; ( !I/ : ; : ;  : ; I : ;  : ; I8 .? : ; ' I 4 : ; I: ; I.? : ;' I .? : ; ' I@: ; I4: ; I 4: ; I!4: ; I" # U$1X Y %1&: ; I'.? : ; ' @(1RUX Y )1 *4: ; I +1RUX Y , U-.1@ ..? : ;' I@/: ;I04: ;I14: ;I 21RUX Y31RUX Y41X Y5.? : ;' I@ 6.? : ;' @74: ; I? < 84: ; I? < 94: ; I?  K ëû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/lib/x86_64-linux-gnu/glib-2.0/include/usr/include/glib-2.0/glib/usr/include/glib-2.0/gobject/usr/include/cairo/usr/include/pango-1.0/pango/usr/include/gtk-2.0/gdk/usr/include/gdk-pixbuf-2.0/gdk-pixbuf/usr/include/gtk-2.0/gtk/usr/include/netinetimg/usr/include/arpagtk.cstdio2.hstddef.htypes.hlibio.hglibconfig.hgtypes.hgarray.hgquark.hgerror.hglist.hgconvert.hgdataset.hgslist.hgmain.hgunicode.hgstring.hgiochannel.hgscanner.hgtype.hgvalue.hgparam.hgclosure.hgsignal.hgobject.hcairo.hpango-font.hpango-attributes.hpango-layout.hgdktypes.h gdkcolor.h gdkfont.h gdkgc.h gdkvisual.h gdkdrawable.h gdkscreen.h gdkinput.h gdkevents.h gdk-pixbuf-core.h gtkenums.h gtkaccelgroup.h gtktypeutils.h gtkobject.h gtkadjustment.h gtkstyle.h gtkrc.h gtkwidget.h gtkwindow.h gtkcontainer.h gtkbin.h gtkmisc.h gtkmenushell.h gtkmenu.h gtklabel.h gtkbox.h gtkbutton.h gtkcelleditable.h gtkcellrenderer.h gtktreemodel.h gtktreesortable.h gtktreeviewcolumn.h gtktogglebutton.h gtkeditable.h gtkimcontext.h gtkliststore.h gtkentry.h gtktreeview.h gtkscrolledwindow.h gtkspinbutton.h mtr.hin.h stdint.hnetdb.hstdio.hnet.hmtr_icon.xpm nameser.h °I@ÊKZ€~fËcJõŸÐ}f°‚Ð}<±XYm"ËcJõŸÝ}f£‚Ý}<¤XY¶~"u- @T\TM¡XK[Ät¥y<¤Xb+iN#ZV>YW=„ÉZ:2ƒ„æd|‚“#Y…Ðz×ó'Ø~MÉW/É¢MŸZ 2K¢jF@ŽX =½ë¿S]ƒ%-Ÿ;=‘%Ÿ;=‘%Ÿ;=;ug)W<,íAƒ¾»&Ÿ;=’YsŸŸ)*gIg7ä2š$p\ ;"*Y*SAƒÉ"Y=ó-SAƒu’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-}AY’Y=ó-SAƒuæHhHk0V<0ØuÕ=Èst òãÕÕ/;W/;yX5y<0 Öw‚ Ju‚ ¬uXiH KuJ’ JwJ JuJh/ó×÷|‚Š&ö|‚Œ<òõŸww(KK×=ïR;ŸIYœ\y.èäKYZu KYZj KYYY­Z}È =­e»YY[ŸäM¡®/[xäsòKY[’ %å»å¼r>Y;=Y%Y»%u»#×;=Õ% XUMT„Z‘ZŸ„vVvZ¼1)»Úö&òMZ»>»>»?I(.’’))„b<$ƒ;=1ŸôŸô†_.$ƒ;=/××…ïVû /usr/include/usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/netinet/usr/include/arpacurses.cctype.hstdlib.hstring3.hstdio2.hstddef.htypes.htime.hstdint.hin.hncurses.hlibio.hmtr.hdisplay.hnet.hstdio.hnameser.h P`@Ö”º=/Jƒs=W[IY-Œ ä¥yX×só]730Z=-0=-Ñ.±òYÍ‚0¯¬ÊÏXCÈ=W».‚.Ff q¬‘…qYY».ŸA€v: X´¬ÌX³<’=-h=-h=-i=-h=-i=-¾òö~Xãf¡X”Û.£XL».„v‘?qYY».ŸA€v:Z @pY/Y».ŸA€v:" Õf¯XÑ<¯XiÎ.²X‚»hZ‘…+YY»v:ŸALž÷fXó<Xkî.XWgg+äÅf¿.Á<¿‚ÁfBXghw‘“»ð”x8YY½f‘K@ ò‘é~tœ.ä~.,º†*Y/Y»v:ŸAmž@pYÉY».ŸA€v: ä…fÿ~X<ÿ~Xiþ.XWgfmä’fò~<Ž<ò~thŒ.ô~¬‹XÌ~t‘ä…,î~¬<œä~.žº  Xa.’/»»»»»»»»»»»»»»» tv.Z»½»0»XX…¤)Z¡,mX…¤)8< f’×Yƒ;YZð>ÉŸ;=ËÙ‘ò±0.uIg[9ÖI­}JÓJ­}‚Óº­}<ÓX­}‚ÙXq<”Ÿ[$€jª}JÖJª}¬Öºª}<Ü.W=sg„¬½Mz"º ž×­e=YÕ=‘ ƒ;=ɼˑÖ•tœ>¬!s=W“jÖJjXÖªºÓ¬utp"”vºOäp>”w#Ðt/-jŸ¡PYe/‘v¾‹Ž>¸ JvÕi¤†‘HlF äJ2YzäȃqJY’]—qXyvtô/»òAZd> Ö˃ç0.u;gZ»Ÿeº/u;=3®¦wJoµºqò"ƒÈ Ètt .Yòx‘/Ÿ0䟠»>>>>>òOX3tŸLÇ{.¹ÈÇ{J¹ºÇ{JººÆ{XºtÆ{<º<Æ{<»tz¬˜ØrY/ƒ=0/‚»f.d]³{‚Í‚³{XÍX³{<Ñ<Z/0YO)ZzzXY/»i*³Ö:X†KYY[I•K¼I¿KZI{Ûû /usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/netinet/usr/include/arpa.mtr.cstdio2.hstring3.hstdlib.hunistd.hstat.htypes.htime.hstddef.hstdint.hsocket.hsockaddr.hin.hnetdb.hstdio.hlibio.hctype.hfcntl.hstat.hmtr.hgetopt.hdisplay.hnameser.hnet.hgetopt.hasn.h ðy@ˆ„å;=2»vIuVZOž,žo.J?©‡fX$Ö ¯Ufä3XŸ» žƒ׬§ò]¿ƒn#Ÿ;=/Aº?<A<Ët¢S¶ºÊ<¶<¬€…È‘gw< <rèŸN›‚å~f0 h“ òŸŸÂŸÀf†fghGÛ}¬ú¬ŸºÖà. Xß.ggé»GäŸLfÍÖK;K;ƒjÈ÷}J‹žKŸ ÖŸWfÓJgŸ„ƒj.Ÿ½Ö9.Gž:fÚÈŸªf×@žŸ.»mÌŸî~‚.þ~º—.g¬}ÖÖžBÖåTŸNÖû.+ºŸaŸfŸÌ~f°.„JŸbÖŸîfÌŸšŸZf=‚üté£wäYY_ ‚ƒ<Ò}f¯XÑ}žªžÖ}žËžµ}ž‡žü‚°\V„Yœ¼Z-=WKŽ\ð|X”žŸŸtº PB@û‚Î<B<B¼ÌZ"ÊÉ×;gVÀÍÛÖ.‚S‚Ys==®=—~Xéž—~ÖêX•|‚ûÈh;«vYƒ“þ{t½žÈ—¬é<—tífZË;‘I„~ X¨{ž†(ó{‚$N8„>uƒ8uií{¬žžÈCòòòr‚ºÎ{´žbtó$‚Å{òÄ(š|¬æ<š|rןxÀ~f¿X›N*Ú/ŸÌ$hV@,æ[ʬó…xÜz²w¬åžkäh¸ggIg»! ñƒYBhÖž£gªh!!XwXÚžúz¬ Xs¬ JZË¢d KY¡L\zº rPT¾šjp@ ºtX ºGM(ñ€L:.»ƒvdv‚.Kòvu>v;eÎspu,>K9h­K-gçÊd>:v’:h/&gsvxÕJ§zÈŸŸØž«zt!×(¨zØt¨zÈ»¬óƒs¬[g¹­Ly'yòóŸs 3ž‹}È.rtÖrf .vX ‚LY-/l•~Xìt”~‚íÖi9Y„ämƒÏÕƒÎt YŸzò fw< =Y1œ„Y³,ƒP!/Óƒ)t$YŸpÈ¿óYŸcžYŸ žYŸwžYŸ]žYŸמ\ /Èyf\~QYº> }à‚ }¬âXr< JXg|vò[uztiK3o¦NtX[ƒ¢YLX¾äÂ<t6¼. ‚Ÿg-Ë(ŸiÈÖ}ºªXÖ}t®fÏ~<±.üX×}<ªÖY^ºguZ¢p?e‘;Y/’ÉY×fÖgKYuY;YYeuü}òu®Ï~<±.Ó~Ö…Ö:Z´fÌ<ɬנMŒ@9=ƒ‘)»I»„ƒî~.Y>X$WzX[‚ý‚«XŸ°‚Ü× Öh×lZcÈ.cÈžúy€sJ†WWeNtº†WW;NÏ䂃ã.*¬ƒ‡¹•ƒ—T†/&1È—T†g$—T†gD$ T†g$ T†g¨$ T†gçòü.]ª/K!K‹Š@ Xw. Jt< .vX tVy‚ .YfK;­päK/J=X¼Yu&uv¸(%ov¯wª»»YŸƒ ã û /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arpadns.cstdio2.hstring3.hsocket2.htypes.htypes.hstddef.hselect.hsocket.hsockaddr.hstdint.hin.hnameser.hnetdb.hstdio.hlibio.hresolv.hmtr.hnet.h p«@áp ALY\ H.]@óK,K=œ>rJ]jSJ.ƒ­f<’Öf<’mLIKYKNƒrtIKK‘K Jƒóƒ2¸Ì ‘ƒ‘¨ä òJ.6<”FJ×IL-=H>¸;¬ƒÉò<’ºò<’ùLIKYKOIƒrtIKK‘K fø?¨JØX¨<‘K,K=œ>rÙž ‘ƒ‘KSÖ †F$8NY>¼gIMG”ÉgIMG”_KWZ‘KNƒròIYY‘K fÜ ?‘ ‘ƒ‘K§ä ‚vf<ƒguK=tƒrJK;L‘?Qƒw ¾uƒØƒ°æX<מX‚ƒYuK=tƒrK;L‘?Qƒw ¾uƒØƒ°K;YiYMƒVuƒz ò =Yƒƒu=»öåf<’Öf<’gƒ„1j€~.€<€~¬óK,K=œ>r…¬­‘ò<’º<<’õ‡yÖ  xY>’LH“ÉLH“Yˆ{K»»I÷]™‡}yS3;=m€Z”9„©(žv;i¬tjf<2%z0väŸX0KlbKYŸYIAV!I>KY¢Êxt¶%ã Ÿ×× í5aˆâò¼:ÙtJ¨ <Ùt<§ JÙtf¦ ¬ÚtX¬  ­| *=Wj—ƒ;=j¤FKKHKKKGwKGKKKj”–æ‘÷YWvf<qXK J”Ì <B;uY;AUWjƒ'Éíwò–/²º~.žÚž¾vtÅ %Ÿ„~/òîvòëò¼ƒ <w.¤~¬Úòî³~ò”xìž”x¬îž,<Ú>V=ÌÉYɃÚwä©%  ºÌwä·% g<^¬ kfk.XjY;È×v¬³ %†žÀWuY;/jÉ'\b@·wJË,ægÍ’åVidZ f”nòÇÖóÐv¬êä–wfêf–w<ëž•¤Ÿ‰wž÷f‰w<ùž/Õwž¬  Wƒ žuY;/¾Ú¿”óÉ;KŠwfûÈŸåˆXgWPÈãwºXãwfäãwȺœ'äwä‘ ,PJ`žž©w#Ù%Ÿ¦wºÜ%Ÿržlž*žÃwžì‚k‚ŸWwºÿXw< ä WƒÅ<».ývXó%žž‚wºÿžÍJŸv.á Ÿv á XŸv ç X,>h"ÖËeH"s‘I Èx J)‡)r¬xž`‘“s‘I'MræHùuX‡ f|ñuº fñu<’ žH¼ºÀv.À Àv À XÀv Å X,>hV®d0½HÊs/IÁi ‚)‡)w‚Ês/I J™vºç f™v<ê žHzºsŸv‚á f•}¬ƒ—Xkž</»ñxfñx<”žG[xfoòɇyò.àx XàxX žàx‚ Xàx<à .çÀzfZW=tÉŸKó;É­e‚XXéÜu‚%žvI=hÉŸK JŸƒóƒdfƒÒuJ­ äÓu<° òäÉ|òô,;vK:vŸƒgI´ò[Jo.KJ‘ käk)K u‚à f u<â žwò§u‚Ù f§u<Û ÖØ ž Zƒ›=KƒeÉYƒ½+YƒÉ®uX× #M»YXX0 d û /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arparaw.cstdio2.htypes.hstddef.hlibio.hstdint.hin.hmtr.hstdio.hnet.hnameser.h 0Ó@2Mc1J3äUJuyžÉ1XP0Zº /%‚]X P4û /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arpasplit.cstdio2.hstring3.htypes.hstddef.hlibio.hmtr.hin.hstdint.hncurses.hstdio.hnet.hdisplay.hnameser.h Ô@È.Ye=ÖpÖ<rXr`N> ÖsU19U++Uº+òUX+UÖ+U.+tUf4Ö <bžgŸy‚ /tˆ×;=/x< fw‚ )lä#+MYWYƒÊMK(XYä'Jh<Ê/JjºjX j uf .„‚eYK/e‘-gJfÁÖ¿XÂ,U;-ºŸL¹.ÇÖ¹JǹJÈ.¸<È‚¸<Étz¬eÈ%‚‘YHž9òƒ;=YY[«tÕX«f×$©º×ä©ÖßžGIšJæJš<溚<æžš‚ìXt.‘­M#€j—JéJ—(ÈË<µXÌ‚ŸW=ZÔ>x( ‘.ôÉ¡‚à‚kJ4º‘ò/¦XèÖÉ~)Û$¥ÛJ¥‚‰<Ä$Èý~È×uY-/ZuU= qu>ýòxöøöÜ~.¤äÜ~º¤tÜ~ò«¬Õ~Ö°×Ï~<·(ƒY;/g1Ã~JºXYÅ~¬ÉºH¹~¬Çò¹~‚¾ÉŸÀ~JÞä~.YXÃJä~JY<ÃÈä~¬Ÿžql´~¬¾tÂ~ȹžÇ~ÈÕžYÖÒ~.®tÒ~.°äÐ~ÖÕX$õÜsgs3ƒYsue=Z‘×»~ºñ,=Ž~XÝ!‚~tþä‚~‚øXuM+-YW1€~<ø.ˆ~žéÖû})ô'=‹~X…Ö¢œû /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/x86_64-linux-gnu/bits/usr/includestddef.htypes.hlibio.hstdio.h¢œû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/includetypes.hstddef.hlibio.hstdio.hïZû /usr/include/x86_64-linux-gnu/bits/usr/include/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/x86_64-linux-gnu/sys/usr/include/netinet/usr/include/arpaselect.ctypes.htime.hstddef.htime.hselect.hlibio.hmtr.hin.hstdint.hdisplay.hstdio.hasn.hnet.hnameser.h °æ@1.q. fw<#+‚uJ ¬SŠÉW29åew,0V u¢d®Kg° fy<}‚Y9 Éäd f=”==:ƒƒk»Sƒ† ‚SÖ‰Øæ$ƒsu.®‘2=‘Kkäc»¼)X ‚G1®;\ò:¬Éþ~.òKsƒNh5ƒ;i I$<ŸºÖY-K,Ȣ׃+Ö˜.Ct5Ö¹ ƒW­]ò:3Y³žÒJu \c[ò/ XaXrX-¬SXƒT0XQX)XlzX=-ggß txXyXtqXgxffjXƒ=eggväfcXƒ/wž$‚]XT™ÈÄQû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/x86_64-linux-gnu/sys/usr/include/arpa/usr/include/netinetasn.cstring3.hstdio2.htypes.hstddef.hstdio.hlibio.htypes.hnameser.hstdint.hin.hsearch.hmtr.hasn.h Pî@ÆÖ5ÏÇ #:Z'ZÉ”L$YÉ–ƒI\ùzf ÈTQ;qJ¬_=G&ä[äÏžKe¬›Mvž ‚ žpÖnžÈmt¡&tv#ås®}^;?S¼zÉ’ fwt ‚Ø0YYYƒc‚^xt ‚;g1ƒgŸƒŸ?aò¾ƒ¬gs ‘h‚(ä®:",xÕ~fª<ƒÕ~<«JÕ~fª¬hד¬/–Û~Ȱ.Ý~X¤¬Ü~.s<°.Ý~<s<°<Ð~ž°tÝ~t£J’Û~‚¥"_ÖxŸÉuÇY äK0Yƒ,æ~‚›"XÜ»uCX<<‚ôòswXóT¾8&¨~tØX¨~fب~JÙX§~<Û*w# t„º­’K¾?¸ZHxK¾Y in_drag_filenofocus_widgetGDK_SELECTION_CLEAR_GtkMenuG_IO_STATUS_AGAINtree_viewG_SIGNAL_RUN_CLEANUPGDK_DESTROY_GArrayGTK_RC_BASEGDK_MOD3_MASKuse_markupblue_shiftgdoublegrabsG_PARAM_PRIVATEcellred_maskCOL_LOSSG_SIGNAL_DETAILEDtorn_offGTK_TREE_VIEW_COLUMN_FIXEDhscrollbarmin_widthG_IO_FLAG_IS_SEEKABLEparent_menu_itemG_TOKEN_EOFalignmentN_COLSis_writeable_IO_save_endis_activeG_PARAM_STATIC_NICKhomogeneoustree_modeltearoff_adjustmentGDK_PROXIMITY_OUTG_IO_FLAG_SET_MASKdigitsGDK_AXIS_YTILTGDK_SHIFT_MASKGdkPixmapgreen_precReportTreeView_clickedNewDestination_activateGDK_GRAB_BROKENselection_boundGDK_SELECTION_NOTIFYGdkByteOrder_IO_write_baseG_SIGNAL_NO_HOOKSio_readGDK_LEAVE_NOTIFY_GtkBoxpriv_accelsG_IO_FLAG_APPENDis_invalid_GtkTreeIterts_y_originGDK_RELEASE_MASKproperty_cachetext_areaGDK_VISIBILITY_NOTIFY_GtkCellEditableGDK_SOURCE_PEN_shortbufG_IO_FLAG_GET_MASKbutton_request_GtkStyleactivates_defaultscreen_IO_save_basecondupper_arrow_prelightrequested_widthcolormapnet_iochannelhas_frameGDK_SUPER_MASKstick_initiallyGdkAxisUsev_uint64COL_RCVallocated_lencopy_itemGTypeGDK_HYPER_MASKpriv_cur_columnmax_widthgtk_net_dataG_PARAM_WRITABLEGDK_MOD2_MASKbase_gcblink_timeoutts_x_originheightmain_windownumericdispatch_GdkDevicewidth_charsGTK_TREE_VIEW_COLUMN_GROW_ONLYgtk_redrawG_PARAM_STATIC_NAME_GSourceCallbackFuncsmodal_GdkRectangletext_aa_gcToolbar_fill_GTypeClassicon_factoriesGSourceDummyMarshalproperty_changed_signalsubwindow_gcsGDK_LSB_FIRST_GtkAccelGroupGDK_FONT_FONTSET_GtkTreeView_GtkBinhave_grabns_s_nsG_IO_STATUS_EOFv_longGCallbackcursor_visibleG_SEEK_SETmenu_flag_IO_markerG_TOKEN_FLOATgunicharaccel_modsGTK_RC_TEXTg_type_instanceclosure_callbackclipboardcolorsderivative_flagreorderableGDK_AXIS_XGDK_AXIS_Yvscrollbarhostentdo_encodeGtkTreeIterCompareFuncwmclass_nameread_cdgtk.cG_TOKEN_IDENTIFIER_NULLbin_window__u6_addr16GDK_MODIFIER_MASK_GSourceGDK_META_MASK_GtkMiscglongGDK_CONTROL_MASKdestroy_with_parentattach_countuint8_tmaximize_initiallymnemonic_widgetg_class_IO_FILEGDK_AXIS_XTILTframe_rightdns_iochanneltearoff_windowGTK_SHADOW_NONEblueG_TOKEN_LASTGDK_KEY_RELEASEns_s_prneed_timerguint32unsigned chartoggle_sizegtk_load_pixmaph_aliasesguint16constructedsnprintfrc_stylegtk_loopsource_funcsGDK_ENTER_NOTIFYtransient_parent_GdkFontGDK_VISUAL_PSEUDO_COLORis_expanded_GtkIMContextclip_y_originns_s_qd_GList_GObjectin_childis_expandermodifierscached_layoutgint8G_IO_PRIhas_focusparent_instancegtk_dns_dataGDK_BUTTON3_MASKuse_bufferellipsizeTreeViewCreateupdate_tree_rowythickness_GdkColormappreedit_cursorG_PARAM_DEPRECATEDcolumn_typehscrollbar_visibledepressedmnemonic_modifierbutton_downaccel_keyauthors_IO_lock_tGDK_DRAG_LEAVEgravitygtk_do_initsourceCOL_AVGblue_maskcolor_flagsgtk_opengtk_detecth_addr_list_GdkGCgtk_dns_data6_IO_read_ptr_GtkWindowGeometryInfohas_user_ref_countGDK_MODE_DISABLEDascentselect_infoview_windowinconsistentG_TOKEN_HEXstdinG_TOKEN_RIGHT_PARENposition_func_dataupdate_policyGTK_SHADOW_ETCHED_OUTguint64GDK_WINDOW_STATEhscrollbar_policyGDK_BUTTON2_MASKtext_max_lengthmodifier_maskGIOConditionCOL_HOSTNAMEGTK_WINDOW_POPUP_GtkWindowGDK_VISUAL_STATIC_GRAY_GtkContainerv_pointer_markers__fmtprivate_flagstimeout_idGDK_2BUTTON_PRESSGDK_VISUAL_DIRECT_COLORclickable_GSListdnd_position_GtkSpinButtonGDK_NO_EXPOSEG_SIGNAL_MUST_COLLECTsnap_to_ticksguint8position_funcobjectin_buttonGDK_SOURCE_MOUSEencodingin_inotifycell_listGDK_MSB_FIRSTfg_gcdefault_widgetGDK_DROP_STARTGtkSortTypeG_SIGNAL_RUN_FIRST_GdkVisualdepress_on_activateGDK_UNMAPupper_arrow_visiblegetSelectedHostns_s_udpercent_formatteraccel_path_quark_GdkPixbufG_TOKEN_STRINGGTK_UPDATE_ALWAYSaccel_pathG_TOKEN_LEFT_PARENG_IO_NVALreallocate_redrawsG_PARAM_CONSTRUCTcell_background_setmaybe_reorderedencoded_read_bufGQuarkmnemonic_keyvalexpandReportStoreh_namey_rootpaused_GSourcePrivateGDK_BUTTON1_MASKG_PARAM_LAX_VALIDATIONclosureGDK_CLIENT_EVENTstylesGDK_MOTION_NOTIFYdark_gcallow_growexposure_gcsunspec_addrfinalizemiscGDK_MODE_SCREEN_lockblackbuf_sizeGDK_AXIS_LASTCOL_COLORv_int_flags2line_term_lenh_lengthg_type_GtkEntryis_cell_renderer_IO_read_baseeditablens_s_maxred_shift_gtk_reserved1need_default_positionlower_arrow_visible_unused2editable_widgetblue_prechas_cursoruser_data2user_data3io_create_watchGDK_MODE_WINDOWlock_countnavigation_timeoutxthicknesssprintfn_guardstree_columnGDK_MOD1_MASKGNU C 4.6.1argc_GtkToggleButtonediting_canceled_old_offsetG_IO_STATUS_NORMALpoll_fdsfixed_widthG_SEEK_ENDargsargvGDK_AXIS_PRESSURE_GSourceFuncsv_floatsingle_line_modeh_addrtypedefault_sort_func_GtkAdjustmentGDK_SELECTION_REQUESTG_TOKEN_CHARis_seekablelong long intdescentWindow_fillGDK_BUTTON5_MASKred_precdrag_start_xdrag_start_yVBoxv_uintG_TOKEN_COMMENT_MULTIG_IO_FLAG_IS_WRITEABLEWindow_destroyGDK_DAMAGExaligngtk_keyactionrc_propertiesGDK_SOURCE_CURSORresize_modehave_transformim_context_IO_write_endin_marshaldepthgbooleanframe_bottomnewdestination_itemCOL_STDEV_GdkDeviceKeyx_n_bytesaccel_flagsclosedcairo_font_options_t_GdkScreenG_SIGNAL_ACTIONdrag_xdrag_yguintGDK_EVENT_LASTGtkRcFlagswm_rolesensitiveGDestroyNotifyGDK_SETTINGns_s_znGDK_BUTTON_PRESSn_columnsuse_stockentryprivate_font_desc_GtkMenuShelliconify_initially_IO_buf_basedecorated_GtkWidget_GdkDeviceAxiskeyboard_modeGDK_OWNER_CHANGEdefault_sort_destroyline_termnormal_gcsmnemonic_windowstep_incrementGDK_MOD5_MASKnum_axesGDK_SCROLLG_IO_STATUS_ERRORG_TOKEN_BINARYclose_on_unrefGTK_WINDOW_TOPLEVELPause_Buttonrecompute_idlev_ulongmouse_cursor_obscuredG_IO_HUP__pad1__pad2__pad3__pad4__pad5GDK_KEY_PRESSfloat_formatterGTK_SORT_DESCENDING_sbufpartial_write_bufvscrollbar_policyG_TOKEN_RIGHT_BRACE_GtkObjectyalignv_int64draw_indicatorToolbar_cairo_font_optionstearoff_activeGTK_TREE_VIEW_COLUMN_AUTOSIZElight_gcn_accelsbits_per_rgbneed_resize_GtkRequisitionGTK_SORT_ASCENDINGconfigure_notify_receivedtrack_linksmid_gcshow_ipsWaitTimepage_size_GValueclip_x_originGTK_POLICY_AUTOMATICGDK_EXPOSEG_TOKEN_COMMApopup_menuGDK_DELETE_GDataGDK_SOURCE_ERASERactivate_timetearoff_hboxvscrollbar_visibleGInitiallyUnownedsend_eventGDK_MOD4_MASKuse_resized_widthtruncate_multilineallow_shrinkgtk_add_ping_timeoutparent_menu_shellG_IO_FLAG_NONBLOCKGDK_CONFIGUREdefault_sort_dataPause_clickedGDK_MAPgpointerlong doublearrowG_TOKEN_LEFT_BRACE_PangoAttrList_GMainContextio_writeGtkMenuPositionFuncGTK_RC_FGio_get_flagsGClosureNotifyCOL_WORSTGDK_BUTTON_RELEASEhas_focus_chainCOL_SNTGTK_SHADOW_OUTwrite_cdgtk_close_GIOChannelacceleratablesG_TOKEN_RIGHT_CURLYGtkAllocationneed_im_resetGTK_SHADOW_ETCHED_INio_close_GtkScrolledWindowresolved_dirtext_lengthaccel_groupdevicecache_includes_preeditselect_linesG_IO_FLAG_IS_READABLEGTK_SHADOW_INgtk_pingGdkModifierTypeuint16_tneeds_destruction_ref_countframe_top__off_tsort_column_idGSeekTypecolormap_sizetimer_stepwrapio_seekeffective_attrsio_set_flagswhitesaved_state_GtkLabelG_TOKEN_OCTALbg_pixmapborder_width/home/wolff/mtrprepare_GtkButtonGDK_DROP_FINISHEDinvisible_charns_s_anns_s_arG_SEEK_CURgeometry_infotext_aaG_PARAM_STATIC_BLURBGTK_POLICY_NEVERGDK_VISUAL_STATIC_COLORG_TOKEN_LEFT_CURLYsource_id_GtkClipboardneed_default_sizecallback_funcsgint16_IO_backup_basepanel_GtkEditableGDK_AXIS_IGNOREwindowing_databg_pixmap_namelower_arrow_prelight_GdkAtomsort_clicked_signalmtr_iconio_freesort_orderuse_underlinewindow_placementcolumn_headersGDK_3BUTTON_PRESS__off64_tignore_enterG_TOKEN_SYMBOLcontainerwhite_gcGTK_RC_BGGDK_DRAG_STATUSx_text_sizeCOL_LASTGIOStatusGtkTreeViewColumnSizingGSourceFunc_GtkListStoreGIOFlagsx_rootnum_keyssort_list_GdkColorselect_wordsGDK_AXIS_WHEEL_IO_buf_endscroll_stepprivate_font_GtkTreeViewColumnrc_style_listsresizableGdkInputSourcev_doublegfloatxpadtimer_callspixel_GTypeInstanceclimb_rate_GStringcheckG_TOKEN_INTn_inotifiersWaitTime_changedshort intgcharreliefeditingpriorityG_TOKEN_IDENTIFIERshow_sort_indicatoroverwrite_moderesolutionfloatingTreesort_column_changed_signalwrap_mode_GtkAccelKey_GIOFuncs_GClosure_vtable_offsetgreen_shiftip_tcallback_dataG_SIGNAL_NO_RECURSEiter__u6_addr8_GErrorreserved2_GIConvjtypespacingold_active_menu_itemscroll_fastignore_leave_GdkDrawableHost_activateclosure_marshalG_IO_FLAG_MASKGDK_PROPERTY_NOTIFY_GdkEventButton_GdkRegionGdkVisualTypepage_incrementGTK_POLICY_ALWAYSgreen_maskRestart_clickedGdkFontTypetype_hintpattern_setG_TOKEN_NONEGDK_BUTTON4_MASKbyte_ordermeta_marshal_IO_read_endcurrent_posGDK_NOTHINGGDK_VISUAL_TRUE_COLORAbout_clickedReportTreeViewactivate_timeoutfocus_outG_TOKEN_COMMENT_SINGLElong long unsigned intgulongallocationG_CONNECT_AFTERevent_windowuint32_tG_TOKEN_ERRORsaved_scroll_offsetGDK_LOCK_MASKengine_specifiedn_fnotifiersGDK_DRAG_ENTERgint64_GtkWindowGroup_GtkTreeViewPrivateshadow_typeclick_childhave_xgrabGTK_UPDATE_IF_VALIDgsizedarkgintgreenchildrenrequisition__ns_sectG_TOKEN_EQUAL_SIGNG_IO_ERRtitleshort unsigned intstdout_GClosureNotifyDatavisualG_PARAM_CONSTRUCT_ONLYtext_gcGDK_VISUAL_GRAYSCALEmessagewmclass_classfocus_on_clickuser_data_IO_write_ptrblack_gcG_PARAM_READABLEtoplevelkeys_changed_handlerconfigure_request_count_GtkAccelGroupEntrylabel_PangoFontDescription_GtkLabelSelectionInfoGdkEventTypeCopy_activatecolumns_dirtyCOL_BEST_GtkCellRenderer_GtkTreeModelGdkWindow__u6_addr32GDK_DRAG_MOTIONlabel_texttearoff_scrollbarGDK_FONT_FONT_PangoLayoutG_IO_IN_GtkTreePathGDK_PROXIMITY_INis_readableqdatahas_toplevel_focusfocus_childin_clickframe_leftprevnavigation_regionpreedit_lengthbg_gcG_CONNECT_SWAPPEDG_IO_OUTGdkInputMode_GtkRcStyleG_SIGNAL_RUN_LASTGDK_FOCUS_CHANGEGtkSpinButtonUpdatePolicy__in6_uGConnectFlagsActionClear_idlokIPPROTO_MTPfactorsIPPROTO_PIMIPPROTO_ICMPActionResetIPPROTO_DCCP_pad_bottomIPPROTO_TPpdat_immedIPPROTO_ENCAPIPPROTO_IGMP__src_pad_x_pad_yhd_lenmtr_curses_opencurses.c_use_keypadchtypeIPPROTO_NONEActionASActionQuitenablemplsattr_tActionIIdata_fieldsActionNonelow_ms_win_st_sync_regtopIPPROTO_COMPmtr_curses_redrawnet_xxx__unused_int_curx_curyIPPROTO_ESPfld_indexstdscrIPPROTO_ICMPV6IPPROTO_SCTPIPPROTO_FRAGMENTtolowerActionScrollDownmaxTTLstrcpy_scrollmtr_curses_graphActionDNSmtr_curses_closeActionMPLSmplslenIPPROTO_UDPmtr_fill_graphldatsaved_regbottommtr_curses_keyactionmtr_gen_scaledisplay_mode_parx_paryActionScrollUp__destblock_mapIPPROTO_MAX_pad_topIPPROTO_RSVP_leaveok__nptrbitpatternrangestartstatIPPROTO_IPV6__resActionPausehigh_msIPPROTO_PUPatofatoi_BooldescrIPPROTO_RAW_maxx_maxyIPPROTO_IDPpwcenterformatdisplay_offsetmtr_curses_hosts_idcok_padfstTTLIPPROTO_HOPOPTS_notimeoutIPPROTO_UDPLITE_pad_rightmax_colsIPPROTO_EGP_bkgdmtr_print_scaledActionResume_yoffsetIPPROTO_GRELocalHostname__time_tmtrtyperowstatlabels_begx_begyIPPROTO_TCPavailable_optionsmtr_curses_clearIPPROTO_AHIPPROTO_ROUTINGIPPROTO_IPIP_pad_leftActionDisplay_delay_linecpacketsizefld_activepressanykey_rowIPPROTO_DSTOPTSIPPROTO_IP__streamst_ctimipinfo_nosa_familysockaddr_in6_ISgraphst_blksizest_blocksai_addrlensin_familysin_addr__gid_tai_flagsSOCK_RAWst_mtimsin6_addrai_nextai_canonnameForceMaxPinggethostname__dev_tDisplayGTKSOCK_DCCPSOCK_RDMl_typehas_argbzero__s2_len_ISprint__blksize_tfilenamest_uid__PRETTY_FUNCTION__SOCK_SEQPACKETDisplaySplitst_rdev__buflensin6_scope_id__socket_typeSOCK_STREAMsockaddr_insin_port__mode_tsin6_port__socklen_tsin_zero__s1_lennet_preopen_result_ISpunctremoteportin_addr_tDisplayCSVlong_optionsst_gidoptindDisplayXMLst_sizenames_toptionai_familyai_socktypetrim_ISxdigitfstat__blkcnt_t__buf__ino_tPrintVersionread_from_file_ISupper_IScntrlhintsalptrprognamereportwide__pad0__fdSOCK_NONBLOCKparse_mtr_optionsst_nlink__unusedai_addrsin6_familyDisplayMode__pid_tst_devInteractivetimespecSOCK_DGRAM_ISalphaPrintHelpsa_family_tappend_to_names_ISblankst_atim_ISalnumsa_data_ISspaceaddrinfol_startDisplayReportInterfaceAddressSOCK_CLOEXECparse_argfprintfmtr.c_ISlowerSOCK_PACKETtrhost__lenstderrinit_fld_optionstv_nsecDisplayCursesunlockl_whencest_mode__uid_tDisplayRawl_pids_addroptarg_ISdigit__resultl_lenfgetsst_ino__statbuf__nlink_tsin6_flowinfoDisplayTXTtv_secai_protocolin_port_tflock__s1srcportsendsock4_icmpoldflagssourcesockaddr__ssize_tnet_jintafromsockaddrobj_hdr_classbatch_atnet_gmeanext_verlocallocal6oldjavgsaved_seqss_familynet_lastnet_set_interfaceaddressremoteutimememmovenet_send_querytotusecremote4remote6net_harvest_fdsudpheaderrecvsocknet_save_incrementunreachabletypefromaddressnew_sequenceechoreplytypenet_opennet_javgtimestamp__fds_bitsnumhostsaddrcopysaved_seq_offsetUDPHeadermaxfdsendsock6_udpcalc_deltatime__ss_alignstrncpyrecvsock4recvsock6net_xmitset_fd_flagsnet_maxext_restimevalnet_resettcpheaderremotesockaddrnet_localaddrnet_add_fdssendsocksendsock4sendsock6fromsockaddrsizersa4unow__fd_maskudpdataext_chktv_usecudppobj_hdr_lennet_drop__flagsdsizeTCPHeaderprependlocal4net_mplswaittimenet_reopenremoteaddressnext_sequencen_unknownnet.cnet_save_xmitsalen__chsent__d0__d1name_structnet_save_return__u_chardecodemplsnet_minremotesockaddr_structnet_avgnet_send_batchudp_checksumsaddrdaddrnet_process_returnsendsock6_icmpsendsock4_udpnet_jitterechotype__suseconds_toldavgnet_waitfdrecvfromnet_preopenfirst__addrudppheaderBSDfixtrueoptnet_transitfromsockaddr_structnet_mplssnet_addrudatatimeexceededtypenet_process_fdsnet_stdevnet_send_tcpnet_upsockaddrtopsourceaddressmemsetversioniphsizenet_saved_pingsfragnet_process_pingnet_close__ss_paddingsockaddr_storagenethostuint64_taddrcmpICMPHeadercsumpacketnet_addrsnet_worst__addr_lenstrptrrsa6ssa4ssa6fd_setsave_sequencemypidUDPv4PHeadernet_bestmemcpywritefdcontentnet_selectsocketsourcesockaddr_structnet_returnedobj_hdr_typedstportaddrcpynet_lossnet_jworstIPHeaderfsa4fsa6net_end_transitns_r_badsigqdatatypens_t_keyns_r_formerrns_t_wksdns_eventsns_t_ixfrns_t_srvns_t_nimlocns_o_maxns_t_minfoaddr2hostdns_lookup2dns_waitfdretranslastlogfrom_sastructlastlinkresolvestreamlogdns_forwardopcodesns_t_invalidaddr2ip6arpabashnumnamestringns_t_dnamedaysns_t_nullns_r_nxdomainns_c_chaosres_reversesuccessns_t_optres_resendnullstringns_t_aaaa_initstampstrlongipns_t_a6previoushost_vcsockns_t_nxtlocalhost6packetheader__ns_classlongipstrgethostbashallocresolvepreviousidns_o_notifypreviousipns_r_badkeyndotsns_t_zxfrns_t_maxnsaddr_listns_t_naptrns_r_badversns_t_cnameidseedns_t_anydatabyte_adatabyte_bns_o_statusfrom4from6ns_r_notauth__u_intres_send_rhookaddrstrdns_opendwordns_t_aplaseedres_timeoutgetidbashunlinkresolvehostns_o_queryarcountdns.cipv6_unavailns_t_nsapstatmallocres_nserrorns_t_hinfofailrp__ns_opcode_ext__res_statesendstringnsaddrsns_t_atmares_goaheadretryresendrequestns_t_amyresres_modifiedtempstringns_t_txtrdatalengthns_r_noerrorres_h_errnouse_dnsres_send_qhookgetipbashsigneddiffloglineqdcountns_t_ptrclearsetresolvecountres_errorns_t_loclastresolveusefulanswersecondsns_r_notzonens_t_nsap_ptrclasstypesdns_lookupdefdnameresponsecodesnextidns_t_kxnextipns_t_certresfd6ancountstackstringns_r_maxdnsrchminutesresrecvbufresfdSTATE_PTRREQ1STATE_PTRREQ2STATE_PTRREQ3nsinitu_int16_tns_t_mbns_t_mdns_t_mfns_t_mgns_r_notimplalignedipns_t_mrfromlenns_t_mxunlinkresolvens_o_iquerypreviousresourcetypesrrtypesns_c_invalidSTATE_FAILEDres_nxdomainns_t_nsres_donestrtdiffns_t_tsig__ns_rcodens_r_servfailissetfdbashvalueres_unknownidns_t_gposns_r_yxrrsetns_t_pxmallocsizestatfreedebugns_t_signssockslocalhostres_sendhookactuntieresolvenscount6ns_t_afsdbns_t_mailans_t_mailbdns_waitfd6dns_ackfindidns_r_refusedfindipnexthostSTATE_FINISHEDunlinkresolveidnsortunlinkresolveipns_t_rpns_t_rtbytens_r_yxdomainu_int32_tnsmapns_o_updatedns_ack6res_hostipmismatchns_r_nxrrsetpfcodenextrpclearfd__u_shortqclassexpireresolvesns_c_hs__ns_typedorequestsweeptime__u_longhoursns_c_inns_c_maxns_r_badtimefindhostns_c_noneexpiretimens_t_x25ns_t_eidns_c_anystrcatns_t_sinkns_t_soans_t_tkeyres_iplookupsuccessres_nextnsnscountparserespacketns_t_isdnns_c_2restellpassrpaddrpns_t_axfrraw_rawpingip_addrraw.craw_rawhosthavenamemsecLineCountLinessplit_keyactionsplit_redrawsplit_closenewLinesplit_opensplit.cdisplay_rawhostdisplay_keyactiondisplay_cleardisplay_redrawdisplay_rawpingdisplay.cdisplay_detectdisplay_opendisplay_loopdisplay_closexml_openreport_closecsv_openfmtinfoiiwidth_lencsv_closesnprint_addrlen_hostsreport.cnlenaddr2dst_lenlen_tmptxt_closexml_closeprint_mplsget_time_stringreport_openfoundtxt_opengetopt.cgetopt1.cdnsfdselect.cnetfdintervaltimereadfdselect_loopthistimeselecttimeipinfo_maxdnsintervallasttimeanysetNumPingdnsfd6ENTRYt_cpasn_openasn.ctrimsepiihashget_iiwidthsplit_txtrecipinfo_lookupitems_ais_printiireverse_host6items_tget_ipinfotxtlen__retvalfmt_ipinfobuffasn_closelookup_keyfound_itemFINDitemswwwUTQ !w!7w7¢wð¢£w£¤w¤©wð *U 'T'£S¤©S -Q-PU LRLPT 3X3PQ°±w±ÇwÇ2wð23w34w49wð°ºU°·T·3S49S°½Q½àU°ÜRÜàT°ÃXÃàQ@GwGæw æçw@VU@LTðôwôÿwÿwðøUðøT(w(RwðRXwXÑwð-USuU-T-:VSuTuÑV^uTuÑVÜàPàÑ^éíPí¤SñõPõÑ\-S‘¸¬Ñ‘¸àáwáâwâéwé;w0;>w>?w?@w@«w0«®w®¯w¯°wàíUí>S@®SàíT P@JP@®S°´w´êwêëwÈÏPÏÒRðôwôwwðUðT $w$8w8<w )U -T@AwAQwQ[w@HUHQSQZX`bwbdwdfwfhw hiw(irw0rvw8vQwÀQXw8XYw0Y[w([]w ]_w_awafw`qUqYV~‚P‚à]àçPç/]/6P6~](,P,˜]˜ŸPŸ]] $P$¾^prwrŽwŽ–w–šw šp wÐp w w w x wx z wz  w& C PC O TŸ £ P£ ? V? C PC ˜ VÇ Ë PË VO S PS ¨ V× Û PÛ 0 V_ c Pc ¸ Vç ë Pë x VX _ P_ Ÿ Võ ü Pü ˜ \˜ œ Pœ Ç V $ P$ O V¨ ¬ P¬ × V0 4 P4 _ V¸ ¼ P¼ ç V= D PD z \z ~ T€ ‚ w‚ ‰ w‰ ‹ w‹ w Ž w(Ž ’ w0’ › w8› §w€§¨w8¨©w0©«w(«­w ­¯w¯±w±¸w¸5w€€ ¶ U¶ ¨S²5S€ Ó TÓ ©V²5Vå é Pé M]²0]Í «\²Æ\ÆÎPÎ \ Y\'P'+\+0P05\Þ ú@ŸÞ ŸÞæ‘°}ŸæU\@BwBDwDEwEFw FJw(JñwÐñòw(òów óõwõ÷w÷wwÐQUPUóVøVX\P\‘S‘·\·ÂSÂË\ËÞSÞí\øS€•P³ÂPøPP $w$7w78w (U (T (Q@DwDWwWXw@HU@HT@HQ`dwdŒwŒw`hU‘w‘ÔwÔÕw˜U˜T˜ÔSàäwäw w 'wàôU$UàøT$T04w4DwDEw08U08TPuwuÞwÀÞãwPyUy¾SèìPìÍ]ÍâTó÷P÷.V.2P2ÃVðñwñõwõÆw0ÆÇwÇÈw07Pðôwô]w]bwP%8PEXPpqwqrwrywyåwÐåæwæçwçèwp†U†æSðñwñCwCDwðôUðøTÿ P CS P%4PPQwQœwœwPTUPXT_ePeœSww w `w `fwfgwgpwpw ,U,gVgkUlU<CsŸCRSRWsŸW\S­w­.wà.0w0q wàÎóPóýV/4P4ÇVÇÌSÌõ|€ŸõPH\]aPaËVÕïPï3\3RVRWSW€|€Ÿ€œPœÓ\èïPïV S F|€ŸFbPb™\®ÔPÔô\ôV?|€ŸTvPv¯\¯ÎPÎï\ï P 1\1»V»ÕPÕ/V/Æ|€ŸÛýPý6\6LVLQSQ˜|€Ÿ˜´P´ë\ # P# D \D c Pc o \v ® V® q |€ŸÎý0Ÿ/õ0ŸõDVRaVaË0ŸÕ3V3€0Ÿ€ÏVÝïVïF0ŸF•V£ÕVô?0ŸI©V¯ V1T0Ÿª/S/Æ0ŸÐ0V6˜0Ÿ˜çVõo Vv S® q 0ŸÎýž/ËžÕôžô a3q ž58v $ &2$p"8C v $ &2$p"ãóPóýV/4P4ÇVÇÌSÌõ|€ŸaËV3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVLQSQ˜|€Ÿv q |€Ÿ{ËPMÇVÇÌSÌõ|€ŸaËV3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVLQSQ˜|€Ÿv q |€Ÿ}œPïPq…P6JPdÇVÇÌSÌõ|€Ÿ3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVv q |€Ÿ£ÅP3PPôP1MP/FPÍ ý P  PG M PéëSëïUï3‘°ŸÎÐSÐÔUÔô‘°ŸÈÊSÊÎUÎï‘°Ÿ,S,1‘°Ÿ  S # U# D ‘°Ÿ] _ S_ c Uc o ‘°Ÿï Ü DŸÜ FŸ€ ‚ w‚ „ w„ † w† ˆ w ˆ ‰ w(‰ Š w0Š ‘ w8‘ wðŽw8Žw0‘w(‘“w “•w•—w—˜w˜wð€ ¬ U¬ ‘¬w± µ Pµ ‘¨wÀ L_Ld‘¤wd`‘¤w”1Ÿ  P û ]dv]è`]û ]8<P<<]vè]ö ú Pú `‘˜wû S"&P&ÕSvèS¤ ¨ T+ / P/ · SjnPnÚVvèVè`S¿ Á 0Ÿ^2<^Á V$ I p2$I ‰ V­ ± 0Ÿ± á Sê û SÁÜ0ŸÜòVV¿ Á 0Ÿ  \‰ û \Ì ý | $ &‘" PŸf ‰ | $ &‘" PŸ ¡w¡¢w¢¦w¦ªw ª«w«¬w¬­w'iPºÄ0ŸÄÎ1ŸÎØ2ŸØâ3Ÿâì4Ÿìö5Ÿö6Ÿ 7Ÿ 8Ÿ'50Ÿo0ŸP¬V«S°ÐU×èU°²0Ÿwww€w €wƒwƒˆwˆçw  U T !S 4P4Qðòwò÷w÷üwüþw þÿw(ÿw0w8DwÀDEw8EFw0FHw(HJw JLwLNwNPwP€wÀðUN_O€_ðTL^O€^PJ]O€]ªSªµVµ4S4=VO€SvzTµ\ÓÛPÛ=\O€\5>PjzP€‚w‚„w„…w…†w †w(àw° àáw(áâw âäwäæwæðwð=w° Ô?]ç]"8])•VÔ5Ÿ"=5ŸºÝP§¬0Ÿ!¶\ç80Ÿ¾! %AŸ¾!‘°Ÿí!‘°Ÿí!| $ &‘"  Ÿç NŸ &R"*NŸ*8R)„S„ˆT) 1AŸ)<U<E‘à~ŸERQR‘à~Ÿ@DwDWwW\w`dwdtwtyw€„w„w’wðy@ z@w z@Qz@w Qz@Rz@wRz@wz@w ðy@z@Uz@Cz@VRz@wz@Vðy@z@Tz@7z@SRz@wz@Sz@'z@P'z@Mz@\Mz@Rz@ ø†aRz@hz@Phz@wz@\€z@‚z@w‚z@ƒz@wƒz@„z@w„z@{@w {@{@w{@ {@w {@ {@w {@{@w €z@‹z@U‹z@{@S {@ {@P {@{@S€z@‹z@U‹z@åz@Såz@ {@P {@{@Sz@’z@\¥z@Äz@qv"ŸÄz@Éz@qv"ŸÉz@åz@Råz@ïz@rŸïz@úz@Rþz@{@rŸ {@{@R{@{@w{@{@w{@{@w{@¿{@w°¿{@À{@wÀ{@Á{@wÁ{@È{@wÈ{@,|@w°{@{@U{@À{@SÂ{@,|@S{@U{@TÂ{@Í{@TÍ{@Ñ{@U_{@Á{@VØ{@Þ{@PÞ{@,|@V7{@J{@1ŸÂ{@ñ{@1Ÿ7{@J{@TÂ{@Í{@TÍ{@Ñ{@U7{@@{@t”8$8%-Ÿ@{@J{@ t”8$8%Ÿh{@r{@P_{@Á{@V|@,|@V_{@Â{@ Ÿ|@,|@ Ÿ_{@¿{@W¿{@Â{@‘Ð{Ÿ|@,|@Wì{@ñ{@ ö%AŸ0|@5|@0ŸJ|@^|@0Ÿl|@‚|@T|@’|@w’|@”|@w”|@–|@w–|@˜|@w ˜|@Ÿ|@w(Ÿ|@¢|@w0¢|@©|@w8©|@m@wÀm@n@w8n@o@w0o@q@w(q@s@w s@u@wu@w@ww@x@wx@‹@wÀ‹@Œ@w8Œ@@w0@@w(@‘@w ‘@“@w“@•@w•@ @w @Q‚@wÀ|@©|@U©|@o@Vx@@V–@Q‚@V|@©|@T©|@n@Sx@Œ@S–@Q‚@S|@©|@0ŸÇ|@Ó|@PN@V@P)}@>}@0Ÿl}@ƒ}@]l}@ƒ}@ `aŸ¼@â@ *&AŸâ@‚@ &AŸ`‚@b‚@wb‚@c‚@wc‚@d‚@wd‚@k‚@w k‚@ô‚@w ô‚@õ‚@w õ‚@ö‚@wö‚@ø‚@wø‚@ù‚@wù‚@ƒ@w `‚@‚@U}‚@“‚@1Ÿ“‚@‚@S¢‚@Ù‚@Sù‚@ƒ@1Ÿ‚‚@³‚@P´‚@Ô‚@PÔ‚@Ø‚@Rù‚@ƒ@P¾‚@Ù‚@ h#AŸPB@RB@wRB@TB@wTB@VB@wVB@XB@w XB@YB@w(YB@ZB@w0ZB@aB@w8aB@”D@wДD@—D@w8—D@˜D@w0˜D@šD@w(šD@œD@w œD@žD@wžD@ D@w D@¨D@w¨D@ÅH@wÐPB@mB@UmB@ÅH@‘¼}PB@mB@TmB@ÅH@‘°}PB@ŽC@0ŸÈD@`E@‘€ŸE@ôG@‘€ŸôG@nH@0ŸnH@ H@‘€Ÿ H@ÅH@0ŸnB@zB@PôG@H@PŽC@ôG@‘¸nH@ H@‘¸ûC@D@PÈD@E@PjE@yE@P×E@òE@qE@E@q‚C@…C@P…C@œD@]¡D@ôG@]nH@ H@]‚C@ŽC@ ø†aŽC@bD@VbD@kD@SkD@xD@VxD@‡D@v‡D@D@SD@¡D@0Ÿ¡D@ôG@VnH@ H@VC@+C@r3$w"°C@VD@€Ÿ¡D@ôG@€ŸnH@ H@€Ÿ°C@VD@ à蟡D@ôG@ àèŸnH@ H@ àèŸD@.D@ ›&AŸbD@kD@0ŸkD@ˆD@VˆD@D@0ŸsF@‘F@_nH@‡H@_AF@sF@wsF@åF@^`G@¬G@^nH@‡H@^‘F@•F@P•F@ÛF@_`G@¬G@_‘F@•F@Q•F@+G@‘À}Ÿ+G@9G@Q9G@ôG@‘À}Ÿ‡H@ H@‘À}Ÿ“G@¬G@ ×&AŸG@5G@_‡H@ H@_åF@G@wG@`G@^¬G@ôG@^‡H@ H@^5G@9G@P9G@`G@_¬G@ôG@_5G@9G@Q9G@`G@‘À}Ÿ¬G@ôG@‘À}ŸÛG@ôG@ ×&AŸH@8H@ $AŸw,w,0w01w1@w@AwAKwU,S-1S;ASP Q;JP\dapŠUpwTw~t1&1Ÿp—U—™u~Ÿ™²UpŠ0Ÿ™¦Q¦©PÀÁwÁÄwÄîvîïwïôvÀ(U(ç\ïô\ÀèTèåSïôSÀQ.]À=RÒ”_Ò”  $ %1Ÿ~ ðäw ðïôw ð>äw ðŸïôw ðŸ>ç\ïô\>é]ïô]>åSïôS‹”_”œ1&1Ÿ‹äw ðŸïôw 🋩w 🩸^¸º~~Ÿºë^ïô^‹©0ŸºÇQÇÊP -U 1T`mU€ŒUÐÚUðúUU0:UPZUpzU—w—ÞwÞßwßêw UðúUU0:UPZU€ŠU ªUÀÊUàêU0Ÿ01w1IwI w  w ww  ®w®¦w¦²w¸Í0ŸÀÆwÆww¢w¢£wÀËUËS¢SÀë0ŸŒ0Ÿ6X  ,AŸ°´w´ w w $ w$ % w` a wa d wd m wm ² w ² ³ w³ ´ w´ µ w` m 0Ÿ• ´ VÀ Á wÁ ë wë ì wÀ Ø UØ à Sð w Uð " T€ w ¨ w¨ © w€ ¤ U‡ ¤ ôƒa¤ ¨ S¨ © P° Ï U° À TÀ Þ Tà î wî / w / 0 w0 Z w Z ` w` | w | wà  U0 3 U[ s Us € txŸà ý Tý + S0 Q S[ x Sx € Qà  Q & V0 7 Q7 V V[ n Q0 3 U[ s Us € txŸ © Uª ¹ U © Tª ¹ T ¥ Qª µ Q  © T  © UÀ  wÂ Ä wÄ Æ wÆ È w È Ì w(Ì Í w0Í Ñ w8Ñ N wÐN R w8R S w0S U w(U W w W Y wY [ w[ \ wÀ ø 0ŸÀ ø 0Ÿ  \ ‘ w‘ › w› w° ž wž   w  /w° ² U² ž SŸ /Sh Ÿ ‘Ü~ ‘Ü~02w27w79w9;w ;<w(<=w0=Aw8Aˆwˆ‰w8‰Šw0ŠŒw(ŒŽw Žw’w’˜w˜˜w0QUQj_““_0jTàô q@‡a"ôj‘Œ““‘Œ j\““\ñ rô‡‰".ñ rˆ‰"Wj\“¼\Wj‘Œ“¼‘ŒWiP“­P ¢w¢«w«¯w¯°w °·w(·BwÐBCw(CDw DFwFHwHPwPÀwР½U½õ\õùUI»\ê÷P÷CSIÀSêð]ðùTùH]»À]`I‘¼}¿W‘¼}p¢‘¼}»À‘¼}æð]ðùTùH]»À]Øù‘Â}Š—PÀÂwÂÄwÄÆwÆÊw ÊËw(ËÒw0ÒÙwÀ#ÙÚw0ÚÛw(ÛÝw ÝßwßáwáèwèñwÀ#ÀGUGh\âE\‘Ý\Œ”U”Ø\Ýñ\ò»‘Ð\ŸâŒSšÐSÐØ‘Ð\ŸÝñSò=0Ÿ‘60Ÿ6À]šØ0ŸÝñ0Ÿò=0Ÿ=»]â‘]‘ž0Ÿž']'Ò0ŸÒŒ]šØ0ŸÝñ0Ÿòh0ŸâE0Ÿ‘ð0Ÿð0PšØ0ŸÝñ0Ÿª¾P…ˆPuŒP Œ‘È\šñ‘È\ò–0Ÿ–"DŸ"»^âŒ^šØ0ŸÝñ0Ÿò0Ÿ"8Ÿ"=Q‘©Q'JQšØ0ŸÝñ0Ÿò0Ÿ"@Ÿ"»VâŒVšØ0ŸÝñ0ŸŒ‘Ì\šñ‘Ì\.VQ.w‘Ð\Ÿ–»‘Ð\ŸâŒSšÐSÝñS]pq1&1Ÿ]‘S]pSpwPwyp~Ÿy€P]p0Ÿy…RÈÓPÓø}ìñQèìQìñ}'P'}e|@ß”~Ÿ|ƒp1&1ŸeÀ]e’]’ŸPŸ¡p~Ÿ¡¨Pe’0Ÿ¡­Qwwww  w(  w0 w8 wÐ  w8  w0 w(w ww w 9wÐ9?w8?@w0@Bw(BDw DFwFHwHIwI wÐx0Ÿ°ÇSI 0ŸpxPxÇV ¡w¡HwHMwMowotw ®U®HSMoS ®0Ÿ€ÄTg *!T€g Q€_ R_ g pxŸg !}wŸ’F tp"”4&8$8&Ÿ’F tp"”?8$8%pt"#”8$8&"Ÿ¸F "pt"#”8$8&8$pt"#”8$8&"Ÿô_ R_ g pxŸg !}wŸôg Qô!Tô!U; g 0Ÿg ’ Xœ !X / X/ 3 xŸ F pt"# F pt"#F \ Y0!R!wR!:"w &:"@"w@"Â%w &¡!¦"‘ÜZÀ"Ù"‘ÜZð"Â%‘ÜZÀ!ô!P;"x"P‡"¦"P#4#Pù#U$P}$·$P½$÷$Pý$7%P=%w%P}%·%Pr!×!0Ÿ×!ô!^;"M"0ŸM"X"‘àZŸX"‡"^‡"#0Ÿ#+$^+$V$‘[ŸV$‰%^‰%–%‘[Ÿ–%½%^r!ô!0Ÿ;"4#0Ÿ4#?#Sù#‰$0Ÿ‰$–$‘[Ÿ–$½$S½$ %0Ÿ %%‘[Ÿ%=%S=%½%0Ÿr!ô!0Ÿ;"x"0Ÿx"‡"S‡"?#0Ÿù#É$0ŸÉ$Ö$‘[ŸÖ$ý$Sý$I%0ŸI%V%‘[ŸV%}%S}%½%0Ÿr!¡!0Ÿ¡!#"\;"¦"\¦"À"0ŸÀ"Ù"‘è}ŸÙ"ð"0Ÿð"#‘ä}Ÿ#Â%\r!¡!0Ÿ¡!+"];"¦"]¦"À"0ŸÀ"Ù"ŸÙ"#0Ÿ#Â%]r!¡!0Ÿ¡!ô!S;"o"S‡"¦"S¦"À"0ŸÀ"Ù"3ŸÙ"ð"0Ÿð"#;Ÿ#+#Sù#e$Sý$%S=%V%S}%½%Sr!¡!0Ÿ¡!"V;"¦"V¦"À"0ŸÀ"Ù"1ŸÙ"ð"0Ÿð"#3Ÿ#Â%Vr!ô!0Ÿ;"‚"0Ÿ‚"‡"U‡"?#0Ÿ?#ó#Uù#x$0Ÿx$}$U}$½%0Ÿ¡!¦"‘ÜZŸ#Â%‘ÜZŸ¡!¦"‘à}Ÿ#Â%‘à}Ÿ¡!¦"0Ÿ#Â%0Ÿ¡!¦" vŸ#Â% vŸ¡!¦"‘àZŸ#Â%‘àZŸ¡!¿! hé"‡"Ux"‡"s<#?#U4#?#sÐ%Û%0Ÿâ%&p&&pX&&w&&w&&w&&w & &w( &,&w0,&â'wâ'ã'w0ã'ä'w(ä'æ'w æ'è'wè'ê'wê'ë'wë'ð'w&1&U1&ê'^ë'ð'^b&d&0Ÿ&ž&\Ã'æ'\ë'ð'\d&ž&V &È&sÈ&ä'Vë'ð'VÉ&Ò&Pb&è']ë'ð']d&‰&sp @Bsx"Ÿñ&þ&sp @Bsx"Ÿð'ñ'wñ'ÿ'wÿ'c(w°c(d(wd(e(ww!w!"w"SwU !S"SSP pŸ &PuŸ!sŸ"SsŸ`dwd‰w‰w”w”•w•Õw`…U…uŸŽ«UµËUàwÔw0ÔØwØ£w0àüUüÐ]ÐÕPÕ£]à¦TÕæT}”T urŸ GUGiXÕæUG¹Sæ£Si¹Væ£V޹\æ£\˜›qrŸ›¦Q}QXø œ9AŸø}p"ŸU(M —9AŸ(C}p"ŸCGUX} ’9AŸXs}p"ŸswU@KUPYUYgTpuUuPp{T{QpxQxU€„U°±w±²w²¶w¶Äw0ÄÅwÅÆwÆÐwÐw0wwwÁw0Z‘\zÁ‘\2Ÿ ÀõŸ º9AŸ£:Ÿ£ 0:’Ÿ£ Ä9AŸBJ À-AŸpz .AŸ†Ž P.AŸÐÔwÔ*w*0w0:w:@w@ØwäP­TðU?UðU0Ÿð0Ÿq2$=A"=Yð0Ÿ",Q,/X6=P@ZUZquŸq|U@I0Ÿ]gQgmTqzP•Ÿt3$àõ"Ÿ&P&?t3$àõ" ¢w¢§w§¬w¬­w ­®w(®n w0n o w(o q w q { w{ } w} € w€ ± w0 »U¾ýUý{ ]{ } ~3$à>“"~ ± ]óý~3$à>“"ýn S~ ± S²¾uȾÈRÈàrŸàëR²¾0ŸÍàPàë^À Ç UÇ / Y0 M YÏ Ó yÈÓ â Râ ù rŸù / R0 M RÏ Ó 0Ÿå ï Pï õ Xù  TP R wR T wT X wX ] w ] d w(d  w0  w(  w   w  w w U w0P ` U`  \  }3$à>’" U \t ~ p3$à>’"~  S U St ~ P~  ] U ]` a wa – w–   w  ¾ w` h Uh – S— ¾ Sm { P— ¾ PÓ = P‡  P  ¡ w¡ Ä wÄ Ð wÐ Ñ wÑ Ò w  ¨ U¨ Ä SÄ È UÉ Ñ Sà ö Uø MUñ ø r3$àõ"ø JPKMr3$àõ"PRwRWwW[w[\w \`w(`w0w(w www"w0P®U®\"\§®}3$à>“"®S Sœ]"]PmUmzRz‘rŸ‘œRPm0Ÿ}‡P‡T‘œ]02w23w37w7Åw ÅÆwÆÈwÈÉwÉÍw 0;U;ÆVÉÍVGNp3$à>’"NÁSÉËSGNPNÈ\ÉÍ\ÐÔwÔðwðõwÐßUwwww w(&w0&õwàõöw0ö÷w(÷ùw ùûwûýwýwdwàU_Q T _XQlÛ]þN]f…P…¾\¾Û^þ)^)_\y…0Ÿ¢ªVª¾0ŸÌÛPptwt~w~€w€œwœ¡wpzUˆUˆU°¶w¶âwâèwèww°ÖUÖâSãS°ÖTãS <aMea8MUeqU8<a€‚w‚‡w‡ŒwŒw ˜w(˜ów0óôw(ôõw õ÷w÷ùwùúw€˜U€˜T˜ù]€˜T˜¼V¼×Uרv|ŸØõV€˜?Ÿ¤¼V¼×U×õv|Ÿ*w*>w >HwHÏw ÏÐwÐUw U`w`–w –›w›w 2U2 SC¡SÐ$SZS‘˜¾S¾Å‘˜ÅÏSÏ‘˜HTHúVC¡VÐÚTÚ$VZÝVAHTHúVC¡VÚ$VZÝVA SC¡SÚ$SZS‘˜¾S¾Å‘˜ÅÏSÏ‘˜OgPg \C¡\Ú$\Z\‘°¾\¾Å‘°ÅÏ\Ï‘°²ú v $ &s"ŸC¡ v $ &s"Ÿ $ v $ &s"ŸjÝ v $ &s"Ÿ² s ŸC¡s Ÿ $s Ÿjös ŸöVvŸ~~Ÿ´V´À^œ^œ¯~Ÿ¯É~ŸÉÔ~ŸÔŒVI¾s Ÿÿ V»V»ÅvvŸÏÙVrV›ÔV0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿç64p8$8%H$q8$8%@$!v|”8$8%8$!v}”8$8%! $ &Ÿÿ 0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿ#0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &ŸÏÙ0p8$8%H$q8$8%@$!r8$8%8$!t8$8%! $ &Ÿ^nPn ^Ýú^çòPòªSz”P”Sˆ¾^¾àPàÿS P»ÅSÙSÊÔPÔSJpp $0)Ÿpyz $0)Ÿäèps ”"ŸèP´‘¢´À‘¢”1ŸÀ‘¢¾‘¢Fvv”8$8%8$u!Ÿ¯ç~”8$8%8$~”8$8%!Ÿçlvv”8$8%8$vw”8$8%!Ÿÿs8$8%8$u8$8%!Ÿ s8$8%8$~”8$8%!ŸTs8$8%8$u8$8%!ŸTZs8$8%8$vw”8$8%!ŸÏÔs8$8%8$u8$8%!ŸÔÙs8$8%8$vw”8$8%!ŸFXÉQXVlXÿ X@X@»^ÏÙXkQkI‘¦¾‘¦*I‘¤¾‘¤‚ÚPC]P]tXtŽsÚúP PZyP|ÄPÄÈs_ÚsCŽsÚús sZys|Ès†ÚQC~Q~ŽsÚúQ QZyQ|™Q™Ès†ÚsCŽsÚús sZys|Ès’ÚRCyRyŽsÚúR RZyR|–R–Ès’ÚsCŽsÚús sZys|Ès–ÚTCƒTƒŽs ÚúT TZyT|“T“Ès –Ús CŽs Úús s Zys |Ès Õ  81AŸÕ  @ŸÕ  ö‘Ÿj¡  6AŸj¡ @Ÿj¡ ö‘ŸÝ P0AŸÝ @ŸÝ ö‘ŸR à1AŸR @ŸR ö‘Ÿ­Ü h2AŸ­Ü @Ÿ­Ü ö‘Ÿ… x5AŸ… @Ÿ… ö‘ŸGV ¸5AŸGV @ŸGV ö‘ŸN‰ 83AŸN‰ @ŸN‰ ö‘Ÿv« B:AŸv« @Ÿv« ö‘ŸãN €4AŸãN @ŸãN ö‘Ÿ,PN ö‘ŸIˆ :AŸIˆ À:’Ÿˆ¾ €1AŸˆ¾ @Ÿˆ¾ ö‘Ÿ¾ÿ 05AŸ¾ÿ @Ÿ¾ÿ ö‘Ÿ6» :AŸ6» @Ÿ6» ö‘Ÿ‚» 0:AŸ‚» @Ÿ‚» ö‘ŸÙò `ïŸÙò À:’Ÿ.› °4AŸ.› @Ÿ.› ö‘Ÿ›Ê 84AŸ›Ê @Ÿ›Ê ö‘Ÿw-w-3w3Úw ÚÛwÛåwåðwð¡ w ¡ ¢ w¢ ¤ w¤ ® w=\P\å\åéTê¤ \e|0Ÿ¥­SÕÚSê 0Ÿ8 D S7 „a7 6’l n P6AŸl n  @Ÿl n ö‘Ÿ° ² w² Í wÍ Ó wÓ t!w t!u!wu!!w!ˆ!wˆ!"w ""w""w""w"*"w Ý !P!!\!ƒ!T„!"\"*"\ !!0Ÿ7!;!Sk!t!S„!Ž!0Ÿ™!!S"*"S° × „a° × àõ‘0"1"w1"8"w8"J"w J"K"wK"P"wP"´"w ´"º"wº"À"wÀ"9#w 0"A"UA"K"SL"º"S¿"9#S0"F"TL"d"T¿"É"TÐ"Ü"Tù"#TL"•"<Ÿ¿"Ð"<Ÿù"9#<ŸL"•"S¿"Ð"Sù"9#Sí"ù" ˆ6AŸí"ù" @Ÿí"ù" ö‘Ÿ@#B#wB#D#wD#F#wF#J#w J#K#w(K#O#w0O#\$wà\$`$w0`$a$w(a$c$w c$e$we$g$wg$p$wp$D%wàD%E%w0E%F%w(F%H%w H%J%wJ%L%wL%M%w@#ƒ#Uƒ#c$\c$k$Ul$H%\V#ƒ# Øßƒ#ö#Sö#$V$6$S6$X$Vl$@%S#´#s´#X$Vl$@%Vé$@% ð6AŸé$@% @Ÿé$@% ö‘ŸP%R%wR%V%wV%W%wW%½%w ½%¾%w¾%À%wÀ%Å%wP%Z%UZ%½%S½%Ä%UP%Z%TZ%À%\À%Ä%TÐ%æ%wæ%6&w06&@&w@&m'w0Ð%ê%Uê%2&\7&m'\ñ%û%Pû%(&S7&ô&Sô&'P'm'S]&„& 8AŸ]&„& @Ÿ]&„& ö‘Ÿ™&Ë& Ð7AŸ™&Ë& @Ÿ™&Ë& ö‘Ÿp't'wt'Ÿ'wŸ' 'wp'„'U…'›'P '·'U '¤'T¤'·'Q '³'0Ÿw^w ^hwh›w !U!PSc›S0T0UVclTl›Vu‹P‹˜R0c ‰=AŸ ¡w¡ÂwÂÎw ¦U¦ÂS ªTwwww  w( w0 w8:w :;w8;<w0<>w(>@w @BwBDwDHwH¥w 26P6@]E¥]b{0ŸruVu…^ V ^{Ä_ ¤P¤·_E _26 à>”6QSQUQUVsŸV{S6b ›=AŸŽšPš^^E~^~‚Yƒˆ‘°}Ÿˆ—P—›^› Pë^ ¦=AŸë^ Ÿë^‘°{ŸPˆ  =AŸPˆ ŸPˆ‘°}Ÿ· ‚=AŸº¿0Ÿðøwø(w()wÿP(Sw%w%&wUT04w4AwAHwH\w\hwhlwlxwxw˜w˜œwœ¨w¨¬w¬¸w¸¼w¼ÈwÈÌwÌÑwàäwäñwñøwø w ww(w(=w=HwHLwLXwX\w\hwhlwlxwx|w|wàU U!8UBPUQ`UapUq€U$U$T0DU0DTwqw0qxwxèw0'U'cSrèS$T$hVrèV”¦P¦è\ðñwñ÷w÷w #w#$w P $‘hP#S#$P04w4LwLQw`bwbgwghwhiw imw(m½w0½¾w(¾¿w ¿ÁwÁÃwÃÄw`|U|Ã]`|0Ÿ¯¹\|¹ x?AŸÐÒwÒÔwÔÖwÖØw ØÙw(ÙÚw0Úáw8á¹w€ ¹ºw8º»w0»½w(½¿w ¿ÁwÁÃwÃÄwÄÞw€ ÔÙ0Ÿ“š0ŸêPšäSüp2$_S~‹P‹—pŸ—œ‘¨v”1Ÿˆ›‘¨vg}P}«Sy}P}I‘¼v^bPb«VÙÞ‘¼vS\SÜI]"<]ÉÍPÍ›‘°vÄI‘°v˜œPœ›V"IV·»P»šSÄ"S„ŽPúœ0Ÿ‚†P†›_"I_IÙ0ŸúÔ0ŸÔœ\“m]IÙ0Ÿú !Ÿ I‘¬vIW!ŸW[P[}‘¬v}«\«²Y²Â‘¬vÂÙSÙÞ‘¬v 8‘¬v8`Y«²Y²É‘¬vÉÔYÔÙp~Ÿ8I K>AŸÙÞ K>AŸ8I@ŸÙÞ@Ÿ8I‘ ŸÙÞ‘ ŸaI‘ ŸÙÞ‘ ŸaI ŸÙÞ ŸaÁ^ÁÄ‘ÀvŸÄI^ÙÞ^îW %AŸîW@ŸîW‘ Ÿ#W‘ Ÿ#W Ÿ#W| $ &‘" ÀŸàH X>AŸàH@ŸàH‘ Ÿ4H‘ Ÿ4H Ÿ4H^¤Õ Ÿ¤Õ} $ &‘" ÀŸ?_ Ÿ?_} $ &‘" ÀŸ˜›0Ÿ"I0Ÿ"I z>AŸ"/ z>AŸÄ" i>AŸÄ"@ŸÄ"‘ Ÿ "‘ Ÿ " Ÿ "^«Pw#w#%w%'w '(w(()w0)-w8-% w % & w8& ' w0' ) w() + w + - w- / w/ 0 w0 s w   0ŸO PÊÐPÐ V U ú Vú  \ÀÄPÄ+ ]n s ]àêPn ¢>AŸ¡ ¿>AŸ¡0 ì>AŸn s ì>AŸë ø>AŸ 4 WË ð W 4 W| ð W 4 ?AŸ ð ?AŸ 4 W ð W0 X ¬>AŸX n Ò>AŸ ’ w’ ” w” – w– ˜ w ˜ ™ w(™ š w0š ¡ w8¡ a wàa b w8b c w0c e w(e g w g i wi k wk p wp ² wà Ú UÚ ² ‘Ø~´ ¾ 0Ÿ‡ ‘ 0ŸÔ Ú q2$Ú Ó SÓ Ú p2$Ú b Sl ² Sã õ PÞ â Pâ k _l ² _  P y ^l š ^ ! P! 4 Ql Q § ‘°~5 E PF v Pv † ‘°~y ‡ 0?AŸ› » g?AŸ - n?AŸš ­ M?AŸwww w w(w0w8w w8 !w0!#w(#%w %'w')w)0w0’wE0ŸE=VTm0Ÿm¢VdV*CVH·Vïù1Ÿù%V%91Ÿ9]VbrVšVŸªVÊÖVÛçVV;FVkxV}’VÛ}_¢d_ÌØPØ_HÔ_ù_9_à%P%,pŸs‚P‚ŠRŠ‘ø|Š’‘ø|8E0ŸE#\*’\8E0ŸEk‘ü|k}0Ÿ}’‘ü|Y^P^|R&PL_Pwwww `w°`aw abwbdwdhwh>w°%U%fVeŽVá V^’‘ÜzŸ’¬vŸ¬ÕVÕëvŸëüvŸü(v Ÿ(Bv ŸŽ©v Ÿ©¾vŸ¾Ï‘ÜzŸÏávŸ (v Ÿ(9V(BS£§P§©SV„PesP…–PÈÙP¾ÇP(1Pü(RŽœR  RüQB\Ž©\  Q’¬v”8$8%8$v”8$8%!Ÿ¬Çv|”8$8%8$v}”8$8%!ŸÕ(v”8$8%8$v”8$8%!ŸŽœv”8$8%8$v”8$8%!Ÿ©¹PÏÙP  v”8$8%8$v”8$8%!Ÿ’¬V¬Õv|Ÿ©¾V(9v|ŸÕBVŽ©VÏáV (VëBvŸŽ©vŸ (vŸwŽ4ŸŒP ( Ð@AŸ@AwA›w›œwœ²w@eUœ¥UjmpŸ@KUK›S›œPœ¥U¥²SÀÂwÂÄwÄÅwÅÉw ÉÍw(ͬw0¬­w(­®w ®°w°²w²¸w¸òw0òów(óôw ôöwöøwøww0ÀëUëùV³½U½áVUùýPý3V36P6®VáîVùVýPpŸ;|ŸNbPb°\áî\ùPùý0Ÿý­SáîSùSYbSbP "w"'w'+w+/w /5w(5Šw0Š‹w(‹Œw ŒŽwŽw‘w 5U5Ž\ 5T5] 57Ÿ 5T5ZVrŒV>ZVZqUqŒv|Ÿ ¢w¢£w£¤w¤«w «áwàáâw âãwãåwåðwð•wà ëUæU‚U[i0Ÿ’P’¶V.h0Ÿhtq3$p"t‚p“µP““µ¶‘À}““<‚S““i ›@AŸiŸiS,i §@AŸ,iŸ,i‘Ð~Ÿ< ‚@AŸ<Ÿ<\PdPàáwáåwå–w0–—w— w ½w0àùU P—S˜¤P¤½S:˜ `>AŸ¸½ `>AŸ:˜8Ÿ¸½8Ÿ:OUO^‘`Ÿ^|X|˜‘`Ÿ¸½‘`ŸP^‘`Ÿ^|X|˜‘`Ÿ¸½‘`ŸP˜ Ÿ¸½ ŸP˜  ?•Ÿ¸½  ?•Ÿàäwäwwww $w$CwCDwWpsxçãó0;ãó0;MZhsx{MZhsx{Ûàëð»ÀÃÈÐÕµº½ÂÊÏõ÷ú      $ J M P W _ j Ð Ô Ü è ë ð ø ý _ c n z } ÀÍÑÝáíòùüð"8!&)=æ{@é{@ì{@ñ{@ñ{@|@|@"|@%|@,|@ }@³}@¸}@º}@@@@#@˜C@¢C@°C@µC@;F@>F@AF@®F@`G@¬G@nH@‡H@;F@>F@AF@®F@`G@¬G@nH@‡H@‚F@ŽF@‘F@–F@‰G@G@“G@¬G@ßF@âF@åF@NG@¬G@ôG@‡H@ H@ßF@âF@åF@NG@¬G@ôG@‡H@ H@&G@2G@5G@:G@ÑG@ØG@ÛG@ôG@ðy@ƒ@PB@ÅH@‹¢¤Ñ‹¢¤Ñ,9W^˜¡¨µ,9W^˜¡¨µØÞáæ:GRWÐÒÙÝQV]fhmp‡QV]fhmp‡uˆŠ˜¯uˆŠ˜¯ñ'ø' ((.58KØðý J]pzŽ¡·Á¢¥²ë¢¥²ëÇ Ì Ï  Ç Ì Ï  RU`œRU`œ€˜œ¡è è 8Phj¤¸ÃÇÍØAH¡à'Uh–AH¡à'Uh–cgos‚gkswkow{{†Š™£®ÉªGVmsv‘ÚàãþUZ`o|ˆ&+.N,-238| ‚ …   ² Ì Í Ò Ó Ø Ü!â!å!"P"°"´"¹"º"Ð"#9#Œ"’"•"°" ####%#*#-#9#í$ %%1%T&Z&]&x&&–&™&¸&z‹”›@NQV€^­ÀH ï !*8ACJP^­À^fin0\xè9HLQ„žª¯8W\aW\aˆðþ##*-58PÕÚà04H¨¬¯»¾ÈÐÕ59B`pP"<ì "!-4DIÖÛë  ' / 4 4 8 Ë ã _ d l o ‡ 2 9 ; J ý ‡ ˜ > p ­ J v y ‡ Ÿ ® ¶ » p — š ­ Y\xz|‹’ëó÷ü>R]agrÖëíóö[Öæèëðó#õý)<FKtú  ¸"'-6:P.symtab.strtab.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment.debug_aranges.debug_info.debug_abbrev.debug_line.debug_str.debug_loc.debug_ranges8@8#T@T 1t@t$Döÿÿo˜@˜\N ø@øðVè@è ^ÿÿÿoü!@ü!”kþÿÿo#@#°z@$@@$¨„è$@è$ˆ Žp6@p6‰6@6À ”PB@PB(µšx÷@x÷  ÷@ ÷`I ¨AAAܶàFAàF´Àˆmaˆmǘma˜mΨma¨mÓ°ma°m0Üàoaàoáèoaèoðêàuaàu  ð†aì…@º3 õ0ì…*þ†  6ˆN—¢"'ð¹Ð?30ÀùÇE>‡?DIËVp;qWØ{(8$h ´!8@T@t@˜@ø@è@ü!@#@ @$@ è$@ p6@ 6@ PB@x÷@ ÷@AAàFAˆma˜ma¨ma°maàoaèoaàua†a ! ôH@ñÿˆma*˜ma8¨maE I@[8†aj@†ax €I@ñÿ„ma‘bAŸ¨ma« @÷@ÁñÿÇ ðy@‡×ø†aÝ {@ìÀaþ‡a  ‡a `+A+e+ADñÿJX†aVx†ae`†arH†avL†ah†a‡p†a“P†a va ©ñÿ²€†a¿„†aƈ†aΠ†a Ô@"A@Üñÿâ ƒ@Köðƒaÿ@‡‰XHß @‡a(Pßôƒa/@ß:DßAøƒaLñÿRàß._=A$j à.w@=A$‚ñÿˆ`à‘ñÿ™ñÿ£ñÿ¬ ðÙ@èÅñÿÎñÿØñÿápäîñÿôèoa „ma„ma.°ma7؆aH Û@!T àua_ ÀÐ@uk ðY@ÔvÈ…a‚‰œ a „a¦̆a± Ы@uº ð½@zÇ ?• Ïã  ‡@ì à®@ö €®@-þ „a#1Ð…a9`éC ˆ@Q Ô@¥^r† ä“· 0÷@ÇÝ …a åöÔ†aÿ†a 0õ@Ý  ÈH@' ë1H p»@dRdé`0ëj} ÐI@‰ ðJ@§hé¦ @Ù@¶ ˆ@Æ@ëÑ×ê 0·@¦ °y@0 P`@9 ÀŽ@œAW؃af‚ {aÀŽȆa’­ `Ù@½„aÅléÔ€é.ÞùHï ) =O 0Œ@Z M@Ðh`ïs Àš@1‚À„a ´@­Á `@MÙëþ ð®@ %?@„a(GNg™˜ß¦¯¤ä»x÷@Á €…@PÊ °Î@ Õ ÀØ@5äù  N@"  ð†@  ðô@2  0¤@’/  p‡@ 7 D a h Øßw  à`@á Œ   ³ Ò  `Œ@Uå  ½@hì  Ðá@õ °éÿ  \@“ €ä 1   _@T? ÀßG  à·@ÖW [ à†ad  ðŒ@ˆr  `N@;‡ è†a” ¦ œa² Ê pßÖ ê  |@Áô û  Ø@¡  0µ@ .  ÐÓ@.: M  pö@$W  ÐÙ@e  À‡@q y À†a|  `‚@ Ž a• ž ¸ €ó8¾ Ó ç  P¬@Ãð  ß  ÷@ Àõ ´é%   ]@Ø. ¸é=  R@L ` v “ ¦ ½  Ðt@½Ï  0×@&Þ ô  ñ@U   ^@r # ¤a, >  €Ê@žG èƒaL `  â@cj †a~ — àua¤  ÀŒ@,²  Ш@?¾  ^@Ì à  °I@í  €‡@ú  Ù@5 (C PÛ@dNð†a[tŒ ¯@˜ °@0¨¸ß®Ç àá@Ñæ …@  Àµ@”a  @Œ@0àõ7 P®@+=ЃaL†a_ [@Gm @[@E~‡ ðÖ@9—àõ‘³Ç¬aÓ °‹@uÝö‘@èІa¨a' ðª@u7 @…@@ P‡@J Ž@*R pƒ@B[Àƒa`Èßj Ðk@{ _@x‹ P²@ •®¿Ôê ðp@ ø„aý„aà>” èua ÐZ@(5K^Œai pä@r¼é| @»@%„˜`a(£ †@Z­¶ àÚ@4Æ maÓì  ö@‰ü €@) 3Àé= †aQ à¼@1Xoˆ¬  ‰@¶ 0|@]Çí Pr@çü ð²@¿"1G ö@R ¹@2`  —@ m€è…aŠ Ó@”®Ñ ðá@Ú @Ÿãöä Àƒ@4# €¢@ª.J`ßUj~ ¯@‰ P†@‘à逧À `J@‰Ð× 0‡@àô [@-ý  Í@  "86’? 0ˆ@ìK_ ÀŠ@ãxÀä‚ Àè²ÀÓãùñÿì…a"9  @ H Ì@zP @Ñ@\ 6’g°ßk† ð…@Ÿ„a§à耵 °Ö@&ÀÜ °æ@’è?•ô 0Ó@› `²@O1 `…@; À¹@ÒD?”Jd ж@^t ðN@„0:’Ðß›· O@Ä`…a8Òå ð@ríú`ê p†@"6TfyŒ ½@Q“§  º@® 0W@µ¾Û €z@àû €^@0CUt 0ö@>}‘ àÒ@0œ°hß½hêËì†aÕ @s@æ pò@qôñÿ@@•ù $: À¸@IG\ Ðy@m€ß{ ÀÛ@ˆ€ê€ž@:’€¬Â àÖ@Î ©@àÞ à[@îä…aù p¾@  ®@)#-Ća8˜a@@?•€G °³@VWq Pî@>  K@Ž …@˜ ‰@v©Æ `@%Îé(†aý €Ù@B  < y@Ldȃai €ä@"s€„a0~’»Ïˆßâþ °®@ ' °K@Ñ>R †@[rë€À?•€ˆœ® @±@»ñÿì…aÂܨßð ðZ@ý 0†@ ÐN@* p«@S5À:’AU à@¡axßlŠ 0‘@h›à>’¢µÎã`äò  ¯@À…a P¹@m!(: à‡@A `×@¡N Pƒ@]t À®@~‘°Ð  ¡@ÔÛ à>“  °²@<  ‡@# àƒa( < 0†aP i r  Ð…@{   PB@u’ ßž  p6@¤ ¸ ëÆ  ðò@õÑ  r@Fâ ó  !ˆacall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.6458dtor_idx.6460frame_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxmtr.cappend_to_namesnamesread_from_filelong_options.6409lock.6383lock.6391__PRETTY_FUNCTION__.6384__PRETTY_FUNCTION__.6392gtk.cmain_windowReportTreeViewPause_Buttontagdone.49413EntryReportStorepaused.49430mtr_iconcurses.c__unused_intlow_mshigh_msscalefactorsnet.cset_fd_flags.part.0numhostshostbatch_atsequenceresetnext_sequence.7128packetsizeBSDfixfirst.7176dns.caddrstr.6338CSWTCH.133addrstr.6595CSWTCH.147raw.chavenamesplit.cdisplay.creport.csnprint_addr.constprop.0getopt.cgetopt1.cselect.cintervaltimeasn.c_GLOBAL_OFFSET_TABLE___init_array_end__init_array_start_DYNAMICInterfaceAddressreport_opendata_startsendrequestgtk_redrawiiwidth_leng_freectime@@GLIBC_2.2.5dnsfrom6bitpatternstatfreeaddr2ip6arpafmtinfofileno@@GLIBC_2.2.5net_xmitlongipstrclearfdgtk_tree_model_get_iter_firstidseedgtk_entry_newiiwidthsendsock6net_localaddrsplit_redrawmemset@@GLIBC_2.2.5getgid@@GLIBC_2.2.5display_modegtk_scrolled_window_set_shadow_type__libc_csu_finisnprintf@@GLIBC_2.2.5opcodesgtk_box_get_typeshow_ipsstdscrgtk_window_newfmt_ipinfo_startsweeptimeinet_pton@@GLIBC_2.2.5dorequestsendsock6_udpalignedipclose@@GLIBC_2.2.5percent_formatterAbout_clickedrecvsockdisplay_rawpingnet_end_transitresrecvbufwmoveioctl@@GLIBC_2.2.5gtk_menu_shell_appendabort@@GLIBC_2.2.5linkresolvemtr_curses_closepwcenternet_maxg_io_channel_unix_newsourcesockaddr__res_nmkquery@@GLIBC_2.2.5data_fieldstos__fprintf_chk@@GLIBC_2.3.4display_rawhostuse_dnssendsock4_icmplocaladdrgethostbyname@@GLIBC_2.2.5gtk_cell_renderer_text_newaseed__gmon_start___Jv_RegisterClassesputs@@GLIBC_2.2.5net_waitfdHost_activatenamestringnet_send_queryresourcetypesgtk_vbox_newlinkresolvehostselect@@GLIBC_2.2.5NewDestination_activateexit@@GLIBC_2.2.5gtk_entry_set_textdns_forward__assert_fail@@GLIBC_2.2.5__printf_chk@@GLIBC_2.3.4rrtypesendwingetaddrinfo@@GLIBC_2.2.5strcasecmp@@GLIBC_2.2.5gettimeofday@@GLIBC_2.2.5res_nxdomaingtk_mainDisplayMode_fininet_lossdns_eventsdisplay_redrawputchar@@GLIBC_2.2.5gtk_do_initnet_jitterget_iiwidthnet_process_returnnet_mingtk_menu_newgtk_button_new_with_mnemonicprintwexpireresolvesmtr_curses_keyactionmalloc@@GLIBC_2.2.5fopen@@GLIBC_2.2.5__libc_start_main@@GLIBC_2.2.5net_save_incrementpassrptxt_openrecvsock4Window_filliihashgtk_scrolled_window_set_policyCopy_activatelastloglastlinkresolverawHostnamesave_sequencegtk_add_ping_timeoutForceMaxPinggtk_menu_get_typecpacketsizesetsockopt@@GLIBC_2.2.5res_timeoutgetpid@@GLIBC_2.2.5parse_argwerasedisplay_closeunlinkresolvehostgtk_entry_get_textraw_rawhostfgets@@GLIBC_2.2.5asn_closedisplay_clearnet_transitinitscrafparse_mtr_optionsmaxTTLmvprintw__strcat_chk@@GLIBC_2.3.4myresgeteuid@@GLIBC_2.2.5setuid@@GLIBC_2.2.5strtdiffres_reversesuccess_IO_stdin_usedlocalhostsendsockgtk_opensendsock6_icmpTreeViewCreategtk_widget_show_all__strdup@@GLIBC_2.2.5gtk_tree_view_new_with_modelfputc@@GLIBC_2.2.5gtk_container_get_typemtr_curses_redrawdisplay_detectgtk_list_store_removesplit_txtrecgtk_loop__dn_expand@@GLIBC_2.2.5WaitTimefree@@GLIBC_2.2.5dns_ack6ssa6strlen@@GLIBC_2.2.5xml_closeoptind@@GLIBC_2.2.5__res_ninit@@GLIBC_2.2.5__data_startnet_save_xmitnet_add_fdsgtk_keyactionferror@@GLIBC_2.2.5gtk_net_datanet_returneddisplay_keyactiongtk_tree_view_append_columngethostbyaddr@@GLIBC_2.2.5print_mplsPrintVersion__ctype_b_loc@@GLIBC_2.3__res_init@@GLIBC_2.2.5dns_waitfd6net_save_returndebuggtk_tree_view_set_cursortxt_closegtk_window_set_titlegtk_window_set_default_sizenet_addrlinkresolveipfstTTLnet_saved_pingsidbashsetfdremotesockaddrstdin@@GLIBC_2.2.5Pause_clickedWaitTime_changedwrefreshsplit_keyactionresfdgtk_editable_get_typegtk_window_get_typeInteractivenet_closetempstringgtk_menu_item_new_with_labelenablemplsMaxPingg_io_add_watchnet_harvest_fdsnet_mplsnet_jintaaddrcmpchecksumrsa4streamlogmtr_curses_hostsgetSelectedHostgetidbash__res_query@@GLIBC_2.2.5pow@@GLIBC_2.2.5getegid@@GLIBC_2.2.5strerror@@GLIBC_2.2.5mtr_gen_scalefromfrom4LineCount__dso_handlegtk_dns_data6g_object_setgtk_show_about_dialogfputs@@GLIBC_2.2.5remoteportcsv_opentimestamprestellstrtol@@GLIBC_2.2.5fld_activenet_stdevgtk_initget_time_string__DTOR_END__getsockname@@GLIBC_2.2.5__libc_csu_initnew_sequencehcreate@@GLIBC_2.2.5connect@@GLIBC_2.2.5sendsock4optarg@@GLIBC_2.2.5failrpgtk_clipboard_set_textgethostname@@GLIBC_2.2.5gtk_toggle_button_new_with_mnemonicnet_resetinit_fld_optionsgdk_pixmap_colormap_create_from_xpm_dmtr_fill_graphgtk_tree_model_get_typelinkresolveidgtk_menu_popupgtk_list_store_appendis_printiiunlinkresolvenet_send_tcpgtk_adjustment_newipinfo_noaddr2host__strcpy_chk@@GLIBC_2.3.4gtk_tree_view_column_set_resizablexml_opennet_opengtk_label_get_typeunspec_addrgtk_object_get_typeudp_checksumdecodemplsgtk_spin_button_set_numericnullstringmemmove@@GLIBC_2.2.5strchr@@GLIBC_2.2.5dns_waitfdnet_avgremotesockaddr_structgetopt_long@@GLIBC_2.2.5float_formatterwgetchnet_javgsocket@@GLIBC_2.2.5gtk_pingresendrequestinet_ntoa@@GLIBC_2.2.5__fxstat@@GLIBC_2.2.5resfd6net_preopengetenv@@GLIBC_2.2.5net_set_interfaceaddressfld_index__errno_location@@GLIBC_2.2.5available_optionsgtk_main_quitgtk_entry_get_typeg_source_removeg_signal_connect_data__bss_startgdk_pixbuf_new_from_xpm_datag_set_application_namenet_send_batchdns_ackdns_lookup2sendstringmemg_type_check_instance_castnet_lastgtk_widget_showfromlenLocalHostnamesplit_open__stack_chk_fail@@GLIBC_2.4select_loopdnsintervalraw_rawpinggtk_list_store_newgetipbashstrcmp@@GLIBC_2.2.5net_mplssfindhostLines__memset_chk@@GLIBC_2.3.4unlinkresolveipgtk_load_pixmaplocalhost6lastresolvegtk_label_new_with_mnemonicToolbar_fillresponsecodesindex@@GLIBC_2.2.5trimsepgtk_hbox_newrecvsock6net_gmeanstrcpy@@GLIBC_2.2.5strtok@@GLIBC_2.2.5gtk_label_set_mnemonic_widgetgtk_container_addsrand@@GLIBC_2.2.5gtk_tree_path_freeistimegetuid@@GLIBC_2.2.5findipupdate_tree_rowgtk_toggle_button_set_activetrimgtk_toggle_button_get_typegtk_scrolled_window_newgtk_closegtk_list_store_setgtk_box_pack_startgtk_clipboard_get__ctype_tolower_loc@@GLIBC_2.3asn_openmemcmp@@GLIBC_2.2.5dns_lookupcalloc@@GLIBC_2.2.5resolvecountsourceaddressPrintHelpmtr_curses_graphreverse_host6_endfclose@@GLIBC_2.2.5gtk_tree_view_get_typerecvfrom@@GLIBC_2.2.5untieresolvestrncpy@@GLIBC_2.2.5mtr_curses_clearres_unknownidreport_closesourcesockaddr_structfrom_sastructhdestroy@@GLIBC_2.2.5split_closenet_process_fdsRestart_clickedipinfo_maxparserespacketgtk_tree_model_getissetfdwattr_offreportwidemtrtypetxtrecunlinkresolveidgtk_button_new_from_stockipinfo_lookupWindow_destroynet_addrsnet_selectsocketgtk_scrolled_window_get_typeaddrcpy__sprintf_chk@@GLIBC_2.3.4stderr@@GLIBC_2.2.5display_loopclearerr@@GLIBC_2.2.5__snprintf_chk@@GLIBC_2.3.4mtr_curses_opengtk_tree_model_get_iterssa4csv_closeclasstypesgtk_spin_button_newgtk_tree_view_column_new_with_attributessendto@@GLIBC_2.2.5res_hostipmismatchgtk_window_set_default_iconclearsetbind@@GLIBC_2.2.5g_timeout_addReportTreeView_clickedfwrite@@GLIBC_2.2.5net_bestinet_aton@@GLIBC_2.2.5sendsock4_udpitems_aperror@@GLIBC_2.2.5rand@@GLIBC_2.2.5allocresolve_edatagai_strerror@@GLIBC_2.2.5res_iplookupsuccessgtk_dns_datanet_worstgdk_colormap_get_systemgtk_detectstatmallocstackstringsetgid@@GLIBC_2.2.5sockaddrtopres_resendgtk_tree_view_get_path_at_posnet_process_pingipbashwrite@@GLIBC_2.2.5gtk_editable_insert_texthsearch@@GLIBC_2.2.5display_offsetgtk_spin_button_get_typedns_openitemsfindidnoechosqrt@@GLIBC_2.2.5net_updisplay_opencalc_deltatimeinet_ntop@@GLIBC_2.2.5strlongipfcntl@@GLIBC_2.2.5gtk_container_set_border_widthgtk_tree_view_column_set_expandnet_reopengtk_tree_view_column_set_cell_data_funchostbashgethostbashnet_jworstrsa6strtod@@GLIBC_2.2.5stdout@@GLIBC_2.2.5gtk_tree_model_iter_nextwattr_onnet_droptime@@GLIBC_2.2.5mainres_nserror_initfflush@@GLIBC_2.2.5remoteaddressget_ipinfomtr_print_scaledgtk_box_pack_endgtk_spin_button_get_valuetimeoutmtr-0.85/gtk.c0000664000175000017500000004745512137535115012241 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball Changes/additions Copyright (C) 1998 R.E.Wolff@BitWizard.nl This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #ifndef NO_GTK #include #include #include #include "mtr.h" #include "net.h" #include "dns.h" #include "mtr-gtk.h" #include "version.h" #include "img/mtr_icon.xpm" #endif gint gtk_ping(gpointer data); gint Copy_activate(GtkWidget *widget, gpointer data); gint NewDestination_activate(GtkWidget *widget, gpointer data); gboolean ReportTreeView_clicked(GtkWidget *Tree, GdkEventButton *event); gchar* getSelectedHost(GtkTreePath *path); extern char *Hostname; extern float WaitTime; extern int af; static int tag; static GtkWidget *Pause_Button; static GtkWidget *Entry; static GtkWidget *main_window; void gtk_add_ping_timeout (void) { int dt; dt = calc_deltatime (WaitTime); tag = g_timeout_add(dt / 1000, gtk_ping, NULL); } void gtk_do_init(int *argc, char ***argv) { static int done = 0; if(!done) { gtk_init(argc, argv); done = 1; } } int gtk_detect(UNUSED int *argc, UNUSED char ***argv) { if(getenv("DISPLAY") != NULL) { /* If we do this here, gtk_init exits on an error. This happens BEFORE the user has had a chance to tell us not to use the display... */ return TRUE; } else { return FALSE; } } gint Window_destroy(UNUSED GtkWidget *Window, UNUSED gpointer data) { gtk_main_quit(); return FALSE; } gint Restart_clicked(UNUSED GtkWidget *Button, UNUSED gpointer data) { net_reset(); gtk_redraw(); return FALSE; } gint Pause_clicked(UNUSED GtkWidget *Button, UNUSED gpointer data) { static int paused = 0; if (paused) { gtk_add_ping_timeout (); } else { g_source_remove (tag); } paused = ! paused; gtk_redraw(); return FALSE; } gint About_clicked(UNUSED GtkWidget *Button, UNUSED gpointer data) { gchar *authors[] = { "Matt Kimball ", "Roger Wolff ", "Bohdan Vlasyuk ", "Evgeniy Tretyak ", "John Thacker ", "Juha Takala", "David Sward ", "David Stone ", "Andrew Stesin", "Greg Stark ", "Robert Sparks ", "Mike Simons ", "Aaron Scarisbrick,", "Craig Milo Rogers ", "Antonio Querubin ", "Russell Nelson ", "Davin Milun ", "Josh Martin ", "Alexander V. Lukyanov ", "Charles Levert ", "Bertrand Leconte ", "Anand Kumria", "Olav Kvittem ", "Adam Kramer ", "Philip Kizer ", "Simon Kirby", "Christophe Kalt", "Steve Kann ", "Brett Johnson ", "Roland Illig ", "Damian Gryski ", "Rob Foehl ", "Mircea Damian", "Cougar ", "Travis Cross ", "Brian Casey", "Andrew Brown ", "Bill Bogstad ", "Marc Bejarano ", "Moritz Barsnick ", "Thomas Klausner ", NULL }; gtk_show_about_dialog(GTK_WINDOW(main_window) , "version", MTR_VERSION , "copyright", "Copyright \xc2\xa9 1997,1998 Matt Kimball" , "website", "http://www.bitwizard.nl/mtr/" , "authors", authors , "comments", "The 'traceroute' and 'ping' programs in a single network diagnostic tool." , "license", "This program is free software; you can redistribute it and/or modify\n" "it under the terms of the GNU General Public License version 2 as\n" "published by the Free Software Foundation.\n" "\n" "This program is distributed in the hope that it will be useful,\n" "but WITHOUT ANY WARRANTY; without even the implied warranty of\n" "MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the\n" "GNU General Public License for more details." , NULL); return TRUE; } /* * There is a small problem with the following code: * The timeout is canceled and removed in order to ensure that * it takes effect (consider what happens if you set the timeout to 999, * then try to undo the change); is a better approach possible? * * What's the problem with this? (-> "I don't think so) */ gint WaitTime_changed(UNUSED GtkAdjustment *Adj, UNUSED GtkWidget *Button) { WaitTime = gtk_spin_button_get_value(GTK_SPIN_BUTTON(Button)); g_source_remove (tag); gtk_add_ping_timeout (); gtk_redraw(); return FALSE; } gint Host_activate(GtkWidget *Entry, UNUSED gpointer data) { struct hostent * addr; addr = dns_forward(gtk_entry_get_text(GTK_ENTRY(Entry))); if(addr) { net_reopen(addr); /* If we are "Paused" at this point it is usually because someone entered a non-existing host. Therefore do the go-ahead... */ gtk_toggle_button_set_active( GTK_TOGGLE_BUTTON( Pause_Button ) , 0); } else { int pos = strlen(gtk_entry_get_text( GTK_ENTRY(Entry))); gtk_toggle_button_set_active( GTK_TOGGLE_BUTTON( Pause_Button ) , 1); gtk_editable_insert_text( GTK_EDITABLE(Entry), ": not found", -1, &pos); } return FALSE; } GdkPixmap *gtk_load_pixmap(char **pixmap) { return gdk_pixmap_colormap_create_from_xpm_d(NULL, gdk_colormap_get_system(), NULL, NULL, pixmap); } void Toolbar_fill(GtkWidget *Toolbar) { GtkWidget *Button; GtkWidget *Label; GtkAdjustment *Adjustment; Button = gtk_button_new_from_stock(GTK_STOCK_QUIT); gtk_box_pack_end(GTK_BOX(Toolbar), Button, FALSE, FALSE, 0); g_signal_connect(GTK_OBJECT(Button), "clicked", GTK_SIGNAL_FUNC(Window_destroy), NULL); Button = gtk_button_new_from_stock(GTK_STOCK_ABOUT); gtk_box_pack_end(GTK_BOX(Toolbar), Button, FALSE, FALSE, 0); g_signal_connect(GTK_OBJECT(Button), "clicked", GTK_SIGNAL_FUNC(About_clicked), NULL); Button = gtk_button_new_with_mnemonic("_Restart"); gtk_box_pack_end(GTK_BOX(Toolbar), Button, FALSE, FALSE, 0); g_signal_connect(GTK_OBJECT(Button), "clicked", GTK_SIGNAL_FUNC(Restart_clicked), NULL); Pause_Button = gtk_toggle_button_new_with_mnemonic("_Pause"); gtk_box_pack_end(GTK_BOX(Toolbar), Pause_Button, FALSE, FALSE, 0); g_signal_connect(GTK_OBJECT(Pause_Button), "clicked", GTK_SIGNAL_FUNC(Pause_clicked), NULL); /* allow root only to set zero delay */ Adjustment = (GtkAdjustment *)gtk_adjustment_new(WaitTime, getuid()==0 ? 0.01:1.00, 999.99, 1.0, 10.0, 0.0); Button = gtk_spin_button_new(Adjustment, 0.5, 2); gtk_spin_button_set_numeric(GTK_SPIN_BUTTON(Button), TRUE); /* gtk_spin_button_set_snap_to_ticks(GTK_SPIN_BUTTON(Button), FALSE); */ /* gtk_spin_button_set_set_update_policy(GTK_SPIN_BUTTON(Button), GTK_UPDATE_IF_VALID); */ gtk_box_pack_end(GTK_BOX(Toolbar), Button, FALSE, FALSE, 0); g_signal_connect(GTK_OBJECT(Adjustment), "value_changed", GTK_SIGNAL_FUNC(WaitTime_changed), Button); Label = gtk_label_new_with_mnemonic("_Hostname:"); gtk_box_pack_start(GTK_BOX(Toolbar), Label, FALSE, FALSE, 0); Entry = gtk_entry_new(); gtk_entry_set_text(GTK_ENTRY(Entry), Hostname); g_signal_connect(GTK_OBJECT(Entry), "activate", GTK_SIGNAL_FUNC(Host_activate), NULL); gtk_box_pack_start(GTK_BOX(Toolbar), Entry, TRUE, TRUE, 0); gtk_label_set_mnemonic_widget(GTK_LABEL(Label), Entry); } static GtkWidget *ReportTreeView; static GtkListStore *ReportStore; enum { COL_HOSTNAME, COL_LOSS, COL_RCV, COL_SNT, COL_LAST, COL_BEST, COL_AVG, COL_WORST, COL_STDEV, COL_COLOR, N_COLS }; // Trick to cast a pointer to integer..... // We are mis-using a pointer as a single integer. On 64-bit // architectures, the pointer is 64 bits and the integer only 32. // The compiler warns us of loss of precision. However we know we // casted a normal 32-bit integer into this pointer a few microseconds // earlier, so it is ok. Nothing to worry about.... #define POINTER_TO_INT(p) ((int)(long)(p)) void float_formatter(GtkTreeViewColumn *tree_column, GtkCellRenderer *cell, GtkTreeModel *tree_model, GtkTreeIter *iter, gpointer data) { gfloat f; gchar text[64]; gtk_tree_model_get(tree_model, iter, POINTER_TO_INT(data), &f, -1); sprintf(text, "%.2f", f); g_object_set(cell, "text", text, NULL); } void percent_formatter(GtkTreeViewColumn *tree_column, GtkCellRenderer *cell, GtkTreeModel *tree_model, GtkTreeIter *iter, gpointer data) { gfloat f; gchar text[64]; gtk_tree_model_get(tree_model, iter, POINTER_TO_INT(data), &f, -1); sprintf(text, "%.1f%%", f); g_object_set(cell, "text", text, NULL); } void TreeViewCreate(void) { GtkCellRenderer *renderer; GtkTreeViewColumn *column; ReportStore = gtk_list_store_new(N_COLS, G_TYPE_STRING, G_TYPE_FLOAT, G_TYPE_INT, G_TYPE_INT, G_TYPE_INT, G_TYPE_INT, G_TYPE_INT, G_TYPE_INT, G_TYPE_FLOAT, G_TYPE_STRING ); ReportTreeView = gtk_tree_view_new_with_model(GTK_TREE_MODEL(ReportStore)); g_signal_connect(GTK_OBJECT(ReportTreeView), "button_press_event", G_CALLBACK(ReportTreeView_clicked),NULL); renderer = gtk_cell_renderer_text_new (); column = gtk_tree_view_column_new_with_attributes ("Hostname", renderer, "text", COL_HOSTNAME, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_expand(column, TRUE); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Loss", renderer, "text", COL_LOSS, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_column_set_cell_data_func(column, renderer, percent_formatter, (void*)COL_LOSS, NULL); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Snt", renderer, "text", 3, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Last", renderer, "text", 4, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Avg", renderer, "text", 6, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Best", renderer, "text", 5, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("Worst", renderer, "text", 7, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); renderer = gtk_cell_renderer_text_new (); g_object_set (G_OBJECT(renderer), "xalign", 1.0, NULL); column = gtk_tree_view_column_new_with_attributes ("StDev", renderer, "text", 8, "foreground", COL_COLOR, NULL); gtk_tree_view_column_set_resizable(column, TRUE); gtk_tree_view_column_set_cell_data_func(column, renderer, float_formatter, (void*)COL_STDEV, NULL); gtk_tree_view_append_column (GTK_TREE_VIEW(ReportTreeView), column); } void update_tree_row(int row, GtkTreeIter *iter) { ip_t *addr; char str[256]="???", *name=str; addr = net_addr(row); if (addrcmp( (void *) addr, (void *) &unspec_addr, af)) { if ((name = dns_lookup(addr))) { if (show_ips) { snprintf(str, sizeof(str), "%s (%s)", name, strlongip(addr)); name = str; } } else name = strlongip(addr); } gtk_list_store_set(ReportStore, iter, COL_HOSTNAME, name, COL_LOSS, (float)(net_loss(row)/1000.0), COL_RCV, net_returned(row), COL_SNT, net_xmit(row), COL_LAST, net_last(row)/1000, COL_BEST, net_best(row)/1000, COL_AVG, net_avg(row)/1000, COL_WORST, net_worst(row)/1000, COL_STDEV, (float)(net_stdev(row)/1000.0), COL_COLOR, net_up(row) ? "black" : "red", -1); } void gtk_redraw(void) { int max = net_max(); GtkTreeIter iter; int row = net_min(); gboolean valid; valid = gtk_tree_model_get_iter_first(GTK_TREE_MODEL(ReportStore), &iter); while(valid) { if(row < max) { update_tree_row(row++, &iter); valid = gtk_tree_model_iter_next(GTK_TREE_MODEL(ReportStore), &iter); } else { valid = gtk_list_store_remove(ReportStore, &iter); } } while(row < max) { gtk_list_store_append(ReportStore, &iter); update_tree_row(row++, &iter); } } void Window_fill(GtkWidget *Window) { GtkWidget *VBox; GtkWidget *Toolbar; GtkWidget *scroll; gtk_window_set_title(GTK_WINDOW(Window), "My traceroute"); gtk_window_set_default_size(GTK_WINDOW(Window), 650, 400); gtk_container_set_border_width(GTK_CONTAINER(Window), 10); VBox = gtk_vbox_new(FALSE, 10); Toolbar = gtk_hbox_new(FALSE, 10); Toolbar_fill(Toolbar); gtk_box_pack_start(GTK_BOX(VBox), Toolbar, FALSE, FALSE, 0); TreeViewCreate(); scroll = gtk_scrolled_window_new(NULL, NULL); gtk_scrolled_window_set_policy(GTK_SCROLLED_WINDOW(scroll), GTK_POLICY_AUTOMATIC, GTK_POLICY_AUTOMATIC); gtk_scrolled_window_set_shadow_type(GTK_SCROLLED_WINDOW(scroll), GTK_SHADOW_IN); gtk_container_add(GTK_CONTAINER(scroll), ReportTreeView); gtk_box_pack_start(GTK_BOX(VBox), scroll, TRUE, TRUE, 0); gtk_container_add(GTK_CONTAINER(Window), VBox); } void gtk_open(void) { GdkPixbuf *icon; int argc; char *args[2]; char **argv; argc = 1; argv = args; argv[0] = ""; argv[1] = NULL; gtk_do_init(&argc, &argv); icon = gdk_pixbuf_new_from_xpm_data((const char**)mtr_icon); gtk_window_set_default_icon(icon); main_window = gtk_window_new(GTK_WINDOW_TOPLEVEL); g_set_application_name("My traceroute"); Window_fill(main_window); g_signal_connect(GTK_OBJECT(main_window), "delete_event", GTK_SIGNAL_FUNC(Window_destroy), NULL); g_signal_connect(GTK_OBJECT(main_window), "destroy", GTK_SIGNAL_FUNC(Window_destroy), NULL); gtk_widget_show_all(main_window); } void gtk_close(void) { } int gtk_keyaction(void) { return 0; } gint gtk_ping(UNUSED gpointer data) { gtk_redraw(); net_send_batch(); net_harvest_fds(); g_source_remove (tag); gtk_add_ping_timeout (); return TRUE; } gboolean gtk_net_data(UNUSED GIOChannel *channel, UNUSED GIOCondition cond, UNUSED gpointer data) { net_process_return(); return TRUE; } gboolean gtk_dns_data(UNUSED GIOChannel *channel, UNUSED GIOCondition cond, UNUSED gpointer data) { dns_ack(); gtk_redraw(); return TRUE; } #ifdef ENABLE_IPV6 gboolean gtk_dns_data6(UNUSED GIOChannel *channel, UNUSED GIOCondition cond, UNUSED gpointer data) { dns_ack6(); gtk_redraw(); return TRUE; } #endif void gtk_loop(void) { GIOChannel *net_iochannel, *dns_iochannel; gtk_add_ping_timeout (); net_iochannel = g_io_channel_unix_new(net_waitfd()); g_io_add_watch(net_iochannel, G_IO_IN, gtk_net_data, NULL); #ifdef ENABLE_IPV6 dns_iochannel = g_io_channel_unix_new(dns_waitfd6()); g_io_add_watch(dns_iochannel, G_IO_IN, gtk_dns_data6, NULL); #endif dns_iochannel = g_io_channel_unix_new(dns_waitfd()); g_io_add_watch(dns_iochannel, G_IO_IN, gtk_dns_data, NULL); gtk_main(); } gboolean NewDestination_activate(GtkWidget *widget, gpointer data) { gchar *hostname; GtkTreePath *path = (GtkTreePath*)data; hostname = getSelectedHost(path); if (hostname) { gtk_entry_set_text (GTK_ENTRY(Entry), hostname); Host_activate(Entry, NULL); g_free(hostname); } return TRUE; } gboolean Copy_activate(GtkWidget *widget, gpointer data) { gchar *hostname; GtkTreePath *path = (GtkTreePath*)data; hostname = getSelectedHost(path); if (hostname != NULL) { GtkClipboard *clipboard; clipboard = gtk_clipboard_get(GDK_SELECTION_CLIPBOARD); gtk_clipboard_set_text(clipboard, hostname, -1); clipboard = gtk_clipboard_get(GDK_SELECTION_PRIMARY); gtk_clipboard_set_text(clipboard, hostname, -1); g_free(hostname); } return TRUE; } gchar *getSelectedHost(GtkTreePath *path) { GtkTreeIter iter; gchar *name = NULL; if (gtk_tree_model_get_iter(GTK_TREE_MODEL(ReportStore), &iter, path)) { gtk_tree_model_get (GTK_TREE_MODEL(ReportStore), &iter, COL_HOSTNAME, &name, -1); } gtk_tree_path_free(path); return name; } gboolean ReportTreeView_clicked(GtkWidget *Tree, GdkEventButton *event) { GtkWidget* popup_menu; GtkWidget* copy_item; GtkWidget* newdestination_item; GtkTreePath *path; if (event->type != GDK_BUTTON_PRESS || event->button != 3) return FALSE; if(!gtk_tree_view_get_path_at_pos(GTK_TREE_VIEW(ReportTreeView), event->x, event->y, &path, NULL, NULL, NULL)) return FALSE; gtk_tree_view_set_cursor(GTK_TREE_VIEW(ReportTreeView), path, NULL, FALSE); // Single right click: prepare and show the popup menu popup_menu = gtk_menu_new (); copy_item = gtk_menu_item_new_with_label ("Copy to clipboard"); newdestination_item = gtk_menu_item_new_with_label ("Set as new destination"); gtk_menu_append (GTK_MENU (popup_menu), copy_item); gtk_menu_append (GTK_MENU (popup_menu), newdestination_item); g_signal_connect(GTK_OBJECT(copy_item),"activate", GTK_SIGNAL_FUNC(Copy_activate), path); g_signal_connect(GTK_OBJECT(newdestination_item),"activate", GTK_SIGNAL_FUNC(NewDestination_activate), path); gtk_widget_show (copy_item); gtk_widget_show (newdestination_item); gtk_menu_popup (GTK_MENU(popup_menu), NULL, NULL, NULL, NULL, 0, event->time); return TRUE; } mtr-0.85/display.h0000664000175000017500000000316512144202516013106 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include /* Don't put a trailing comma in enumeration lists. Some compilers (notably the one on Irix 5.2) do not like that. */ enum { ActionNone, ActionQuit, ActionReset, ActionDisplay, ActionClear, ActionPause, ActionResume, ActionMPLS, ActionDNS, #ifndef NO_IPINFO ActionII, ActionAS, #endif ActionScrollDown, ActionScrollUp }; enum { DisplayReport, DisplayCurses, DisplayGTK, DisplaySplit, DisplayRaw, DisplayXML, DisplayCSV, DisplayTXT}; /* Prototypes for display.c */ void display_detect(int *argc, char ***argv); void display_open(void); void display_close(time_t now); void display_redraw(void); void display_rawping(int hostnum, int msec); void display_rawhost(int hostnum, ip_t *ip_addr); int display_keyaction(void); void display_loop(void); void display_clear(void); extern int display_mode; extern int display_offset; /* only used in text mode */ mtr-0.85/.gitignore0000664000175000017500000000033512106217130013250 0ustar wolffwolff# .gitignore *.o Makefile Makefile.in aclocal.m4 confdefs.h config.* configure confinc confmf conftest.* depcomp install-sh missing stamp-h1* /autom4te.cache/ /.deps/ /ChangeLog /INSTALL /mtr /version.h /version.h.tmp mtr-0.85/raw.h0000664000175000017500000000160312104140215012216 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1998 R.E.Wolff@BitWizard.nl raw.h -- raw output (for logging for later analysis) This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for raw.c */ void raw_rawping(int host, int msec); void raw_rawhost(int host, ip_t * addr); mtr-0.85/report.h0000664000175000017500000000166112144202516012753 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for report.h */ void report_open(void); void report_close(void); void txt_open(void); void txt_close(void); void xml_open(void); void xml_close(void); void csv_open(void); void csv_close(time_t now); mtr-0.85/configure.ac0000664000175000017500000001733012162522624013562 0ustar wolffwolffAC_INIT([mtr], [0.85]) AC_CONFIG_SRCDIR([mtr.c]) AM_INIT_AUTOMAKE([foreign]) AC_CONFIG_FILES([version.h.tmp:version.h.in]) AC_SUBST(GTK_OBJ) AC_SUBST(CURSES_OBJ) GTK_OBJ=gtk.o CURSES_OBJ=curses.o AC_PROG_CC AC_CHECK_SIZEOF(unsigned char, 1) AC_CHECK_SIZEOF(unsigned short, 2) AC_CHECK_SIZEOF(unsigned int, 4) AC_CHECK_SIZEOF(unsigned long, 4) AC_CHECK_HEADERS(ncurses.h ncurses/curses.h curses.h cursesX.h sys/types.h fcntl.h) AC_CHECK_HEADERS(socket.h sys/socket.h sys/xti.h arpa/nameser_compat.h) # We don't refer to any symbols in termcap, but -lcurses on SunOS does. # We have to trust the linker not to mess things up... (It should not # pull in anything if we don't refer to anything in the lib). AC_CHECK_LIB(termcap, tgetent) AC_CHECK_LIB(tinfo, tgetent) AC_CHECK_FUNC(initscr, , AC_CHECK_LIB(ncurses, initscr, , AC_CHECK_LIB(curses, initscr, , AC_CHECK_LIB(cursesX, initscr, , AC_MSG_WARN(Building without curses display support) AC_DEFINE(NO_CURSES, 1, Define if you don't have the curses libraries available.) CURSES_OBJ=)))) AC_CHECK_FUNCS(attron fcntl) AC_CHECK_LIB(m, floor, , AC_MSG_ERROR(No math library found)) AC_ARG_WITH(gtk, [ --without-gtk Do not try to use GTK+ at all], WANTS_GTK=$withval, WANTS_GTK=yes) AC_ARG_WITH(glib, [ --without-glib Do not try to use glib at all], WANTS_GLIB=$withval, WANTS_GLIB=yes) AC_ARG_WITH([ipinfo], [ --without-ipinfo Do not try to use ipinfo lookup at all], [case "${withval}" in yes) ipinfo=true ;; no) ipinfo=false ;; *) AC_MSG_ERROR([bad value ${withval} for --with-ipinfo]) ;; esac],[ipinfo=true]) AM_CONDITIONAL([IPINFO], [test x$ipinfo = xtrue]) if test "x$ipinfo" = "xfalse"; then AC_DEFINE([NO_IPINFO], [1], [Define to disable ipinfo lookup]) fi AC_ARG_ENABLE(ipv6, [ --disable-ipv6 Do not enable IPv6], WANTS_IPV6=$enableval, WANTS_IPV6=yes) if test "x$WANTS_GTK" = "xyes"; then AM_PATH_GTK_2_0(2.6.0, CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$LIBS $GTK_LIBS -lm", AC_MSG_WARN(Building without GTK2 display support) AC_DEFINE(NO_GTK, 1, [Define if you don't have the GTK+ libraries available.]) GTK_OBJ="") else AC_DEFINE(NO_GTK) GTK_OBJ="" if test "x$WANTS_GLIB" = "xyes"; then PKG_CHECK_MODULES([GLIB], [glib-2.0]) else AC_DEFINE(NO_GLIB, 1, [Define if you don't have the glib libraries available.]) fi fi AC_CHECK_FUNC(socket, , AC_CHECK_LIB(socket, socket, , AC_MSG_ERROR(No socket library found))) AC_CHECK_FUNC(gethostbyname, , AC_CHECK_LIB(nsl, gethostbyname, , AC_MSG_ERROR(No nameservice library found))) #AC_CHECK_FUNC(res_init, , # AC_CHECK_LIB(bind, res_init, , # AC_CHECK_LIB(resolv, res_init, , AC_MSG_ERROR(No resolver library found)))) AC_CHECK_FUNCS(seteuid) # AC_CHECK_FUNC(setuid, , AC_MSG_ERROR (I Need either seteuid or setuid)) #AC_CHECK_FUNC(res_mkquery, , # AC_CHECK_LIB(bind, res_mkquery, , # AC_CHECK_LIB(resolv, res_mkquery, , # AC_CHECK_LIB(resolv, __res_mkquery, , AC_MSG_ERROR(No resolver library found))))) # See if a library is needed for res_mkquery and if so put it in RESOLV_LIBS RESOLV_LIBS= AC_SUBST(RESOLV_LIBS) AC_DEFUN([LIBRESOLVTEST_SRC], [ AC_LANG_PROGRAM([[ #include #include ]], [[ int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; (void)(*res_mkquery_func)(0); ]])]) AC_MSG_CHECKING([whether library required for res_mkquery]) RESOLV_LIB_NONE= AC_LINK_IFELSE([LIBRESOLVTEST_SRC], [AC_MSG_RESULT([no]) RESOLV_LIB_NONE=yes], [AC_MSG_RESULT([yes])]) if test "x$RESOLV_LIB_NONE" = "x"; then AC_MSG_CHECKING([for res_mkquery in -lbind]) STASH_LIBS="$LIBS" LIBS="$STASH_LIBS -lbind" AC_LINK_IFELSE([LIBRESOLVTEST_SRC], [AC_MSG_RESULT([yes]) RESOLV_LIBS=-lbind], [AC_MSG_RESULT([no])]) if test "x$RESOLV_LIBS" = "x"; then AC_MSG_CHECKING([for res_mkquery in -lresolv]) LIBS="$STASH_LIBS -lresolv" AC_LINK_IFELSE([LIBRESOLVTEST_SRC], [AC_MSG_RESULT([yes]) RESOLV_LIBS=-lresolv], [AC_MSG_RESULT([no]) AC_MSG_ERROR(No resolver library found)]) fi LIBS="$STASH_LIBS" fi AC_CHECK_FUNC(herror, , AC_DEFINE(NO_HERROR, 1, [Define if you don't have the herror() function available.])) AC_CHECK_FUNC(strerror, , AC_DEFINE(NO_STRERROR, 1, [Define if you don't have the strerror() function available.])) USES_IPV6= AC_CHECK_FUNC(getaddrinfo, [if test "$WANTS_IPV6" = "yes"; then AC_DEFINE([ENABLE_IPV6], [], [Define to enable IPv6]) USES_IPV6=yes fi]) AC_DEFUN([NEED_RES_STATE_EXT_TEST_SRC], [ AC_LANG_PROGRAM([[ #include #include #ifdef __GLIBC__ #define RESEXTIN6(r,i) (*(r._u._ext.nsaddrs[i])) #else #define RESEXTIN6(r,i) (r._u._ext.ext->nsaddrs[i].sin6) #endif ]], [[ struct __res_state res; return RESEXTIN6(res,0).sin6_addr.s6_addr[0]; ]])]) AC_DEFUN([DEFINE_RES_STATE_EXT_TEST_SRC], [ AC_LANG_PROGRAM([[ #include #include #ifdef __GLIBC__ #define RESEXTIN6(r,i) (*(r._u._ext.nsaddrs[i])) #else #define RESEXTIN6(r,i) (r._u._ext.ext->nsaddrs[i].sin6) struct __res_state_ext { union res_sockaddr_union nsaddrs[MAXNS]; struct sort_list { int af; union { struct in_addr ina; struct in6_addr in6a; } addr, mask; } sort_list[MAXRESOLVSORT]; char nsuffix[64]; char nsuffix2[64]; }; #endif ]], [[ struct __res_state res; return RESEXTIN6(res,0).sin6_addr.s6_addr[0]; ]])]) if test "x$USES_IPV6" = "xyes"; then AC_MSG_CHECKING([whether __res_state_ext needs to be defined]) AC_COMPILE_IFELSE([NEED_RES_STATE_EXT_TEST_SRC], [AC_MSG_RESULT([no])], [AC_MSG_RESULT([yes]) AC_MSG_CHECKING([whether provided __res_state_ext definition can be compiled]) AC_COMPILE_IFELSE([DEFINE_RES_STATE_EXT_TEST_SRC], [AC_MSG_RESULT([yes]) AC_DEFINE(NEED_RES_STATE_EXT, 1, [Define if struct __res_state_ext needs to be defined.])], [AC_MSG_RESULT([no]) AC_MSG_ERROR(Need definition for struct __res_state_ext but unable to define it.)])]) fi AC_CHECK_DECLS(errno, , , [[ #include #include ]] ) AC_CHECK_TYPE(socklen_t, AC_DEFINE([HAVE_SOCKLEN_T], [], [Define if your system has socklen_t]) , , [[ #include #ifdef HAVE_SOCKET_H #include #endif #ifdef HAVE_SYS_SOCKET_H #include #endif ]]) AC_CHECK_TYPE(struct in_addr, AC_DEFINE([HAVE_STRUCT_INADDR], [], [Define if you have struct in_addr]), , [[ #include ]]) dnl Add C flags to display more warnings AC_MSG_CHECKING(for C flags to get more warnings) ac_save_CFLAGS="$CFLAGS" if test "x$ac_cv_c_compiler_gnu" = "xyes" ; then dnl gcc is the easiest C compiler warning_CFLAGS="-Wall" # Check if compiler supports -Wno-pointer-sign and add it if supports CFLAGS_saved="$CFLAGS" CFLAGS="$CFLAGS -Wno-pointer-sign" AC_COMPILE_IFELSE([ AC_LANG_SOURCE([[ int foo; ]])], [ warning_CFLAGS="${warning_CFLAGS} -Wno-pointer-sign" ],) CFLAGS="$CFLAGS_saved" else dnl Vendor supplied C compilers are a bit tricky case "$host_os" in dnl SGI IRIX with the MipsPRO C compiler irix*) CFLAGS="$CFLAGS -fullwarn" AC_COMPILE_IFELSE([AC_LANG_PROGRAM([[#include ]], [[printf("test");]])],[warning_CFLAGS="-fullwarn"],[]) ;; dnl SunOS 4.x with the SparcWorks(?) acc compiler sunos*) if "$CC" = "acc" ; then CFLAGS="$CFLAGS -vc" AC_COMPILE_IFELSE([AC_LANG_PROGRAM([[#include ]], [[printf("test");]])],[warning_CFLAGS="-vc"],[]) fi ;; dnl Unknown, do nothing *) warning_CFLAGS="none" ;; esac fi CFLAGS="$ac_save_CFLAGS" if test "$warning_CFLAGS" = "none" ; then AC_MSG_RESULT(none) else CFLAGS="$CFLAGS $warning_CFLAGS" AC_MSG_RESULT($warning_CFLAGS) fi AC_CONFIG_HEADERS([config.h]) AC_CONFIG_FILES([Makefile img/Makefile]) AC_OUTPUT mtr-0.85/getopt.o0000664000175000017500000001051012162522233012743 0ustar wolffwolffELF>X@@ Ô8intiŽiŽØbb#ˆ#ˆ#ˆ#ˆ# ˆ#(ˆ#0ˆ#8ˆ#@ˆ#Hˆ#P ˆ#X" #`$¦#h&b#p*b#t,p#x0F#€1T#‚2¬#ƒ6¼#ˆ?{#H†#˜I†# J†#¨K†#°L-#¸Nb#ÀPÂ#Ä ´ º  » # ¼¦# Àb#i• ޼ 8b ŽÒ 8¥¦¦¦¥¦¦¦% : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ 4: ; I? < ¢œû /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/x86_64-linux-gnu/bits/usr/includestddef.htypes.hlibio.hstdio.h_IO_buf_end_old_offset_IO_save_endshort intsize_t_offset_IO_write_ptr_flags/home/wolff/mtr_IO_buf_base_markers_IO_read_end_locklong int_cur_column_pos_sbuf_IO_FILEunsigned charsigned charunsigned int_IO_marker_shortbuf__pad2_IO_write_base_unused2_IO_read_ptrshort unsigned intchar_next__pad1GNU C 4.6.1__pad3__pad4__pad5long unsigned int_IO_write_end__off64_tgetopt.c_chain__off_t_IO_backup_basestdin_flags2_mode_IO_read_base_vtable_offset_IO_save_base_filenostdout_IO_lock_tGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1.symtab.strtab.shstrtab.text.data.bss.rela.debug_info.debug_abbrev.debug_line.debug_str.comment.note.GNU-stack@!@'@1@,ð X =G±Kø¦W0žb0¬+k××{Ø   à ñÿ  getopt.c  B  S!) . /; cB µI P ÏW Ã^ %l Œq | ƒ‘ 0– ¬£ L² Á yÐ Éß øî >ý u  c * æ9 ¥H W pf –u ô„ »“  ¢ •² × çÒ †â 6ò ; ñ N" U2 \B ÃR c j Üv 5„ ¦’ ¡Ó µà üí µú ümtr-0.85/bootstrap.sh0000775000175000017500000000012012104204375013631 0ustar wolffwolff#!/bin/sh aclocal autoheader automake --add-missing --copy --foreign autoconf mtr-0.85/Makefile.am0000664000175000017500000000233612135723235013331 0ustar wolffwolffSUBDIRS = img sbin_PROGRAMS = mtr man_MANS = mtr.8 install-exec-hook: chmod u+s $(DESTDIR)$(sbindir)/mtr mtr_SOURCES = mtr.c \ net.c net.h \ dns.c dns.h \ raw.c raw.h \ split.c split.h \ display.c display.h \ report.c report.h \ getopt.c getopt1.c getopt.h \ select.c select.h \ mtr-curses.h \ mtr-gtk.h if IPINFO mtr_SOURCES += asn.c asn.h endif nodist_mtr_SOURCES = version.h EXTRA_mtr_SOURCES = curses.c \ gtk.c DEFAULT_INCLUDES= $(GLIB_CFLAGS) -I. mtr_DEPENDENCIES = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDFLAGS = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDADD = $(GLIB_LIBS) $(RESOLV_LIBS) CLEANFILES = version.h BUILT_SOURCES = version.h version.h: version.h.tmp Makefile $(mtr_SOURCES) @cat version.h.tmp > $@; \ if [ -d .git ] && [ -n "$$(which git)" ]; then \ xver="+git:$$(git rev-list -n1 --abbrev=8 --abbrev-commit HEAD)"; \ sed \ -e "/#define *MTR_VERSION */{s/\"\([^\"]*\)\"/\"\1$$xver\"/;}" \ version.h.tmp > $@; \ fi; EXTRA_DIST = SECURITY mtr.8 Makefile Makefile.dist distclean-local: (sleep 3; cp Makefile.dist Makefile) & rm -f *.orig DISTCLEANFILES = *~ mtr-0.85/getopt1.c0000664000175000017500000001016012104140215013001 0ustar wolffwolff/* getopt_long and getopt_long_only entry points for GNU getopt. Copyright (C) 1987, 88, 89, 90, 91, 92, 1993, 1994 Free Software Foundation, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ #ifdef HAVE_CONFIG_H #include #endif #include "getopt.h" #if !defined (__STDC__) || !__STDC__ /* This is a separate conditional since some stdc systems reject `defined (const)'. */ #ifndef const #define const #endif #endif #include /* Comment out all this code if we are using the GNU C Library, and are not actually compiling the library itself. This code is part of the GNU C Library, but also included in many other GNU distributions. Compiling and linking in this code is a waste when using the GNU C library (especially if it is a shared library). Rather than having every GNU program understand `configure --with-gnu-libc' and omit the object files, it is simpler to just do this in the source for each such file. */ #if defined (_LIBC) || !defined (__GNU_LIBRARY__) /* This needs to come after some library #include to get __GNU_LIBRARY__ defined. */ #ifdef __GNU_LIBRARY__ #include #else char *getenv (); #endif #ifndef NULL #define NULL 0 #endif int getopt_long (argc, argv, options, long_options, opt_index) int argc; char *const *argv; const char *options; const struct option *long_options; int *opt_index; { return _getopt_internal (argc, argv, options, long_options, opt_index, 0); } /* Like getopt_long, but '-' as well as '--' can indicate a long option. If an option that starts with '-' (not '--') doesn't match a long option, but does match a short option, it is parsed as a short option instead. */ int getopt_long_only (argc, argv, options, long_options, opt_index) int argc; char *const *argv; const char *options; const struct option *long_options; int *opt_index; { return _getopt_internal (argc, argv, options, long_options, opt_index, 1); } #endif /* _LIBC or not __GNU_LIBRARY__. */ #ifdef TEST #include int main (argc, argv) int argc; char **argv; { int c; int digit_optind = 0; while (1) { int this_option_optind = optind ? optind : 1; int option_index = 0; static struct option long_options[] = { {"add", 1, 0, 0}, {"append", 0, 0, 0}, {"delete", 1, 0, 0}, {"verbose", 0, 0, 0}, {"create", 0, 0, 0}, {"file", 1, 0, 0}, {0, 0, 0, 0} }; c = getopt_long (argc, argv, "abc:d:0123456789", long_options, &option_index); if (c == EOF) break; switch (c) { case 0: printf ("option %s", long_options[option_index].name); if (optarg) printf (" with arg %s", optarg); printf ("\n"); break; case '0': case '1': case '2': case '3': case '4': case '5': case '6': case '7': case '8': case '9': if (digit_optind != 0 && digit_optind != this_option_optind) printf ("digits occur in two different argv-elements.\n"); digit_optind = this_option_optind; printf ("option %c\n", c); break; case 'a': printf ("option a\n"); break; case 'b': printf ("option b\n"); break; case 'c': printf ("option c with value `%s'\n", optarg); break; case 'd': printf ("option d with value `%s'\n", optarg); break; case '?': break; default: printf ("?? getopt returned character code 0%o ??\n", c); } } if (optind < argc) { printf ("non-option ARGV-elements: "); while (optind < argc) printf ("%s ", argv[optind++]); printf ("\n"); } exit (0); } #endif /* TEST */ mtr-0.85/net.o0000664000175000017500000024703012162522232012237 0ustar wolffwolffELF>0³@@S1À¾‰ûèƒøÿt,‰Â¾1ÀƒÊ‰ßè…Àu[Ã[¿éD[¿éDó* ó^ÁóYó,ÀÀ‰ðÁèƸÿÿÑþt0ƒî1ÒHLwfD·HƒÇÂH9Ïuò‰ÐâÿÿÁèÂ÷Ò·ÂóÃfffff.„UH‰åAWAVAUA‰ÕE| McíATI‰üSH‰óHƒì‹5dH‹%(H‰EÈ1ÀD‰øHƒÀHÁèHÁàH)ÄD‰øÁøLt$‰ÂD1úIƒæð)‹L‰÷HcÒMõÁø1Æ)Æ@¶öèA‹$AÆFA‰A‹D$A‰FA¶D$ AˆF A·D$ fA‰F ·fA‰E·CfA‰E·CfA‰E·CfA‰ED‰øÁèAǸÿÿAÑÿt3Aƒï1ÒKL~€A·IƒÆÂI9Îuñ‰ÐâÿÿÁèÂ÷Ò·ÂH‹UÈdH3%(uHeØ[A\A]A^A_]Ãèfff.„HcÇHiÀXHÃffffff.„HcÿHcöHiÿXHƒÆHÁæH„>ÃfHcÇHiÀXHÃffffff.„HcÿHcöHiÿXHvHÁàH„8ÃfHcÿ1ÀHiÿX‹‹—9Ñt2)Ñò ò*‡ò*ÑòYÁò^Âò\ÈòòYÁò,ÀóÃHcÿHiÿX‹‡+‡+‡ÃHcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHƒì1ÀHiÿX‹—ƒú~/ò*ÊòH*‡ò\ ò^ÁòQÈf.ÉzòY ò,ÁHƒÄÃèf(ÈëäfDHcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„‹ƒèÃfDHcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„HcÿHiÿX‹‡Ãffffff.„¸Ãf.„¸ÇHXH=uìóÃfSºÿ¾¿»ÿÿÿÿHƒìÇD$ è…À‰ˆ¡º:¾¿ 躾¿ ‰è‹=HL$ 1öA¸º‰è…ÀuWº¾¿è…À‰x.‰Ç1Ûè úÿÿº:¾¿ è…À‰x‰ÇèûùÿÿHƒÄ‰Ø[ÿèëé@‹…Àxf‹ƒøtCƒø‹t 1À…Òx óÄ‹ÁøÃfD‹1À…Ò‰yÔëÜ@‹1À…Ò‰y¼ëÄ@¸ÿÿÿÿÃf.„‹HÇÆpÿÿÿSÇ ¹Hîƒè‰HÇÇA<ÇAÇA1ÀÇA ÇAÇA$ÇAÇA ÇA(HÇAÇA,ÇA0ÇA4ÇA8Ç„þÿÿÿHƒÀH= uéÇ`:ÿÿÿHÁXHù…[ÿÿÿ»fD‹;ÇCä…ÿ~ èÇHƒÃ(HûuÛ[1ö¿éfffff.„1ÒH…ÿSH‰ût6‹H‹5ƒøf‰„|1Òƒø t‹=è1Òƒøÿ„‰Ð[ÃH‹H‰þ¿ fÇBHƒÂè…ÀH‹5ºµH‹=ºH‰Ù¾1Àèºë©„H‹5fÇFHƒÆè…ÀH‹5ºaÿÿÿëª@¿èº‰Ð[Ãffff.„Hƒì‹ …Éx‹=è‹=è‹=…ÿxè‹…Òx‹=è‹=è‹=…ÿxHƒÄéf.„HƒÄÃff.„‹Ãf„HcÇHiÀXHÃffffff.„U1íS»HƒìHcýºƒÅHiÿXH·HÇèƒÇCüþÿÿÿHÃXýuÂHƒÄ[]Ãff.„SHcßHiÃXƒ¸þtèHiÛXǃÿÿÿÿ[Ã@HcÏHcöHiÁXH¶HÁ≺ǂD‹€‹°HÇ‚HǂǀAƒÀ…öD‰€D‰‚t Ç€HiÉXÇé„S‹¸è€S‰ÞúL‰è‰Ø[ÀHcÿHiÇX+°þÈwHiÿÖHcöHD>4‰…óÃH‰\$ðH‰l$øHƒì·H‰óH‰Õfƒøt3fƒø t]H‹ º!¾¿èÆH‹l$H‹\$HƒÄËèHUÿH‰ßH‰ÆèÆD+ÿH‹\$H‹l$HƒÄÃDHw‰ÑH‹l$H‰Ú¿ H‹\$HƒÄéffffff.„ƒút ƒú t¸ÿÿÿÿúéfDºéfDAWAVAUATE1äUSHƒì‹ƒø~nƒÀD‹5L‹=‰D$ »ë'„D‰ò¾H‰ïè…ÀDEãƒÃ;\$ t+DkþD‰òL‰þIcíHiíXHÅH‰ïè…ÀuºEeHƒÄD‰à[]A\A]A^A_Ã@ƒútƒú tóÃ@H‹H‰H‹FH‰GˉÃff.„SH‰ûHì dH‹%(H‰„$˜1Àè‹CH‹ƒøf‰t3ƒø „ÒH‹ ¿º¾è¿èD‹H‹=º‰‹HƒÇ‰H‹CH‹0èH‹HƒÀH‰H‹HƒÀH‰‹=HT$ Ht$ÇD$ €èH|$º.¾è1ÀH‹”$˜dH3%(uoHÄ [Ë…Òx`‹…ÀxV‰H‹CH‹=‰º H‹0HƒÇèH‹HƒÀH‰H‹HƒÀH‰éKÿÿÿèH‹ ¿º¾è¿èAWA‰ÿAVAUATUSHƒìXH‰T$ ‹H|$0dH‹%(H‰D$H1ÀH‰L$(èAÿÿÿ‡øMcÿK¿HÁãD‹ƒE…À„Ý‹»Çƒ…ÿ~èǃK¿L‹d$(D‹-¾HÁâ‹‚D+¢‰D$Lct$H‹D$ H+‚D‰êIiÞXiÀ@BH«AÄH‰ïè1Ò…ÀH‰\$„žfDHj‰T$H‹T$Ht$0H‰èHÁàHœD‰êH‰ßè…Àt!D‰ê¾H‰ßè…À„XHƒýH‰êu¯IiÖXD‰à+‚‰‚HÂ…ÀˆIiÆX‹¸D‰ …ÿަIiÆXHD;` }D‰` IiÆXD; ~D‰ IiÆX‹H;P~‰PIiÎXD‰â‹‹±H™D‹D‹‰H©)ƒÆò*ÊD‰â‰±ò*Þò*ÀòX f(Ñò^ÓòXÂòH*‘ò,À)‰ò*ÂòYÁò^òXÐòH,ÂH‰D‰ÀD)ȉÂÁú÷þ‹‘AÁBD‰‰ÁøA)ÀDƒþ‰‘~Uòò*f(Ëò$ò\Êò^Ëèò*Kò$òD$ò^ÑòA*Äf(ÊèòYD$ò,À‰EIiÖXK¿‹Å+‚ǂǂÇ‚=Èv:‹|$D‰æèfDH‹D$HdH3%(…HƒÄX[]A\A]A^A_ÃDMiöÖH˜‹|$D‰æJD04D‰$…èë´@Ht$0D‰êH‰ïèH‹”$‹|$H‰îH‰“H‹”$˜H‰“H‹”$ H‰“H‹”$¨H‰“H‹”$°H‰“H‹”$¸H‰“H‹”$ÀH‰“H‹”$ÈH‰“H‹”$ÐH‰“H‹”$ØH‰“H‹”$àH‰“H‹”$èH‰“è‹H»Ht$0èH‹„$H‰ƒH‹„$˜H‰ƒH‹„$ H‰ƒH‹„$¨H‰ƒH‹„$°H‰ƒH‹„$¸H‰ƒH‹„$ÀH‰ƒH‹„$ÈH‰ƒH‹„$ÐH‰ƒH‹„$ØH‰ƒH‹„$àH‰ƒH‹„$èH‰ƒéüÿÿHˆD‰ D‰ D‰ HǀǀǀǀÇA é üÿÿ€÷؉B éÜûÿÿfDHt$0D‰êH‰ßèHcD$H‹T$H‰Þ‹|$H@HÁàH„H‹”$H‰PH‹”$˜H‰PH‹”$ H‰PH‹”$¨H‰P H‹”$°H‰P(H‹”$¸H‰P0H‹”$ÀH‰P8H‹”$ÈH‰P@H‹”$ÐH‰PHH‹”$ØH‰PPH‹”$àH‰PXH‹”$èH‰P`èéæúÿÿè„AU1Ò¾ATA‰üUSHì(‹=dH‹%(H‰„$1ÀAD$ÇD$‰D$è…À‰Ãˆ²Ll$1À¹H¬$L‰ïóH«H‰ï±óH«‹ƒøf‰D$f‰„$„"ƒø „iº€L‰î‰ßè…À… HT$ L‰î‰ßÇD$ €è…À…HT$1À¾!T‰ßÇD$è…À…à‹ƒø„aƒø „·D$fƒøt%fƒø tè¿è¿èfDD·l$D‰çfAÁÍE·íD‰îMcíOd­èIÁä1öI¼$躀H‰î‰ßA‰œ$èH‹„$dH3%(…€HÄ([]A\A]ÀH‹5I}ºHƒÆèH}‹H‹5è·fÁÈf‰„$’é þÿÿf„H‹5I}º HƒÆèH}ë®HL$A¸º¾)‰ßè…À„Äþÿÿè¿è¿èHL$1öA¸º‰ßè…ÀuÇ1öA¸¹º‰ßè…À„jþÿÿè¿è¿èè¿è¿èè¿è¿èè¿è¿èè¿è¿èèAVAUATA‰üUSHìdH‹%(H‰„$ˆ1Àƒ=„ž‹-AD$ÇD$ ‰D$ƒý~rýv޶Çvºv½v‹‹5H\$¹vH‰ßÁø1Æ)Æ@¶ö苃øt4ƒø „/1í1ÒE1öé«f„Ǻ½똋D‹H{ H‹5ºÆD$EfÇD$fÇD$A¾ˆD$‰èfÇD$fÁÈE…ÛEÅHƒÆ½f‰D$‹D$ˆD$‹ˆD$èH‹5H{ºèº‹ƒø„ÿE1íƒø„[‹ƒø„ìƒø „“‹‹Áø1Â)ÂL‹‹=1ÉHcÒA‰éH‰ÞèÁè„Àt%D‹ E…Ét苃øZ„˜ƒø„ÇH‹„$ˆdH3%(…HÄ[]A\A]A^ÃfDƒ=…`ÿÿÿ‹=HL$ A¸º¾)è…À„8ÿÿÿ¿è¿è€ƒ=„“‹‹¹ÿÿÿÿÁø1Â)‰ÐÑøt$ƒè1ÉH|CH‰Ø·0HƒÀñH9øuò‰ÈÁèÁ÷Ñf‰L$é×þÿÿ€McîIÝfAÇEèf=ÿD‹F‹fÁÈfA‰E‹Áø1Â)ÂfD)òE…ÒfA‰Uu fÁÊfA‰UD‰çèfA‰E·À1öH€H<ÅèA·EfÁÈfA‰Eéþÿÿf„McîIÝAˆUAÆEfAÇEèD‰çfA‰E苉ÇfA‰E‹Áú1Ð)ÐD)ð‰ÂÁêкÿÿÿÿÑøt*ƒè1ÒItEL‰èfD·HƒÀÊH9ðuò‰ÐÁèÂ÷Ò·ÇfA‰U1öH€E1íH<ÅèékýÿÿfDD‹d$E…ä„_þÿÿ¿ è‹T$ ‹ L‰îD‰ H‰Ç‰P¶T$ˆP A·Uf‰P ‹Áú1Ñ)Ѻ D)ñèfA‰Eé þÿÿD‹‹1ÉL‹‹=A‰éH‰ÞÁø1Â)Âf‰T$HcÒè…Àˆ4ýÿÿÇé%ýÿÿ@èé!ýÿÿ‹=HL$A¸º¾)è…Àu½º€E1öéRüÿÿHcÕéVûÿÿè¿è¿èffffff.„AWAVAUATUSHƒì‹=;=}(‹…Àˆ‰‹…Ûˆ0‹=è‹D‹51ÛD‹-L‹=ƒèD9ð‰D$ }U‹l$ 1Û„LcåD‰ê¾MiäXIÄL‰çèD‰êƒøL‰þL‰çƒÓè…À¸D؃ÅA9î¹IcþD‰êL‰þHiÿXHÇè…Àt9ƒû4‹ƒèA9Æ}&AƒÆ1ÀD‰5HƒÄ[]A\A]A^A_Ãf.„‹D$ AƒÆD‰5‰HƒÄ¸[]A\A]A^A_Ãè¹äÿÿÿ+ ‰ÂÁú÷ùƒÂ‰éÂþÿÿèò*Àò^òYòXò,À÷؉éžþÿÿS1ÒH‰û1ÀA¸ëfHiòXHƒÂL‰ÁHÆHúH‰÷óH«uÜH‹‹SH‹=f‰H‹CH‹0è‹Cƒøt*ƒø tLH‹ ¿º¾è¿èH‹CH‹=ºH‹0HƒÇèè[éH‹CH‹=º H‹0HƒÇèè[éfff.„HcÁH‰\$ØH‰l$àD¶L‰d$èA¹L‰l$ðL‰t$øD¾T¶\D¶\E!ÁEÑ…LAÀøA€ø…>D¾ÃE¾ÛAÁàEØ„)DAA9øD¾D¾\D¶LAÁàAØAƒø†ú€|…ïA€ù…åAƒèAÁèA¾ØDˆBX…ÛŽÍA9ÇŒÂDi Da i I‰ÑƒÁ E1ÒE1Àë+f„D9ÃŽ—‰ÈHƒÂIƒÁ9ÇF…H|~G"H˜AƒÀ¾McÛIóE¶3Áà %ðAÀþAƒæIÆC*AêMcÒH˜¾Áà%ðLðH‰A¶ÐøƒàAˆA@A¶ƒàAƒøAˆAPB¶AˆAHŽjÿÿÿf.„H‹\$ØH‹l$àL‹d$èL‹l$ðL‹t$øÃfDH‰\$ØH‰l$à1öL‰d$èL‰l$ðL‰t$øHìH|$`Æ„$ØdH‹%(H‰„$è1À苃ø„Zƒø „!L„$1í1ÛE1íE1ä‹=LL$|H´$€1ɺv苃ú„ÁE1öƒú ti‹ ƒùtvƒù„%ƒù„ H‹„$èdH3%(…²H‹œ$ðH‹¬$øL‹¤$L‹¬$L‹´$HÄÃDƒøL´$€v§‹ ƒùuŠA¶9Ùt9Íuƒú„Ó1Ûƒú „H·;fÁÏ·ÿé¸f„ƒøL´$”‡6ÿÿÿéNÿÿÿf.„L„$ÇD$|½»A½M`éÈþÿÿ€L„$ÇD$|½» E1íM`é›þÿÿf.„A¶9Ùt9Í…Ôþÿÿƒú„×1Ûƒú „L·{fÁÏ·ÿ…ÿ„­þÿÿH‹„$€H‹T$`L‰æH‹L$hH‰$H‹„$ˆH‰D$H‹„$H‰D$H‹„$˜H‰D$H‹„$ H‰D$ H‹„$¨H‰D$(H‹„$°H‰D$0H‹„$¸H‰D$8H‹„$ÀH‰D$@H‹„$ÈH‰D$HH‹„$ÐH‰D$PH‹„$ØH‰D$Xèéûýÿÿ€A¶D9étW9Ë…ãýÿÿƒú„fƒú u>ƒø7†Éýÿÿ=ŒL´$°~&H”$€H´$€¹ˆ‰Çèf.„A·^èf9Ã…ýÿÿA·~éÂþÿÿƒø7†kýÿÿ=ŒHœ$°Ž˜þÿÿH”$€H´$€¹ˆ‰Çèéwþÿÿƒø7†+ýÿÿ=ŒHœ$°ŽœýÿÿH”$€H´$€¹ˆ‰Çèé{ýÿÿƒø7†ëüÿÿ= Hœ$°ŽþÿÿH”$€H´$€¹œ‰Çèé÷ýÿÿƒø7†«üÿÿ= Hœ$°ŽýÿÿH”$€H´$€¹œ‰Çèéûüÿÿƒø7†küÿÿ= L´$°ŽÄþÿÿH”$€H´$€¹œ‰Çèé£þÿÿèfffff.„¸A¸D‹…É~‰ÊM‰ÁÁúIÓáHcÒL ×;|ƒÁ‰HƒÀ(H=uÓóÃAVI‰þ1öAUATE1äUS»HìàH|$`Æ„$ÈdH‹%(H‰„$Ø1ÀèH‹D$`Liè@BLl$hë:@H‹CðL‰êHiÀ@BHCøH)ÂHcH9ÂwoAƒÄHƒÃ(Aü„*‹+…í~å‰è‰éÁøH˜I‹ÆHÓø¨t°º¾‰ïèƒøtB苃øot6ƒø t‰‰ïèÇéwÿÿÿ€‰ïèÇë‚f„H‹D$pH‹T$`D‰çH‹L$hH‹5H‰$H‹D$xH‰D$H‹„$€H‰D$H‹„$ˆH‰D$H‹„$H‰D$ H‹„$˜H‰D$(H‹„$ H‰D$0H‹„$¨H‰D$8H‹„$°H‰D$@H‹„$¸H‰D$HH‹„$ÀH‰D$PH‹„$ÈH‰D$Xèé¥þÿÿDH‹„$ØdH3%(uHÄà[]A\A]A^ÃèS¹1ÀHì Ç„$œH‰çüóH«H´$œH‰çHÇ„$€HÇ„$ˆè‹¼$œL„$€H‰â1É1öèH‰çèHÄ [à è€Couldn't get fd's flagsCouldn't set fd's flagssetsockopt(IP_HDRINCL,1)Could not open IPv6 socket net_open bad address type socket()bind()getsockname()ioctl FIONBIOsetsockopt IP_TTLsetsockopt IP_TOSunknown AF?setsockopt IPV6_UNICAST_HOPSsetsockopt IPV6_CHECKSUMnet_reopen bad address type Gmtr: bad interface address: %s mtr: failed to bind to interfacesockaddrtop unknown address type $tIY@@@ð?€„.AffÆÿÿÿßAào@p@¢(8intiŽi•i—i´i¯ÀF"-nžÔMK M†#N‘# 7i € C- K-# = M N ¯f M #¶  (·       €€ € ? ²ë ´·# µë# ¯û M € ¿2 Á·# ÂM# Ã2# ¯B Mo 8R M 18 2? 4F 8M !C         ! ) + , . / 2 3 : ; < Ü â ç ì „ ˆ ÿ € a] h Žt N# Èž Êž Ì® ; R® M ]¾ M hÎ M Æé Ït# á. ã·# äC# åY# èB# ï ñ·# òC# óh# ôÎ# õh#‡¯1—Ødb#©#©#©#©# ©#(©#0©#8©#@©#H©#P ©#X"¢#`$¨#h&b#p*b#t,p#x0?#€1T#‚2®#ƒ6¾#ˆ?{#Hœ#˜Iœ# Jœ#¨Kœ#°L×#¸Nb#ÀPÄ#Ä´º¢»¢#¼¨#Àb#k— ¯¾ Md ¯Ô Mbà8?,F8Ω etg©#h#ib#jb#k#Â`Ë‚Ë#expƒÛ#@ttl„Û#Hs…V#P†¯#X MÛ M ïë M b(      é.2†3ï#4ï#5ú#id6ú#7ú#;Ë<ú#=ú#>ú#?ú#C Dú#Eú#seqF# JU K#L#Mï#Nï# lenOú# Sí Tï#tosUï#lenVú#idWú#Xú#ttlYï#Zï# [ú# \# ]#Xn3 o#p3 #qb#rb#”sb#˜uptb#œvaruO# vb#¨wb#¬xb#°avgyb#´zb#¸{b#¼}b#À~b#Äb#È€b#ÌC #Ђb#ðƒz#ø„S #Ø C M bS MÇ zc M(ˆ¶ ‰b#Šb#‹b#Œâ#b# JÜ fdJbMbMœ MœMbM×ábN áœszábchãN sumäF?`b ` ` Œ8œº 8œ8Ú8×v©ï v©vv×!•b- a•©b•©af•b"rc–b1œb 1œ1Ú1×#§‘ a§©b§©af§b#pÏ atpbseqpbmspb"idxrb#¶anum¶b$¶©$¶a$¶b"i¸b¹F¹F¹F¹FºÁºÁzA̽AbAœ__nA×AbBtB½f%¶ ó&Ä 'Ï (Øbw')Øá* wh&# &. '8 'B +ôbo)ôœ)ôœ)ôb)ôb,öF-‚,÷o,ú‡,û‡../  &. &# 0'8 'B ¯‚1MØM †2eÆwÆ3atebU2kÆw4atkb4ikb2pœwB3atpbU2uœwƒ4atub3iubT2zbw¸4atzb2ƒbwí4atƒb2‰bw"4at‰b2bwW4atb2•bwŒ4at•b2›bwÁ4at›b2¡bwö4at¡b5§b,4at§b2±bwa4at±b2·bw–4at·b2½bwË4at½b2Ãbw4atÃb6Þbw2äbwV4atäb2êbw‹4atêb2ðbwÀ4atðb2öbwõ4atöb6ü©w7wG8atb5[b}9]b‘l6ƒbw:óÚ8atõb"iöb5bH;©8lenbB6Qbw2WÔwº3atWbU:]ì8at_b:h4athb7 w`; b4seq b5b½;b9b 8seqb*‘ wü&  &« ?· Q' :{o;{t;{©4len{×8sa4|(8sa6~.*ï wô& & & @! <ï •& & AB! = 5Éb:8atËb8maxÌb*b wl?q U?{ T?… Q5¢bÔ;¢Ô9¥û‘à~9©t‘à~Ÿ8lenªf!:5Ñ4seq5bC5z‘;5œ3now5â‘.7b.8b.9b.:b"i;b9=Ñ‘ /‘ ž&· =« &  0' ¯á M:*;*bDttl,b‘´}8s,bDopt-b‘¸}..b9/û‘À}90û‘À~91(‘À}Ÿ92.‘À}Ÿ93(‘À~Ÿ94.‘À~Ÿ8len5fEï8__v†?8__x†?A8__vO?"__xO?:—™;—b9Ÿ™‘Ð\8ip ª.¡°8udp¢.£‡.¤ú8rv§b9¨b 8ttl©b.©b.©b.©b.¯bFÜ µT& =ú &ï ExD__vÈ?P"__xÈ?F »&. &# 0'8 'B Gí8__vø?"__xø?G#8__vû?8__xû?GY8__vÿ?8__xÿ?/ ì&. &# 0'8 'B ¯ªHMuU 45 bû. b8i b:Õ=;ÕÔ8at×b*Ï w- ?Þ U&ê &ö &B''$'0B<BHBT<Ï ¶&&ö &ê &Þ A'BB$B0'<'H'T:¦"9¨™‘àZ9ªû‘à}9«.‘à}Ÿ9¯t‘à}Ÿ9°(‘à}Ÿ.±f8num²b.³°.´.µ"Dnow¶â‘ÀZ.·Æ.¸b.¸b.¸b.¹b9¼z‘à~IgÓµ!&±&¦&›&&…&zGë!8__v[?8__x[?A8__v6?8__x6?Ë7Ýw€"CÝ€"UCÝÔT8atßb8fdßb=:ë%#;ë€"8atíb8fdíb8ríbDnowîâ‘Ð~.ïs.ïs9òz‘à~:“#9=‘Ð~9b‘lDtvâ‘P0bbJ¥¨J¦¨J§¨J~Kšb  í ì# MÿKœÜ#  c $HMÿÿK$ Kžâ J¡bJ¢bJ£bJ¤bJ¥bJ¦bJ§bJ¨bJ©bJªbJ­ûJ®ûJ¯.J°.J¶tJ·tJ¸(J¹(J»ÆJ¼Æ ¯P% M-JÀ@%KÈb KÉb JËbJÌbJÍbKÎb JÏbLtosÐbLafÑbJÒbJÓbJÔbJ¥¨J¦¨J§¨M~ M b M¡b M¢b M£b M¤b M¥b M¦b M§b M¨b M©b Mªb M­û M®û M¯. M°. M¶t M·t M¸( M¹( M»Æ M¼Æ MÀ@% JËbJÌbJÍbJÏbLtosÐbLafÑbJÒbJÓbJÔb% : ; I$ > $ >   I : ;  : ; I8  : ;  I !I/  : ;  (  : ;  : ;  : ; I&I : ; : ;I8 : ; & : ; I8  : ; .: ;' : ;I4: ;I.? : ; ' I 4 : ; I.? : ; ' I : ; I4: ; I !.? : ;' I "4: ;I#.? : ;' $: ;I%.1@&1'41(.? : ; ' I@ ): ; I*.1@ +.? : ; ' I@,4: ; I-44 I.4: ;I/1RUX Y0 U1!I/2.? : ;' I@ 3: ;I 4: ;I5.? : ;' I@6.? : ;' I@ 7.? : ;' @ 84: ;I94: ;I :.? : ;' @;: ;I<1X Y=1>.? : ;' @?1 @41 A B41C: ;I D4: ;I E UF1RUX YG H!I/I1X YJ4: ; I? < K4: ; I L4: ; I? < M4: ; I?  w,w,0w01w1@w@AwAKwU,S-1S;ASP Q;JP\dapŠUpwTw~t1&1Ÿp—U—™u~Ÿ™²UpŠ0Ÿ™¦Q¦©PÀÁwÁÄwÄîvîïwïôvÀ(U(ç\ïô\ÀèTèåSïôSÀQ.]À=RÒ”_Ò”  $ %1Ÿ~ ðäw ðïôw ð>äw ðŸïôw ðŸ>ç\ïô\>é]ïô]>åSïôS‹”_”œ1&1Ÿ‹äw ðŸïôw 🋩w 🩸^¸º~~Ÿºë^ïô^‹©0ŸºÇQÇÊP -U 1T`mU€ŒUÐÚUðúUU0:UPZUpzU—w—ÞwÞßwßêw UðúUU0:UPZU€ŠU ªUÀÊUàêU0Ÿ01w1IwI w  w ww  ®w®¦w¦²w¸Í0ŸÀÆwÆww¢w¢£wÀËUËS¢SÀë0ŸŒ0Ÿ6X Ÿ°´w´ w w $ w$ % w` a wa d wd m wm ² w ² ³ w³ ´ w´ µ w` m 0Ÿ• ´ VÀ Á wÁ ë wë ì wÀ Ø UØ à Sð w Uð " T€ w ¨ w¨ © w€ ¤ U‡ ¤ ¤ ¨ S¨ © P° Ï U° À TÀ Þ Tà î wî / w / 0 w0 Z w Z ` w` | w | wà  U0 3 U[ s Us € txŸà ý Tý + S0 Q S[ x Sx € Qà  Q & V0 7 Q7 V V[ n Q0 3 U[ s Us € txŸ © Uª ¹ U © Tª ¹ T ¥ Qª µ Q  © T  © UÀ  wÂ Ä wÄ Æ wÆ È w È Ì w(Ì Í w0Í Ñ w8Ñ N wÐN R w8R S w0S U w(U W w W Y wY [ w[ \ wÀ ø 0ŸÀ ø 0Ÿ  \ ‘ w‘ › w› w° ž wž   w  /w° ² U² ž SŸ /Sh Ÿ ‘Ü~ ‘Ü~02w27w79w9;w ;<w(<=w0=Aw8Aˆwˆ‰w8‰Šw0ŠŒw(ŒŽw Žw’w’˜w˜˜w0QUQj_““_0jTàô q"ôj‘Œ““‘Œ j\““\ñ r".ñ r"Wj\“¼\Wj‘Œ“¼‘ŒWiP“­P ¢w¢«w«¯w¯°w °·w(·BwÐBCw(CDw DFwFHwHPwPÀwР½U½õ\õùUI»\ê÷P÷CSIÀSêð]ðùTùH]»À]`I‘¼}¿W‘¼}p¢‘¼}»À‘¼}æð]ðùTùH]»À]Øù‘Â}Š—PÀÂwÂÄwÄÆwÆÊw ÊËw(ËÒw0ÒÙwÀ#ÙÚw0ÚÛw(ÛÝw ÝßwßáwáèwèñwÀ#ÀGUGh\âE\‘Ý\Œ”U”Ø\Ýñ\ò»‘Ð\ŸâŒSšÐSÐØ‘Ð\ŸÝñSò=0Ÿ‘60Ÿ6À]šØ0ŸÝñ0Ÿò=0Ÿ=»]â‘]‘ž0Ÿž']'Ò0ŸÒŒ]šØ0ŸÝñ0Ÿòh0ŸâE0Ÿ‘ð0Ÿð0PšØ0ŸÝñ0Ÿª¾P…ˆPuŒP Œ‘È\šñ‘È\ò–0Ÿ–"DŸ"»^âŒ^šØ0ŸÝñ0Ÿò0Ÿ"8Ÿ"=Q‘©Q'JQšØ0ŸÝñ0Ÿò0Ÿ"@Ÿ"»VâŒVšØ0ŸÝñ0ŸŒ‘Ì\šñ‘Ì\.VQ.w‘Ð\Ÿ–»‘Ð\ŸâŒSšÐSÝñS]pq1&1Ÿ]‘S]pSpwPwyp~Ÿy€P]p0Ÿy…RÈÓPÓø}ìñQèìQìñ}'P'}e|”~Ÿ|ƒp1&1ŸeÀ]e’]’ŸPŸ¡p~Ÿ¡¨Pe’0Ÿ¡­Qwwww  w(  w0 w8 wÐ  w8  w0 w(w ww w 9wÐ9?w8?@w0@Bw(BDw DFwFHwHIwI wÐx0Ÿ°ÇSI 0ŸpxPxÇV ¡w¡HwHMwMowotw ®U®HSMoS ®0Ÿ€ÄTg *!T€g Q€_ R_ g pxŸg !}wŸ’F tp"”4&8$8&Ÿ’F tp"”?8$8%pt"#”8$8&"Ÿ¸F "pt"#”8$8&8$pt"#”8$8&"Ÿô_ R_ g pxŸg !}wŸôg Qô!Tô!U; g 0Ÿg ’ Xœ !X / X/ 3 xŸ F pt"# F pt"#F \ Y0!R!wR!:"w &:"@"w@"Â%w &¡!¦"‘ÜZÀ"Ù"‘ÜZð"Â%‘ÜZÀ!ô!P;"x"P‡"¦"P#4#Pù#U$P}$·$P½$÷$Pý$7%P=%w%P}%·%Pr!×!0Ÿ×!ô!^;"M"0ŸM"X"‘àZŸX"‡"^‡"#0Ÿ#+$^+$V$‘[ŸV$‰%^‰%–%‘[Ÿ–%½%^r!ô!0Ÿ;"4#0Ÿ4#?#Sù#‰$0Ÿ‰$–$‘[Ÿ–$½$S½$ %0Ÿ %%‘[Ÿ%=%S=%½%0Ÿr!ô!0Ÿ;"x"0Ÿx"‡"S‡"?#0Ÿù#É$0ŸÉ$Ö$‘[ŸÖ$ý$Sý$I%0ŸI%V%‘[ŸV%}%S}%½%0Ÿr!¡!0Ÿ¡!#"\;"¦"\¦"À"0ŸÀ"Ù"‘è}ŸÙ"ð"0Ÿð"#‘ä}Ÿ#Â%\r!¡!0Ÿ¡!+"];"¦"]¦"À"0ŸÀ"Ù"ŸÙ"#0Ÿ#Â%]r!¡!0Ÿ¡!ô!S;"o"S‡"¦"S¦"À"0ŸÀ"Ù"3ŸÙ"ð"0Ÿð"#;Ÿ#+#Sù#e$Sý$%S=%V%S}%½%Sr!¡!0Ÿ¡!"V;"¦"V¦"À"0ŸÀ"Ù"1ŸÙ"ð"0Ÿð"#3Ÿ#Â%Vr!ô!0Ÿ;"‚"0Ÿ‚"‡"U‡"?#0Ÿ?#ó#Uù#x$0Ÿx$}$U}$½%0Ÿ¡!¦"‘ÜZŸ#Â%‘ÜZŸ¡!¦"‘à}Ÿ#Â%‘à}Ÿ¡!¦"0Ÿ#Â%0Ÿ¡!¦" vŸ#Â% vŸ¡!¦"‘àZŸ#Â%‘àZŸ¡!¿! "‡"Ux"‡"s<#?#U4#?#sÐ%Û%0Ÿâ%&p&&pX&&w&&w&&w&&w & &w( &,&w0,&â'wâ'ã'w0ã'ä'w(ä'æ'w æ'è'wè'ê'wê'ë'wë'ð'w&1&U1&ê'^ë'ð'^b&d&0Ÿ&ž&\Ã'æ'\ë'ð'\d&ž&V &È&sÈ&ä'Vë'ð'VÉ&Ò&Pb&è']ë'ð']d&‰&sp @Bsx"Ÿñ&þ&sp @Bsx"Ÿð'ñ'wñ'ÿ'wÿ'c(w°c(d(wd(e(w,e(‹¢¤Ñ‹¢¤Ñ,9W^˜¡¨µ,9W^˜¡¨µØÞáæ:GRWÐÒÙÝQV]fhmp‡QV]fhmp‡uˆŠ˜¯uˆŠ˜¯ñ'ø' ((t û /usr/include/x86_64-linux-gnu/bits/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arpanet.cstring3.hstdio2.hsocket2.htypes.htypes.hstddef.htime.hselect.hsocket.hsockaddr.hstdint.hin.hstdio.hlibio.hmtr.hnetdb.hnet.hnameser.h É'yt5Y\idæz †yä»»ˆuxA) ¬m÷É Xs<Ëcæ!eYÝ~£< <v<Ý~¬§XLV=’Ÿ°ƒ‘‘a‘ žrJ.vº!fÜ/óö»?óõ»?=-i22­Nóöóöóöóöóö;N+!/Tóöóöóöóò‘xóöóöóöóöö†¹…ÓJ'çvXKˆZ,hi=ãg^ztl–=-g Jw.\=-g•p¬Ÿf ¡ X*Oyòm*+iz‚ f*z.lv‚XÕ¬au%zäyµ Jguu tv.uuuuuuƒuuu„ã…mt-uKYš •U ?0É;=Ȱ*•qtug²v‚Ð žtäÉ#Ÿ[KŸ­®žYŸ­®ŸIåööóö","VwÙu<¦ X=ÙuJ© X;ré$!/Y¡wf:>rןxÀ~f¿X›N*Ú/ŸÌ$hV@,æ[ʬó…xÜz²w¬åžkäh¸ggIg»! ñƒYBhÖž£gªh!!XwXÚžúz¬ Xs¬ JZË¢d KY¡L\zº rPT¾šjp@ ºtX ºGM(ñ€L:.»ƒvdv‚.Kòvu>v;eÎspu,>K9h­K-gçÊd>:v’:h/&gsvxÕJ§zÈŸŸØž«zt!×(¨zØt¨zÈ»¬óƒs¬[g¹­Ly'yòóŸs 3ž‹}È.rtÖrf .vX ‚LY-/l•~Xìt”~‚íÖi9Y„ämƒÏÕƒÎt YŸzò fw< =Y1œ„Y³,ƒP!/Óƒ)t$YŸpÈ¿óYŸcžYŸ žYŸwžYŸ]žYŸמ\ /Èyf\~QYº> }à‚ }¬âXr< JXg|vò[uztiK3o¦NtX[ƒ¢YLX¾äÂ<t6¼. ‚Ÿg-Ë(ŸiÈÖ}ºªXÖ}t®fÏ~<±.üX×}<ªÖY^ºguZ¢p?e‘;Y/’ÉY×fÖgKYuY;YYeuü}òu®Ï~<±.Ó~Ö…Ö:Z´fÌ<ɬנMŒ@9=ƒ‘)»I»„ƒî~.Y>X$WzX[‚ý‚«XŸ°‚Ü× Öh×lZcÈ.cÈžúy€sJ†WWeNtº†WW;NÏ䂃ã.*¬ƒ‡¹•ƒ—T†/&1È—T†g$—T†gD$ T†g$ T†g¨$ T†gçòü.]ª/K!K‹Š@ Xw. Jt< .vX tVy‚ .YfK;­päK/J=X¼Yu&uv¸(%ov¯wª»»YŸƒ socklen_t__streamaddrsIPPROTO_EGPsize_tsrcportsa_familysendsock4_icmpoldflagssockaddr_in6sourcesockaddr__ssize_t__fmtnet_jintasin_familysin_addr_IO_save_endfromsockaddruint32IPPROTO_MTPjworstheaderSOCK_RAWobj_hdr_classsin6_addrmtrtype_IO_write_baseIPPROTO_ENCAPbatch_atIPPROTO_ROUTING_lockjavgnet_gmeantypemaxTTLext_verlocal_IO_save_baselocal6_chainssize_toldjavgsaved_seqss_family_cur_columnnet_lasttimeIPPROTO_UDPnet_set_interfaceaddressremoteutimeSOCK_DCCPlong intSOCK_RDMmemmovenet_send_querytotusecns_s_nsremote4remote6zerou_charnet_harvest_fds_IO_markerudpheaderrecvsocknet_save_incrementunreachabletypefromaddressnew_sequenceechoreplytypenet_openpheaderin_addrsigned charuint8_tnet_javgIPPROTO_IGMP_IO_FILEsavedtimestampSOCK_SEQPACKETns_s_prtsize__fds_bitsunsigned charh_aliasesnumhostsaddrcopymplslensaved_seq_offsetns_s_qd__off64_tUDPHeadersin6_scope_idmaxfdgmean__socket_typesendsock6_udpIPPROTO_IPcalc_deltatimecharSOCK_STREAM__ss_alignstrncpyrecvsock4recvsock6net_xmitset_fd_flagsnet_max_IO_lock_text_resIPPROTO_PIMsockaddr_intimevalmplsnet_resetsin_portIPPROTO_IPV6h_addr_list_IO_read_ptrtcpheaderbitpatternremotesockaddrsin6_port_pos__socklen_tstdinnet_localaddrfstTTLnet_add_fdspacketsizeworstsin_zero_markerssendsocksendsock4sendsock6fromsockaddrsizecpacketsizersa4unow__fd_maskremoteportudpdataext_chkhostenttv_usecudppin_addr_tIPPROTO_NONEobj_hdr_lennet_dropns_s_ud__flagsdsize_offsetindexTCPHeaderprependlocal4IPPROTO_DSTOPTSh_nameIPPROTO_ICMPIPPROTO_ESPIPPROTO_UDPLITEunspec_addrlong unsigned intchecknet_mpls_flags2waittimeh_lengthIPPROTO_MAX_IO_read_baseIPPROTO_HOPOPTSns_s_maxIPPROTO_RAW_unused2net_reopenremoteaddresslocaladdr_old_offsetnext_sequenceIPPROTO_RSVPxmitn_unknownjintanet.ch_addrtypenet_save_xmitsalen__u6_addr8__chprotocolsent__srclong long int__d0__d1name_structnet_save_returnIPPROTO_ICMPV6double_IO_write_end__u_chardecodemplsnet_minremotesockaddr_structtimeoutfloatnet_avgIPPROTO_DCCPns_s_znaddr_IO_buf_basenet_send_batchudp_checksumunsigned intsaddrIPPROTO_FRAGMENTdaddrnet_process_returnsendsock6_icmpsendsock4_udp__pad1__pad2__pad3__pad4__pad5_sbufnet_jitterechotype__suseconds_toldavg__fdSOCK_NONBLOCKnet_waitfdlabelssequencerecvfrom_flagsoffsetnet_preopenportfirst_modein6_addrIPPROTO_TP__addrudppheaderBSDfixtrueoptsin6_familyFILEnet_transitchecksumSOCK_DGRAMfromsockaddr_structnet_mplssnet_addrudatatimeexceededtypeIPPROTO_SCTPicmpIPPROTO_PUPjitterlong long unsigned intsa_family_tnet_process_fdsnet_stdevlengthuint16_t__off_tnet_send_tcpnet_upIPPROTO_IDPsa_datasockaddrtopsourceaddressns_s_anns_s_arsockaddr__time_tmemsetversioniphsize_IO_backup_basebest_shortbufpsizenet_saved_pings_next/home/wolff/mtrIPPROTO_GREcodeIPPROTO_COMP_IO_buf_endfragresetInterfaceAddresshostSOCK_CLOEXECnamenet_process_pingnet_closefprintfuint8__bufSOCK_PACKET__ss_padding__lensockaddr_storagestderrshort intnethostuint64_taddrcmpICMPHeadercsumpacketnet_addrsnet_worst__addr_len_vtable_offsetstrptrip_t__destmplssrsa6ssa4ssa6fd_setsave_sequencepacketsocketmypidUDPv4PHeadertransitreturnednet_bestmemcpywritefd_IO_read_endcontentIPPROTO_IPIPGNU C 4.6.1s_addrnet_selectsocketsourcesockaddr_structnet_returned__u6_addr16IPPROTO_TCPobj_hdr_typeuint32_t_filenodstport__ns_sectaddrcpyshort unsigned intstdout_IO_write_ptrnet_lossnet_jworstIPHeaderlabel__u6_addr32fsa4fsa6sin6_flowinfonet_end_transitdatatv_secuint16in_port_tlast__in6_uIPPROTO_AHGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx $KAƒk D A O ADXB,l4A†C IŽMŒDƒ A œ°ÄØìP(<PdxZGG A ”¨¼Ðä ø  4H\ pìAƒX À CD ”v¨NƒøÄãFƒ~ D šäuD] O D$,UA†CƒI EAAT,Aƒjpˆ„)Aƒg 0$´¡N †ƒA A j F \Ü*DðœBBŽB B(ŒD0†A8ƒDP}8D0A(B BBB8%$LŸAƒJ° AB LthBEŽB B(ŒA0†A8ƒDG 8A0A(B BBBF <Ä BIŒD †A(ƒGЋ (A ABBH D1BŽBB ŒD(†A0ƒGÀ# 0A(A BBBG `L BBŽB B(ŒA0†A8ƒDPý 8A0A(B BBBK Y 8F0A(B BBBA °ÔAƒ§ E bЪrŽŒ†ƒ$ì’b &ŽŒ†ƒè F ?D(àBŽGB ŒD(†A0ƒL¶ 0A(A BBBA puAƒN°dA.symtab.strtab.shstrtab.rela.text.rela.data.bss.rodata.str1.1.rodata.str1.8.rodata.cst4.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @e(øÎˆ,+¨(<&€û1) X/ 62)1E28*jT¤*a¨*@sè*¦(nüL ŽSB’ÐWp8H¨ ¢@0ÀH0±pàÄP“x ¿ðHÐ0Èœ Û0h«+ä“«ù˜«ôI(²0º& 0ÉÂñÿK0$(X)X/2(;X/A4TX/_X/f8    qv { € … ‹ ‘ (— 0 8£©°P¿pBÈÀ4Õàçø  @`€P'Ð0ð9B0LPTp^Zhmðxƒ0ŒP–p ž¥€² »ÀÇàÎÜòÿ .æö0ì òÿòÿ"òÿ0;òÿEòÿO v`hòÿr |‚À㨫ºòÿÃÈ(Í×Þìñû°uòÿòÿ"0 -òÿ6@ F` UYaÀ ,oð ˆ}€ )а 0šà ¡¦­·¿É *ÑØÀ œàçòÿõòÿ` %  Ÿ!&+òÿ9E J0h[_o  Œ’ ¨³·À1ÆÓÚëòù  Ô$€ª/0!’BKÐ%?W&àgouð'u…Œòÿ €¢òÿ €¸òÿnet.cset_fd_flags.part.0numhostshostbatch_atsequenceresetnext_sequence.7128packetsizeBSDfixfirst.7176.LC2.LC3.LC4.LC5.LC12.LC13.LC23.LC24.LC25fcntlperrorcalc_deltatimechecksumudp_checksumbitpatternmemset__stack_chk_failnet_addrnet_addrsnet_mplsnet_mplssnet_lossnet_dropnet_lastnet_bestnet_worstnet_avgnet_gmeannet_stdevsqrtnet_jitternet_jworstnet_javgnet_jintanet_minfstTTLnet_returnednet_xmitnet_transitnet_upnet_localaddrlocaladdrnet_end_transitnet_preopensocketsendsock4sendsock6_icmpsendsock6_udpsetsockoptrecvsock4recvsock6net_selectsocketmtrtypesendsock6net_resetclosegettimeofdaynet_set_interfaceaddressafsourcesockaddrsendsockbindssa6inet_ptonstderr__fprintf_chkssa4inet_atonnet_closesendsock4_icmpsendsock4_udpnet_waitfdrecvsocknet_saved_pingsnet_save_incrementmemmovenet_save_xmitsave_sequencenew_sequencenet_save_returnsockaddrtopfwriteinet_ntoastrncpyinet_ntopaddrcmpmemcmpnet_maxmaxTTLremoteaddressunspec_addraddrcpynet_openremotesockaddrexitrsa4sourceaddressgetsocknamersa6net_process_pingpowdisplay_rawpingdisplay_rawhostnet_send_tcpioctldisplay_clearconnectremoteporttosnet_send_query__memset_chksendto__errno_locationgetpidmallocnet_send_batchcpacketsizerandnet_reopendecodemplsnet_process_returnrecvfromnet_add_fdsnet_process_fdstimeoutwritenet_harvest_fdsselectremotesockaddr_structsourcesockaddr_structtimestamp &üÿÿÿÿÿÿÿ#&üÿÿÿÿÿÿÿ2 B T,`üÿÿÿÿÿÿÿä+üÿÿÿÿÿÿÿ!+üÿÿÿÿÿÿÿ:,üÿÿÿÿÿÿÿð-üÿÿÿÿÿÿÿ  (9 (L X(y X(Ž (” Ì(¢üÿÿÿÿÿÿÿª ”(ÂüÿÿÿÿÿÿÿÜ (â Ì(è ”(ü ¨( ¬(< °(\ ´(| ¸(¢ ”(´  (¼üÿÿÿÿÿÿÿÒüÿÿÿÿÿÿÿà:üÿÿÿÿÿÿÿü ¼( Ä(< À(\ È(r@üÿÿÿÿÿÿÿŒ ”(¬ (Ì Ì(ì œ( F Ì(& ÌX/RIüÿÿÿÿÿÿÿZJüÿÿÿÿÿÿÿtIüÿÿÿÿÿÿÿ‰KüÿÿÿÿÿÿÿŽIüÿÿÿÿÿÿÿ”Jüÿÿÿÿÿÿÿ¬Lüÿÿÿÿÿÿÿ±MüÿÿÿÿÿÿÿÉIüÿÿÿÿÿÿÿÑNüÿÿÿÿÿÿÿðIüÿÿÿÿÿÿÿøOüÿÿÿÿÿÿÿ 0'üÿÿÿÿÿÿÿ"Jüÿÿÿÿÿÿÿ,Qüÿÿÿÿÿÿÿ:RüÿÿÿÿÿÿÿRJüÿÿÿÿÿÿÿbLüÿÿÿÿÿÿÿlRüÿÿÿÿÿÿÿzKüÿÿÿÿÿÿÿ„Rüÿÿÿÿÿÿÿ¢@üÿÿÿÿÿÿÿ°(¹ (À (ÉX/C Ð(k X/v  ŽTüÿÿÿÿÿÿÿŸ  (© X/ÍWüÿÿÿÿÿÿÿÔXüÿÿÿÿÿÿÿíYüÿÿÿÿÿÿÿòZüÿÿÿÿÿÿÿ [üÿÿÿÿÿÿÿ"\üÿÿÿÿÿÿÿ+Xüÿÿÿÿÿÿÿ9]üÿÿÿÿÿÿÿ> M^üÿÿÿÿÿÿÿc_üÿÿÿÿÿÿÿr`üÿÿÿÿÿÿÿ{Xüÿÿÿÿÿÿÿ‘ –'üÿÿÿÿÿÿÿ¶JüÿÿÿÿÿÿÿÀbüÿÿÿÿÿÿÿÅTüÿÿÿÿÿÿÿËcüÿÿÿÿÿÿÿÐTüÿÿÿÿÿÿÿÖNüÿÿÿÿÿÿÿßTüÿÿÿÿÿÿÿåRüÿÿÿÿÿÿÿïKüÿÿÿÿÿÿÿôTüÿÿÿÿÿÿÿúLüÿÿÿÿÿÿÿÿTüÿÿÿÿÿÿÿ Oüÿÿÿÿÿÿÿ2 eüÿÿÿÿÿÿÿL Ð(e ð(… Ô(Œ Ð(‘ hüÿÿÿÿÿÿÿÍ ì(Õ güÿÿÿÿÿÿÿâ ì(   ( ˜(% 0 : Ì(K (R Z œ(k ˜(ƒ 0œ 0¡ jüÿÿÿÿÿÿÿ¼ ð(Ú ( ]üÿÿÿÿÿÿÿ H nüÿÿÿÿÿÿÿ4 oüÿÿÿÿÿÿÿC püÿÿÿÿÿÿÿÓ uüÿÿÿÿÿÿÿâ Wüÿÿÿÿÿÿÿé vüÿÿÿÿÿÿÿ w rüÿÿÿÿÿÿÿ6 (> rüÿÿÿÿÿÿÿ¯ Süÿÿÿÿÿÿÿ¹ züÿÿÿÿÿÿÿÑ ]üÿÿÿÿÿÿÿÖ eå nüÿÿÿÿÿÿÿï {üÿÿÿÿÿÿÿú Jüÿÿÿÿÿÿÿ |üÿÿÿÿÿÿÿ Yüÿÿÿÿÿÿÿ Nüÿÿÿÿÿÿÿ eüÿÿÿÿÿÿÿ( xüÿÿÿÿÿÿÿ/ _üÿÿÿÿÿÿÿ: }üÿÿÿÿÿÿÿA |üÿÿÿÿÿÿÿL vüÿÿÿÿÿÿÿR eüÿÿÿÿÿÿÿi ~üÿÿÿÿÿÿÿx F} müÿÿÿÿÿÿÿ¢ Rüÿÿÿÿÿÿÿ¬ Oüÿÿÿÿÿÿÿ¶ eüÿÿÿÿÿÿÿÁ üÿÿÿÿÿÿÿÇ YüÿÿÿÿÿÿÿØ xüÿÿÿÿÿÿÿß [üÿÿÿÿÿÿÿê }üÿÿÿÿÿÿÿñ üÿÿÿÿÿÿÿü vüÿÿÿÿÿÿÿ-üÿÿÿÿÿÿÿ ]üÿÿÿÿÿÿÿ I!nüÿÿÿÿÿÿÿ+{üÿÿÿÿÿÿÿHWüÿÿÿÿÿÿÿgxüÿÿÿÿÿÿÿ† •  › ¨Tüÿÿÿÿÿÿÿ®  ÂWüÿÿÿÿÿÿÿÇ wÑ Ø í  (rüÿÿÿÿÿÿÿE (Prüÿÿÿÿÿÿÿ\ wdrüÿÿÿÿÿÿÿ… ¨(‹ ¼(’ °(§ ”(® ¨(à  (Û °(ä °(ñ ¼(÷ À( ´( ”( (# ¼(* À(1 °(C ”(S üÿÿÿÿÿÿÿh  (t ´(„!üÿÿÿÿÿÿÿ”  (§ È(´ À(Æ È(ÐüÿÿÿÿÿÿÿØ ¸(îüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ/ 5 ð(; ˜(E œ(O Ì(f‚üÿÿÿÿÿÿÿ± (¶‚üÿÿÿÿÿÿÿÌxüÿÿÿÿÿÿÿâ ø(ñ ( ( ( (-  (< ((K 0(Z 8(i @(x H(‡ P(Œƒüÿÿÿÿÿÿÿ’Wüÿÿÿÿÿÿÿ™ (£xüÿÿÿÿÿÿÿ² X(Á `(Ð h(ß p(î x(ý €(  ˆ( (* ˜(9  (H ¨(W °(c °(j ¸(q °(x ¬(  (‰ ´(“ È( Ä(Ôxüÿÿÿÿÿÿÿõ P(Šƒüÿÿÿÿÿÿÿ”-üÿÿÿÿÿÿÿ¹WüÿÿÿÿÿÿÿâIüÿÿÿÿÿÿÿWüÿÿÿÿÿÿÿBZüÿÿÿÿÿÿÿa~üÿÿÿÿÿÿÿ„…üÿÿÿÿÿÿÿ’Wüÿÿÿÿÿÿÿº†üÿÿÿÿÿÿÿ¿ ÐÄ'üÿÿÿÿÿÿÿÎ{üÿÿÿÿÿÿÿöjüÿÿÿÿÿÿÿ  Uüÿÿÿÿÿÿÿ  ‡üÿÿÿÿÿÿÿS_üÿÿÿÿÿÿÿexüÿÿÿÿÿÿÿoWüÿÿÿÿÿÿÿvvüÿÿÿÿÿÿÿ{xüÿÿÿÿÿÿÿ‚ˆüÿÿÿÿÿÿÿ£[üÿÿÿÿÿÿÿµxüÿÿÿÿÿÿÿØMüÿÿÿÿÿÿÿå†üÿÿÿÿÿÿÿê ¬ï'üÿÿÿÿÿÿÿù{üÿÿÿÿÿÿÿMüÿÿÿÿÿÿÿ& ‰2Müÿÿÿÿÿÿÿ?†üÿÿÿÿÿÿÿD ¾I'üÿÿÿÿÿÿÿS{üÿÿÿÿÿÿÿX†üÿÿÿÿÿÿÿ] ‰b'üÿÿÿÿÿÿÿl{üÿÿÿÿÿÿÿq†üÿÿÿÿÿÿÿv ž{'üÿÿÿÿÿÿÿ…{üÿÿÿÿÿÿÿІüÿÿÿÿÿÿÿ ”'üÿÿÿÿÿÿÿž{üÿÿÿÿÿÿÿ£†üÿÿÿÿÿÿÿ¨ €­'üÿÿÿÿÿÿÿ·{üÿÿÿÿÿÿÿ¼-üÿÿÿÿÿÿÿçQûÿÿÿÿÿÿÿôüW/øW/0+üÿÿÿÿÿÿÿ6+üÿÿÿÿÿÿÿS‹üÿÿÿÿÿÿÿYWüÿÿÿÿÿÿÿ‚øW/˜‰üÿÿÿÿÿÿÿŸX/ª_üÿÿÿÿÿÿÿûQüÿÿÿÿÿÿÿxüÿÿÿÿÿÿÿ vüÿÿÿÿÿÿÿxüÿÿÿÿÿÿÿ$Qüÿÿÿÿÿÿÿ?WüÿÿÿÿÿÿÿWüW/]üW/kzüÿÿÿÿÿÿÿqYüÿÿÿÿÿÿÿŒüÿÿÿÿÿÿÿ4™üÿÿÿÿÿÿÿ³0êQûÿÿÿÿÿÿÿ÷YüÿÿÿÿÿÿÿMüÿÿÿÿÿÿÿ ù#'üÿÿÿÿÿÿÿ-{üÿÿÿÿÿÿÿ:QûÿÿÿÿÿÿÿGüW/MüW/¦Žüÿÿÿÿÿÿÿ·X/ÀüW/ÏüW/õküÿÿÿÿÿÿÿ  UüÿÿÿÿÿÿÿGŽüÿÿÿÿÿÿÿTküÿÿÿÿÿÿÿZüW/güW/Ä ÉUüÿÿÿÿÿÿÿìüÿÿÿÿÿÿÿöüW/üW/-*üÿÿÿÿÿÿÿBüW/HüW/QzüÿÿÿÿÿÿÿWYüÿÿÿÿÿÿÿqŒüÿÿÿÿÿÿÿüW/‘„üÿÿÿÿÿÿÿœYüÿÿÿÿÿÿÿ¶MüÿÿÿÿÿÿÿÙ-üÿÿÿÿÿÿÿÞ Üã'üÿÿÿÿÿÿÿí{üÿÿÿÿÿÿÿX/@üÿÿÿÿÿÿÿ‘üÿÿÿÿÿÿÿ,üW/2+üÿÿÿÿÿÿÿ@X/EŠüÿÿÿÿÿÿÿK@üÿÿÿÿÿÿÿRX/[Wüÿÿÿÿÿÿÿbvüÿÿÿÿÿÿÿ‡ w• (rüÿÿÿÿÿÿÿ±rüÿÿÿÿÿÿÿÚ (ßrüÿÿÿÿÿÿÿîuüÿÿÿÿÿÿÿX/+,1X/J’üÿÿÿÿÿÿÿU‘üÿÿÿÿÿÿÿeüW/o’üÿÿÿÿÿÿÿ{"üÿÿÿÿÿÿÿƒ#üÿÿÿÿÿÿÿ‹$üÿÿÿÿÿÿÿ—+üÿÿÿÿÿÿÿÁ (×züÿÿÿÿÿÿÿávüÿÿÿÿÿÿÿðxüÿÿÿÿÿÿÿ]üÿÿÿÿÿÿÿ  nüÿÿÿÿÿÿÿ"{üÿÿÿÿÿÿÿ-|üÿÿÿÿÿÿÿ>xüÿÿÿÿÿÿÿCSüÿÿÿÿÿÿÿTüÿÿÿÿÿÿÿexüÿÿÿÿÿÿÿjSüÿÿÿÿÿÿÿs!Uüÿÿÿÿÿÿÿy!Wüÿÿÿÿÿÿÿ£!eüÿÿÿÿÿÿÿ¼!–üÿÿÿÿÿÿÿÂ!WüÿÿÿÿÿÿÿÙ!QüÿÿÿÿÿÿÿO"Qüÿÿÿÿÿÿÿð#€üÿÿÿÿÿÿÿR$”üÿÿÿÿÿÿÿf$Žüÿÿÿÿÿÿÿ´$”üÿÿÿÿÿÿÿô$”üÿÿÿÿÿÿÿ4%”üÿÿÿÿÿÿÿt%”üÿÿÿÿÿÿÿ´%”üÿÿÿÿÿÿÿ¾%-üÿÿÿÿÿÿÿÑ%  &  (!&  M&Uüÿÿÿÿÿÿÿ€&™üÿÿÿÿÿÿÿ¾& /Å&šüÿÿÿÿÿÿÿÏ&üÿÿÿÿÿÿÿâ&Tüÿÿÿÿÿÿÿû&Tüÿÿÿÿÿÿÿ%'vüÿÿÿÿÿÿÿº'€üÿÿÿÿÿÿÿì'-üÿÿÿÿÿÿÿ5(—üÿÿÿÿÿÿÿP(œüÿÿÿÿÿÿÿX(˜üÿÿÿÿÿÿÿ7'üÿÿÿÿÿÿÿG'üÿÿÿÿÿÿÿ®Uüÿÿÿÿÿÿÿ Tüÿÿÿÿÿÿÿt iüÿÿÿÿÿÿÿ} qüÿÿÿÿÿÿÿ¦ süÿÿÿÿÿÿÿ¶ süÿÿÿÿÿÿÿIüÿÿÿÿÿÿÿpüÿÿÿÿÿÿÿžž (ž  U  d r !e() . ; PB ì I P ‚W å^ E l ÿq ´ | ›‡  ’ ' Ÿ r² ÿ· ù MÍ …Ø %ã €ï pý À  “ E> Ô K g R ­g r É~ „ ù Š Û – (œ õ¢  ¨ Í ° A ¸ ~ à  Ï 4Ý Ü ü -  Ÿ $  S ñ^ « i Á t W ‡ å ד M™ Ÿ H ¥ ¨ « ± T · ý Ð Ã § É MÏ  Õ *Û £á Bç ‚ í Zó •ù áÿ × 6  Á  h  “ ' B . f5 ð< ½D ~O ÍZ Ýf a } ‰ˆ œ “ 7Ï ž Û ê tö Œ — —  =/ V; Ó I êW Me òs ¯ ß ˜ ¥ s ´ ¹Ã 3 Ò Éá ð ÿ ÷ g   , i; 7 J  Y Fh ~w Ê † £• (¤ ©´  Ä L Ô :ä ô ê ñ ø$ ÿ4  D ˜ T üe Ul dx l †  ” ôä ?ë ðð  û w º ³ " ¸. F< ^J jX ´f ­{ z‡ 1½ Z ì Ú ø “þ Z þ  7 0 ù  " ç5 h A OO Ž ] ð x a ‡ ¥“ ,¡ Ò ¯ ¤ ½ ð Ì Ø ,æ Ò  ý   ´+ H9 ™V (b ' ™ ¬ µ ™à ”Ñ ß ´î O û b  O&  5 ¢a ˆp G  7 ì ` » @Ê ÍÙ ^è  ÷  ‚ ˆ$ ¿ d a p ~  Œ •𠾍 ð · @Ð MÞ  ð ¸ û ” '  ð $ kV ú h  s |‡ ™ ¸ ¤ §¯ ' ¼ Î ¸ Ù §ä ' ñ ` / $ A ¸ L §W ' d ä “ ÑÑ ë é ÷ ˆ z  [% `1 °= äI äU ´ i j { < †  œ § ² ² ’ ÈÐKØ å œî øõ ðPi «" A,p4²H dQ ‡Z Ãc j ƒuÀ}ô… XŽ Õ˜ Ì + § ¬ V ¶ ^»  Å ”Ê ?Ô ·Þ Úã s í ò 'ü \ ¹  œ @  Ò  ¨+ 4‹< H >Q zV 0_ ºh 0• " ¡©Î ~ Ú â>ü z   š@%QD  P`X~r À… ‘€™Ð³ 㺠ðÆÐÎíè ï µûð )$  08!R LY ˆ e0mA‡ oŽ EšP¢a¼ ’à EÏp×ñ µø š  ê Ø' 8.  :ðB\ [c ow!‘ ~˜ ù¤0¬AÆ ¡Í ‚ÙPáaû Ä pz#  /€7‘Q çX 7d l±†   ä ™À¡Ñ» - Â É ÎàÖñð P ÷    [ (.B s I  U0]e — n Ë  h ‹ “–  ¨ °²¸  Ë k Ü ÏèÀð£ø   ·    L %6-Q= „ J ð R°Z% b ° h O t0 |7 ‰ \ •@ Q ¼ ‚Ä` ̵ Ô $ ç À î uöÀ þì  ÷  C  Û (ð 0x @ K y [ œ b ±n€ v© ~ ¿ ‡ ’  — 4¤4¸ .° Êà Þ ç ¢÷ Åþ ä à   è * „/ ¬ : âJ QZ Àj ãt |º  ™ Q¢ ‡±  ¹° É ½Ò à×  ß° ö MÀ \  % @5 d?` G… n Ìz ‚/Š ›“ È ž %£ ų Ú Ï nÜ ß ä0ì˜ô ¨ ú  ˆ b' C< G fL (W ¾\ 5 g ôl w "† qš,¢ `® P¼ †Á °Ê Àã ¼ ë óÀû ö  ø- TB  M R cb èr /ƒ w” 8¥ @Á ùÆ Ú ]ê ¹ðøŠ  Þ  (À0ñ8 A L +Q é k Àp O { 5‹ ¨ È› h  ÷ « ïº ¿ ’ Ì8à Hå / ð ‚õ     ƒ ¡  z  '!):1 0A a!O „!U `}Q… • ù!ž ""£ ଠE"µ £"¼ÄÄÈÜ Ú"îèöì # 4#$,D k#T Ž#^uf 0r ²#{ ý#€ p‰  $’ ~$¸ tÄÌ Ô µ$Ý Tè ¨&ö ó&ý   t )' b) '8 æ'B€J*!e  (n @(w c(… °(Ž â(— $)¯ô·!Ç h)Ð µ)Ù Ø)â û)çôï!ü * h*  *& É*/ º7 0!? Â%G +P é `  p H ­’ C£ l® g+¾ ¶+à ÔÎ „,Ó oÞ q-ã Æî J.! ¥! 7/! ¾! è/#! 1 .! ‚03! •>! Ž1C! a N! ;2S! ˆg!¡!o!À!ƒ! è2Œ! $3•! `3ž! ˜3§! Ô3°! 4¶!x"¾!"Ö! ;4æ! ^4ì!4#ô!<#" ‚4" ¥4&"  ."Ð%6"&F" + T" ½l" É4{" í4ˆ" Š "&˜"ð' " %5©" + ´" O6Ã" ˜6Ò" õ6à" R7õ" Ž# u7# ï# «7# ˆ'# T/#ð'7#e(?# û7H# + X# ½u# °z# »†# À”# ¡# ÿ ®# > »# vÈ# Ä Ô#X/í# È ù#($ a $($ ± 4$X/=$ XJ$ >W$ Üd$ #q$ b~$ Í‹$ ט$ -¥$ O²$ y¿$ y Ì$ !Ù$ Ï æ$ Å ó$ c% Û % Ê % ‰'% ð 4% Q% ^% !j%X/s% h%0ˆ% •% T¢% }¯% ,»%X/Ä% Ðê% ü÷% & 7& & ÿ +& > 8& vE&wN& [&Ÿd& Xq&Jz& >‡&b& Ü&c¦& #³&N¼& bÉ&RÒ& Íß&Kè& ×õ&Lþ& - 'O' O!'Y*' y7'e@' y M'žV' !c'l' Ï y'[‚' Å '˜' c¥'X®' Û»'zÄ' Ê Ñ'_Ú' ‰ç'|ð' ð ý'}( (v( )(F2( ?( TL( }Y( Ð( üŒ( ™( 7—  A4{ ´(7À(Å#X/#4e š HP\ppÀ ´ È@Ü`ð€Ðð,@0TPhp|˜ð¬À0ÔPèpü€ $À8àL`t0˜ ¬ ÈÀè°0 @ 0` XÀ t𠈀 ¤° ¸à à ôÀ <` P x0È ÀP´ Ô€ð0!Ð%,&tð'mtr-0.85/NEWS0000664000175000017500000003203612135162273011773 0ustar wolffwolffWHAT'S NEW? V0.84 Fix some glib things by Thomas. V0.83 Move to github. Mostly done by Travis. Author: Travis Cross Add autotools bootstrap script Update README for building from git repository Cleanup whitespace in the NEWS file Resolve -Wunused-but-set-variable warnings Resolve -Wnull-dereference clang warning Add -z / --show-ip support Author: R.E. Wolff (mostly from patches by others) some running patches Made report wide switch properly to displayreport mode. Bug #780647 fixed gtk field order. Bug #701513 added aslookup patch from bug #701514 added some extra clarifications to the SECURITY file. enable ipv6 resolvers. By Antonio Querubin. Fixes bug #752583 V0.82 Removed old Changelog file appended at the end as oldest changes. 2011-03-28 Mark Kamichoff Enable decoding of ICMP extensions for MPLS for curses and report interfaces. Use the -e flag or press 'e' to enable it. V0.81 Moved to git. Testing git... V0.80 Some compilation fixes for BSD by Jeremy Chadwick V0.78/0.79 some compilation fixes for BSD&others by Thomas Klausner V0.76 display load sharing hosts in --raw output. added about button in gui. v0.75 Feelgood patch to move sprintf to snprintf. People might think that sprintf might cause a buffer overflow. Now it's clean. cut-paste patches: you can now copy an intermediate host to the clipboard. v0.74 Martin Pels' patch to allow UDP probes. KES reported a build problem. Turns out I need to install gtk-1.2 on my development sytem, otherwise my release script causes the build to break. changed some docs to advertise the new mailing list. added documentation for the Mac OS X compilation problem. added -Wno-pointer-sign to the compiler options. Nico Lichtmaier's cleanup-gtk patch. (now mtr uses a more modern dialect of gtk). v0.73 Some securty patches. Although MTR drops privileges as soon as possible after opening the sockets, it still had some sprintf calls, which have now been converted into snprintf. v0.72 Fix signed/unsigned bug in IPV6 part improved random packet size behaviour. --REW v0.71 Some IPV6 fixes, introduce packet size cmdline option. (was already present as a cmdline argument) v0.70 Antinio submitted a cumulative patch containing some nice improvements. He also submitted an automake patch that causes mtr to no longer compile on my system. I refuse to have mtr "in the dark" that I can't test-compile the dist. v0.69 make distclean should now also remove "rej" files. Antonio Querubin: update getopt.h . More cleanups using new infrastructure. rcw: Fixed IPV6 support: When compiled in an IPV6-supporting environment, but when the kernel doesn't support IPV6, mtr would fail to start. v0.68 included some old patches. included patch from Antonio Querubin for better IPV6 support restructured some more whitespace. added mtr.h where "global" things should go. Not finished moving things around, but now that the infrastructure is there, it should be easy. v0.67 Bad keyboarding by REW caused this one out the door. Sorry. No changes. v0.66 Through the Debian bugtracking system a bug report and fix was sent my way, that deals with stupid optmization trying to save some 768 bytes of memory, sacrificing "it works" on a different architecture... (default char signedness) v0.65 Dancer Vesperman noted that mtr no longer traces past a section of non-responding hosts. Apparently I added a line in net.c that didn't make sense in mtr-0.56. I can't find the reason for adding that line, so someone who thinks (s)he needs it, should holler. v0.64 Philippe suggests to do the time_t thingy before socket.h. Apparently, MAC OS X doesn't compile socket.h otherwise. v0.63 Suggestion by RCW: Add -lm at line 70 of Configure.in. On my system no ill effects ensued, so this version released so that he can test if it still works on his sytem. Let me add that it's stupid that I have to specify that this this program now requires Automake version 1.5 to build, where Automake was intended to make software independent of different versions of build software! For those concerned about the above statement: If you're just trying to compile and use MTR, there is no need for automake. Just when you're messing with the configure and build system of mtr is automake a tool you need. v0.62 Apparently someone changed gethostbyname into gethostbyname2 in mtr.c in an attempt to add IPV6 support. For systems without ipv6 support, the old gethostbyname should be used! Linux has the call even if you don't enable IPV6. Thanks Gary (rsub) v0.61 Attempt to get/print the local IP address. Now shows as 0.0.0.0 :-( Hints and tips appreciated! -- REW Lots of blank space reformatting. moved the interface address setting to net.c (where it belongs). v0.60 John Thacker submitted a surprisingly simple patch to enable linking against GTK2. (up to 2.4.0) v0.59 Josh Martin suggested to add some bounds checking to the dynamic field code. This caused me to delve in, and rewrite some things. Now 50 lines of code less, but cleaner code. :-) v0.58 I don't remember. Fogot to update this. :-( Check the patch. v0.57 Lots of whitespace cleanups. And a DNS fix: Don't do DNS lookups in raw mode with -n specified. v0.56 Fixed compile warnings. Now compiles with -Wall. If your compiler finds things mine didn't feel free to shout. v0.55 Cleanup patch. I'm going to do some maintenance on MTR, but I want to be able to say: Can you see which version fixed/broke things for you, so you're going to see a bunch of new releases soon. v0.54 Added "scrolling" patch from Roland Illig, to allow scrolling in text mode. I've always wanted this...... v0.53 Added fix for raw mode. v0.52 Mostly cleanups from Brett Johnson on MacOS X. It may clean up some compilation problems on MacOS X as well. v0.51 Fixed the bug introduced by the previous select loop fix... Thanks Evgeniy v0.50 Make "interface address" option work. Changes to "select" loop to allow window resizes (select interruption) to work. Thanks Mike! v0.49 Fix compilation problems on several platforms. v0.48 Draw names in red (GTK) or bold (Curses) if host doesn't respond. v0.47 Fixed a (believed-) non-exploitable bufferoverflow. Thanks Damian. v0.46 Included patch to be able to specify outgoing interface address. v0.45 People are pressuring me to release new versions with their changes. That's fine. Now this version just adds dynamic switching between numeric / dns names, and some minor stuff I forgot. This release serves as a code-sync-release. new version with even more new stuff in about two weeks! I'm afraid I don't know how to fix the MaxOS-X compilation problems in the source. Help wanted... v0.44 David Stone adds the "last" column to the gtk version. v0.43 Compile fixes. v0.41 Added afr's patch to allow disabling of gtk without Robn's hack. Made report mode report the newly added extra resolution. v0.40 Fixed some problems with HPUX and SunOS. Included Olav Kvittem's patch to do packetsize option. Made the timekeeping in micro seconds. v0.39 Forgot the parentheses around the previous fix... :-( v0.38 fixed some dubious code in dns.c (noted by someone's lint) v0.37 Added Bill Bogstad's "show the local host & time" patch. Added R. Sparks' show-last-ping patch, submitted by Philip Kizer. v0.36 Added Craigs change-the-interval-on-the-fly patch. Added Moritz Barsnick's "do something sensible if host not found" patch. Some cleanup of both Craigs and Moritz' patches. v0.35 Added Craig Milo Rogers pause/resume for GTK patch. Added Craig Milo Rogers cleanup of "reset". (restart at the beginning) Net_open used to send a first packet. After that the display-driver got a chance to distort the timing by taking its time to initialize. v0.34 Added Matt's nifty "use the icmp unreachables to do the timing" patch. Added Steve Kann's pause/resume patch. v0.33 Fixed the Linux glibc resolver problems. Fixed the off-by-one problem with -c option. v0.32 Fixed the FreeBSD bug detection stuff. v0.31 Fixed a few documentation issues. -- Matt Changed the autoconf stuff to find the resolver library on Solaris. -- REW Cleaned up the autoconf.in file a bit. -- Matt. v0.30 Fixed a typo in the changelog (NEWS) entry for 0.27. :-) added use of "MTR_OPTIONS" environment variable for defaults. v0.29 Lots of stuff. Neato overview display by David Sward. FreeBSD does wrong in the kernel the same that Solaris/x86 (see note for 0.27 does right. It forces mtr to send bad packets.... Adjusted "not too much at once" algorithm. Now probing continues as long as not more than 5 hosts are unknown. Returning packets usually allow us to do the first sweep in one go. v0.28 DNS lookups are now suppressed if you don't want them. v0.27 Fixed bug that showed up on Solaris/x86. GTK mainloop now runs as it's supposed to. v0.26 Added "-n" flag for numeric output. fixed IP numbers displaying backwards. GTK mainloop now runs at 10 packets per second. - That's too much if there are only 3 hosts - that's too little if there are 20 hosts. -> Someone tell me how to change the "ping-timeout" callback time in gtk. Can't find it in the docs. The default for "hostname" is now "localhost" so that you can start mtr without any arguments and later fill in the host you want to trace to. v0.25 Included two "raw" formats. One for separating GUI from the setuid program, and one suitable for later parsing and displaying. Volunteers wanted to separate the GTK backend. Thanks to Bertrand Leconte for contributing the format that's now called "split". v0.24 Fixed number of probes. Accidentally was counted per packet sent instead of per round of packets. v0.23 Fixed Sparc alignment problem with statmalloc v0.22 Roger has take over maintenance. mtr now uses an "int" to pass options to the kernel. Makes things work on Solaris and *BSD I'm told. mtr doesn't fire off a flurry of packets when a new second comes around. Instead they are spaced evenly around the whole second. This allows people with a relatively slow first link to do meaningful measurements of whatever is behind that. v0.21 mtr now drops root permissions after it acquires the raw sockets it needs. mtr should be a bit happier about building under SCO and Solaris. Fixed the problem with packets arriving after a reset. v0.20 The build process for mtr now uses automake. Fixed a build problem for Irix. Now uses non-blocking DNS code, so mtr can attempt to do reverse lookup on multiple hosts at once. Fewer packets are sent out each cycle, so mtr doesn't hog quite so much bandwidth. v0.19 Fixed a type-o in curses.c v0.18 Fixed the network code to work properly under FreeBSD. Hopefully this will fix some other operating systems too. Also, fixed a build problem and the DNS hanging bug. v0.17 Fixed the configure script to always like with the math library. Added an icon. v0.16 Added one #include to select.c. Some people were unable to build mtr without this line. v0.15 Both the build process and the networking code have been cleaned up and reorganized. mtr now builds cleanly with GTK+ 0.99.8. --- Below is the contents of the old "Changelog file" that annoyed some people as it didn't contain any recent changes/news. 2002-03-06 Cougar + If hop doesn't respond, draw its name in red (GTK) or bold (curses) 2002-02-09 bodq + Added --address option to bind to given IP addess 2001-04-15 root + Added this file so that automake won't complain. + Commented out the test for res_init in configure.in; it does not work for GLIBC2 systems (e.g., RedHat 7+). + Fixed the subordinate CHECK_LIBS on the test for res_mkquery, so that they test for res_mkquery, not res_init. mtr-0.85/select.o0000664000175000017500000004507012162522233012731 0ustar wolffwolffELF>Ð"@@AW1öAVAUATE1äU1íSHìXH¼$H\$L´$Ç„$LèÇD$ ó躃ÞC‰ÁH‰ß÷ê‰ÈÁøÁú)ÂHcÂiÒ@BH‰1À)ѺHcÉH‰ H‰ÑüóH«H‰ÑL‰÷üóH«‹Ç„$L…ÀtHƒL$Ç„$L‹E1ÿÇD$…À…èH?…À‰ÂIÈÁúÁêÁùD,HcÉH‰ $Aƒå?A)ÕºD‰éHÓâH‹ $H TÌ;„$L| ƒÀ‰„$Lƒ=„À l$ éîfDH‹¼$(H‹´$L‹„ÓH)ÑH)÷ˆ”I)øH)ÈM…ÀL‰„$8H‰„$0ˆ(D‹E…ÛtcòòH,ÈH9Œ$0Ž)òYHºÛ4¶×‚ÞCòH,ðH‰ðH÷êH‰ðHÁø?HÁúH)ÂHiÒ@BH)ÖH‰òH‰Œ$0H‰”$8‹¼$LL„$01É1ÒH‰Þè…À‰2èƒ8… …í…à‹…À…bH¼$ 1öèH‹”$H‹H‹Œ$ H4H9ñŽÏþÿÿH‹„$ D;%H‰„$H‹„$(H‰„$|‹…À„h‹…À…Zè…ÀtAƒÄH‹¼$(H‹´$H‹Œ$ H‹”$L‹H‹H)ÑH)÷‰lþÿÿHƒéHÇ@Bé\þÿÿ‹¼$LL„$01ÉL‰òH‰ÞHÇ„$0HÇ„$8è…ÀˆÎþÿÿH‹$1íH‹DÔL£ès@µèD‹E…Ò…ÓöD$…¨ƒ=…°üÿÿL‰÷èé£üÿÿfDèé‘þÿÿHƒèIÀ@BH‰„$0L‰„$8é¸ýÿÿ„…þÿÿòYHºÛ4¶×‚ÞCòH,ðH‰ðH÷êH‰ðHÁø?HÁúH)ÂHiÒ@BH)ÖH9´$8H‰òŽÓýÿÿé¾ýÿÿ€N L9ÏŒ ýÿÿé/þÿÿfD¿è¿è@è‰Â‰D$‹L$ƒÂ?…ÀIÐÁøÁèÁúÁHcÒƒá?)Á¸HÓàH DÔ‹D$;„$L| ƒÀ‰„$L‹…À„ÆèA‰Ç…ÀAW?IÐÁøÁèÁúA HcÒƒá?)Á¸HÓàH DÔD;¼$LŒÖûÿÿAG‰„$LéÆûÿÿHÄX[]A\A]A^A_ÃfDèƒø †Ð½é@þÿÿ„ó¿ZÀòèD‹ E…É„þÿÿ‹D$D‹D$‹T$ƒÀ?E…ÀID$ÁúÁêÁøHcÈ‹D$Ѓà?)ÐH‹TÌH£Âr`AG?E…ÿAIÇÁøHcÐD‰øÁøÁèAÇAƒç?A)ÇH‹DÔL£øƒ“ýÿÿè½é„ýÿÿH´$LL‰÷èé+ûÿÿ‰Àÿ$Åf„è‹=½…ÿuƒéDýÿÿ€‹51À…ö”À‰è½é&ýÿÿ‹ ºVUUU½ƒÁ‰È÷ê‰ÈÁø)ÂR)щ éøüÿÿè½ééüÿÿ‹½ƒè…À‰‰ÍüÿÿÇé¾üÿÿƒ½é­üÿÿƒ=½Œ›üÿÿ¸D‰é„üÿÿ‹½…ÀˆqüÿÿƒÀ;‰Ž\üÿÿÇéMüÿÿ‹ ½…É„:üÿÿ‹1À…Ò”À‰èéüÿÿÇD$ ½é üÿÿÇD$ é´ýÿÿE1ÿéIùÿÿSelect failed€„.Aiint^Ž^•^—^™L{ÔBKßM{#N†#7^ €CK# ß BNê Ø÷ W# “# “# “# “# “#( “#0 “#8 “#@ “#H “#P  “#X "5#` $;#h &W#p *W#t ,e#x 04#€ 1I#‚ 2A#ƒ 6Q#ˆ ?p# H‘#˜ I‘#  J‘#¨ K‘#° L«#¸ NW#À PW#Ä´º5»5#¼;#ÀW#þ* ™Q B÷ ™g B8€ Æ› Ï# 1- 24 4; ! !)+,./23:;<Üâç섈ÿ€ È« Ê« Ì» ÍË ›» B ¦Ë B ±Û B 2    bo2©3‘€}4‘€~5W6W‘¼7W7W9W;WWrv?W€HWHWIWIW ¥; ¦;=Wdns>W@W +W ,W W W'W(W)W*g+n,W.¶  ¥; ¦;=Wdns>W@W +W/W ~u  W W'W(W)W*g+n ,W% $ > $ > : ; I  I : ;  : ; I8  : ;  I !I/  : ; : ;I8 : ;  : ; (  : ;  : ; I : ; .? : ; ' @4: ; I 4: ; I4: ; I U4: ; I 4: ; I? < 4: ; I? < 4: ; I?  www w w(w0w8w w8 !w0!#w(#%w %'w')w)0w0’wE0ŸE=VTm0Ÿm¢VdV*CVH·Vïù1Ÿù%V%91Ÿ9]VbrVšVŸªVÊÖVÛçVV;FVkxV}’VÛ}_¢d_ÌØPØ_HÔ_ù_9_à%P%,pŸs‚P‚ŠRŠ‘ø|Š’‘ø|8E0ŸE#\*’\8E0ŸEk‘ü|k}0Ÿ}’‘ü|Y^P^|R&PL_P,’Y\xz|‹’ïZû /usr/include/x86_64-linux-gnu/bits/usr/include/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/x86_64-linux-gnu/sys/usr/include/netinet/usr/include/arpaselect.ctypes.htime.hstddef.htime.hselect.hlibio.hmtr.hin.hstdint.hdisplay.hstdio.hasn.hnet.hnameser.h 1.q. fw<#+‚uJ ¬SŠÉW29åew,0V u¢d®Kg° fy<}‚Y9 Éäd f=”==:ƒƒk»Sƒ† ‚SÖ‰Øæ$ƒsu.®‘2=‘Kkäc»¼)X ‚G1®;\ò:¬Éþ~.òKsƒNh5ƒ;i I$<ŸºÖY-K,Ȣ׃+Ö˜.Ct5Ö¹ ƒW­]ò:3Y³žÒJu \c[ò/ XaXrX-¬SXƒT0XQX)XlzX=-ggß txXyXtqXgxffjXƒ=eggväfcXƒ/wž$‚]XT™ÈActionASmtrtype_IO_read_ptr_chaindnsfdns_s_ns__in6_usize_tselect.cIPPROTO_MTPIPPROTO_PIM_shortbufActionResetIPPROTO_DCCPIPPROTO_TP_IO_read_base_IO_buf_baseIPPROTO_ENCAPIPPROTO_IGMP__d1pausednetfdIPPROTO_RSVPlong long intsigned charIPPROTO_IPMaxPing_filenoipinfo_no_IO_read_endintervaltime__u6_addr16long int__u6_addr32maxfdIPPROTO_NONEreadfdForceMaxPing_cur_columnselect_loopActionQuitenablemplsuint16_tdouble_old_offset_offsetActionIIActionNonens_s_prns_s_anIPPROTO_COMPlong long unsigned intns_s_ar_IO_markerstdinfd_setunsigned intIPPROTO_ESP__suseconds_t_IO_write_ptrunspec_addr_sbufIPPROTO_ICMPV6IPPROTO_FRAGMENTshort unsigned intns_s_qdip_t_posthistime_IO_save_baseActionScrollDown_lock_flags2timevalstdoutActionMPLSselecttimeIPPROTO_UDPipinfo_maxWaitTimednsintervaltv_secdisplay_mode_IO_write_endActionScrollUpwritefdIPPROTO_MAX_IO_lock_t_IO_FILE/home/wolff/mtr__off_ttime_t_modefloatns_s_znIPPROTO_IPV6ActionPause_markersIPPROTO_PUPIPPROTO_SCTPunsigned charIPPROTO_RAW__ns_sectIPPROTO_IDP_IO_buf_end__fd_maskshort intlasttime_vtable_offsetuse_dnsdisplay_offsetin6_addrtv_usecuint32_tIPPROTO_HOPOPTSGNU C 4.6.1IPPROTO_UDPLITElong unsigned intcharIPPROTO_EGP__d0__u6_addr8ns_s_max_next__off64_tIPPROTO_ICMPActionResume_IO_save_endIPPROTO_GRE__pad1__pad2__pad3__pad4__pad5__time_t_unused2ActionClear_flagsuint8_tIPPROTO_TCP_IO_backup_baseInteractivens_s_udanysetIPPROTO_AHIPPROTO_ROUTINGNumPingIPPROTO_IPIPActionDisplaydnsfd6ActionDNS_IO_write_baseIPPROTO_DSTOPTS__fds_bitsGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx L’BDŽB B(ŒD0†C8ƒG 8A0A(B BBBG .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.1.rela.rodata.rodata.cst8.rela.debug_info.debug_abbrev.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @’(0x&Ô,à 12àEðh@ 68MX_`mZØ7 kÍ‚yO'‰v0„ØI0 ˜¦P«öó¦J·0é_Â0H!+Ës!àx!hÛ Jà!êP)( x.¯ñÿ     ’(5>MY]hpòÿ|ƒ”œ©¸ËÛêñö *2>GR`mw†›£òÿselect.cintervaltime.LC0select_loopgettimeofdayWaitTimecalc_deltatimeInteractivednsnet_waitfdmtrtypednsintervalselect__errno_locationMaxPingForceMaxPingnet_send_batchnet_process_returnnet_process_fdsdisplay_redrawperrorexitdns_waitfd6dns_waitfddisplay_keyactiondns_eventsdns_acknet_add_fdsdns_ack6enablemplsdisplay_cleardisplay_modenet_resetdisplay_offsetipinfo_noipinfo_maxuse_dnsunspec_addr9üÿÿÿÿÿÿÿIüÿÿÿÿÿÿÿNüÿÿÿÿÿÿÿt ‡žüÿÿÿÿÿÿÿÄüÿÿÿÿÿÿÿÜüÿÿÿÿÿÿÿ.ûÿÿÿÿÿÿÿ[“üÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ»üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ#üÿÿÿÿÿÿÿ:üÿÿÿÿÿÿÿQüÿÿÿÿÿÿÿ` „üÿÿÿÿÿÿÿ¤üÿÿÿÿÿÿÿ² üÿÿÿÿÿÿÿ¿!üÿÿÿÿÿÿÿîõ Hüÿÿÿÿÿÿÿi"üÿÿÿÿÿÿÿpüÿÿÿÿÿÿÿŠûÿÿÿÿÿÿÿ™#üÿÿÿÿÿÿÿ©$üÿÿÿÿÿÿÿêüÿÿÿÿÿÿÿQ V%üÿÿÿÿÿÿÿ`&üÿÿÿÿÿÿÿi'üÿÿÿÿÿÿÿ¸üÿÿÿÿÿÿÿÅ(üÿÿÿÿÿÿÿ1)üÿÿÿÿÿÿÿTüÿÿÿÿÿÿÿY düÿÿÿÿÿÿÿi*üÿÿÿÿÿÿÿpüÿÿÿÿÿÿÿë+üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ !-üÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿB.üÿÿÿÿÿÿÿO.üÿÿÿÿÿÿÿT/üÿÿÿÿÿÿÿd0üÿÿÿÿÿÿÿ‡0üÿÿÿÿÿÿÿ‘1üÿÿÿÿÿÿÿ¡2üÿÿÿÿÿÿÿ±2üÿÿÿÿÿÿÿ½2øÿÿÿÿÿÿÿÌ2ûÿÿÿÿÿÿÿÝ3ûÿÿÿÿÿÿÿõ4üÿÿÿÿÿÿÿû3üÿÿÿÿÿÿÿ3üÿÿÿÿÿÿÿ4üÿÿÿÿÿÿÿ"3üÿÿÿÿÿÿÿ.3øÿÿÿÿÿÿÿ=üÿÿÿÿÿÿÿP5üÿÿÿÿÿÿÿ]5üÿÿÿÿÿÿÿb/üÿÿÿÿÿÿÿ>b S(}0k8@@;HPÛXÊ`Ÿ Ä B ­!’) 0 7 ¨> AE àL ôS aa Kf ½q "| ‚‡ Zœ ò¡ Ŭ ;· à TÑ £à Wó T :  & æ+ ¤8  G V %e ‘t 5ƒ h’ h¡ Ÿ° K¿ ÖÎ »Ý Fì ùû    û( Å7 ‡G tW cg õw ч _— f§ m· tÇ {× Ìç ‹ø ™ÿ )   ‚' Èj Òq ¾v à š 3œ §§ µ² «Å Ë ´Ñ ,× ºÝ  ã ¯é ÷ï õ (û ? † y  à ñ — Ù% S+ N1 æ7 ˆ= fC DI KP ¬W W^ ýe l Ðs )z Š • ?  Tä âê Ÿð mö ü ” í 9  + Ù  & ä, v3 5? »E ØK õQ íW +] ×c !i q “x€’ˆ ‘ s  …¯ ß¹ R¾ `Í %× âÜ Óæ wë $õ ¯ú    Ì Y k' Í6 N »\ ña j u Ç’‰œ’  Ǫ 4·  Ä ªÞ ƒë [ø ‹  4 Ë,  9 zF ?S H`  m 2y‚ 4  œ ª¶ ƒÃ [Ð ‹Ý2æ vó6ü   4 Ë#  0 z= ?J HW`   g mtr-0.85/raw.c0000664000175000017500000000311512104140215012211 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1998 R.E.Wolff@BitWizard.nl raw.c -- raw output (for logging for later analysis) This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #include #include #include "mtr.h" #include "raw.h" #include "net.h" #include "dns.h" static int havename[MaxHost]; extern int af; #if 0 static char *addr_to_str(ip_t addr) { static char buf[20]; sprintf (buf, "%s", strlongip( &addr )); return buf; } #endif void raw_rawping (int host, int msec) { char *name; if (dns && !havename[host]) { name = dns_lookup2(net_addr(host)); if (name) { havename[host]++; printf ("d %d %s\n", host, name); } } printf ("p %d %d\n", host, msec); fflush (stdout); } void raw_rawhost (int host, ip_t * ip_addr) { printf ("h %d %s\n", host, strlongip( ip_addr )); fflush (stdout); } mtr-0.85/raw.o0000664000175000017500000002304012162522232012233 0ustar wolffwolffELF>À@@H‰\$èH‰l$ð‰ûL‰d$øHƒì‹‰õ…ÒtLcçB‹¥…Àt8‰é‰Ú¿¾1ÀèH‹=H‹$H‹l$L‹d$HƒÄéDèH‰ÇèH…Àt¶H‰Á‰Ú¾¿1ÀBƒ¥èë•DS‰ûH‰÷è‰ÚH‰Á¿¾1Àè[H‹=éd %d %s p %d %d h %d %s uint^Ž^ƒƒÔBØ{ W# }# }# }# }# }#( }#0 }#8 }#@ }#H }#P  }#X "¹#` $¿#h &W#p *W#t ,e#x 04#€ 1I#‚ 2Å#ƒ 6Õ#ˆ ?p# H{#˜ I{#  J{#¨ K{#° L•#¸ NW#À PÛ#Ä ´ º¹ »¹# ¼¿# ÀW#‚® ƒÕB{ ƒëB1-244;È6Ê6ÌFÍV ëFB öVB fB Æ Ï #8f bÉgWégŠ22W2W4}É=\ÜÉ:Ü ŸBéBWBéÉDÜ Ÿ ¥¿ ¦¿dns>W W&Bÿ $  ¥¿ ¦¿dns>W! ~ % $ > $ > : ; I  I&I : ; : ;I8 : ;  : ;  : ; I8 I!I/  : ;  : ; I : ; ( .? : ; ' I 4 : ; I.? : ; ' @: ; I4: ; I1X Y 11RUX Y 1 1X Y 4: ; I? < 4: ; I? < 4: ; I !4: ; I?  w^w ^hwh›w !U!PSc›S0T0UVclTl›Vu‹P‹˜R0c Ÿ ¡w¡ÂwÂÎw ¦U¦ÂS ªT,Îz‹”›d û /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arparaw.cstdio2.htypes.hstddef.hlibio.hstdint.hin.hmtr.hstdio.hnet.hnameser.h 2Mc1J3äUJuyžÉ1XP0Zº /%‚]X _flags2_old_offsetns_s_znraw_rawping_IO_save_endshort intsize_tin6_addr_offsethost_IO_write_ptr_flags/home/wolff/mtr__u6_addr8_markers_IO_read_enduint8_tip_addrunspec_addrlong long int__u6_addr16_lockns_s_anlong intns_s_arns_s_prprintf__ns_sect_cur_column_posns_s_maxname_sbuf_IO_FILEunsigned charsigned charlong long unsigned int__in6_uuint32_t_shortbufunsigned int_IO_markeruint16_traw.c_IO_write_base_unused2ns_s_qd_IO_read_ptr_IO_buf_endcharns_s_ud_next__pad1__pad2__pad3__pad4__pad5raw_rawhostshort unsigned int__fmtip_tlong unsigned int_IO_write_end__off64_t__off_t_chain_IO_backup_basestdin_IO_buf_basens_s_ns_mode_IO_read_base__u6_addr32_vtable_offsetGNU C 4.6.1_IO_save_base_filenohavenamemsecstdout_IO_lock_tGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx  ›L†ƒI ŒI J @.Aƒa.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.1.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @ÎÀ€&,  12 E;y@@P Q´ºdn _% tz 0o¨%0 ƒª 0–Ú h‘Ø%¢0B ­0a+¶ŒËXÆð%0èÕÀˆ Hrñÿ   › -4;DP .\fòÿraw.chavenameraw_rawpingdns__printf_chkstdoutfflushnet_addrdns_lookup2raw_rawhoststrlongipunspec_addrüÿÿÿÿÿÿÿ( :  AüÿÿÿÿÿÿÿHüÿÿÿÿÿÿÿiüÿÿÿÿÿÿÿqüÿÿÿÿÿÿÿ€  •üÿÿÿÿÿÿÿ§üÿÿÿÿÿÿÿ¶ ½üÿÿÿÿÿÿÿÅüÿÿÿÿÿÿÿ_üÿÿÿÿÿÿÿÊüÿÿÿÿÿÿÿ  Ý « q!Î) 0 >7 ,> ŠE JL LS 5a æf tq j† ê– ?£ ¾ª X¯ 5¼ jË ÑÚ •é ´ø ± \ \% ™4 ÞC éR ƒa (p Œ |Ž ÷ ¬ » Ë ÎÛ €ë Øû O  ý + ; K [ ®k À| ƒ — ÷ /« ì ¢÷ ¢ w  Ì+ Âg Fs o‚ E ™ ÉŸ ¥ Þ« ÷± ¦· ï½ ïà !Ë ÿÝ ?ë òú›  W ` $ ©) *3 <0DEW ;azi vƒ Š ’Κ g£ W­ ³² ª¼ éÅ«ÍÁÞð “ý ' ÿ3< “I c ²pN   D mtr-0.85/display.o0000664000175000017500000003310012162522232013105 0ustar wolffwolffELF>à@@HƒìÇè…Àt ÇHƒÄÃf.„Hƒìƒ=v HƒÄÃfD‹ÿ$ÅHƒÄé€HƒÄé€è‹…Àx¶1ÀHƒÄéfDHƒÄé€HƒÄé€HƒÄé€HƒÄéffffff.„Hƒìƒ=v HƒÄÃfD‹ÿ$ÅHƒÄé€HƒÄ逋…Òx1ÀèHƒÄéfDHƒÄé€HƒÄé€HƒÄé€HƒÄéffffff.„‹ƒøt%ƒøtƒøt óÃf„éééff.„‹ƒøt%ƒøtƒøt 1ÀÄéééff.„ƒ=tóÃDéff.„ƒ=tóÃDéff.„ƒ=vóÃDHc ¸HÓà¨ût 鄨t é€óÃfffff.„ƒ=tóÃDéÍÔ8intiŽi•i™Ømb#“#“#“#“# “#(“#0“#8“#@“#H“#P “#X"«#`$±#h&b#p*b#t,p#x0F#€1T#‚2·#ƒ6Ç#ˆ?{#H‘#˜I‘# J‘#¨K‘#°L-#¸Nb#ÀPÍ#Ä ´ º« »«# ¼±# Àb#t  ™Ç 8m ™Ý 8bL†8 Æ" ÏC#1?2F4MÈmÊmÌ}Í "} 8 - 8 8 8 ÖCCÝC“Rspnowsê“w¦bw¶wë¶b¶bÈw*ÈbÈ*üÚwíw ¥± ¦± b$b ¥± ¦± b$b% : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/  : ;  : ; I : ; ( .? : ; ' @: ; I.? : ; ' @: ; I.? : ; ' @ .? : ; ' I@ .? : ; ' @ 4: ; I? < w%w%&wUT04w4AwAHwH\w\hwhlwlxwxw˜w˜œwœ¨w¨¬w¬¸w¸¼w¼ÈwÈÌwÌÑwàäwäñwñøwø w ww(w(=w=HwHLwLXwX\w\hwhlwlxwx|w|wàU U!8UBPUQ`UapUq€U$U$T0DU0DT,µ¬ýû /usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/netinet.display.cstddef.htypes.hlibio.htime.hmtr.hin.hstdint.hstdio.hasn.hdisplay.h ÂN¢‘¡èKd¬òjJºgJ ºZŸ .vJ ¬G½zJÀmJºpJh)¸ OI n]· {m20h 50 b°|P5 0¯˜0Á+¡ì¶ð0±h5Ø À  °!ýñÿ     &&10¡>GScmvŠ“œࡪ´ÁËÜæòü5'4?Ð5Qfv„” 0°¼PBÉÕÞ ìdisplay.cdisplay_detectDisplayModegtk_detectdisplay_opentxt_openreport_openmtr_curses_openipinfo_noasn_opengtk_opensplit_openxml_opencsv_opendisplay_closetxt_closereport_closeasn_closemtr_curses_closegtk_closesplit_closexml_closecsv_closedisplay_redrawmtr_curses_redrawsplit_redrawgtk_redrawdisplay_keyactionmtr_curses_keyactionsplit_keyactiongtk_keyactiondisplay_rawpingraw_rawpingdisplay_rawhostraw_rawhostdisplay_loopselect_loopgtk_loopdisplay_clearmtr_curses_clearøÿÿÿÿÿÿÿüÿÿÿÿÿÿÿøÿÿÿÿÿÿÿ6ûÿÿÿÿÿÿÿJüÿÿÿÿÿÿÿQ yüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿæûÿÿÿÿÿÿÿúüÿÿÿÿÿÿÿ @*üÿÿÿÿÿÿÿ5üÿÿÿÿÿÿÿ’üÿÿÿÿÿÿÿÒüÿÿÿÿÿÿÿûÿÿÿÿÿÿÿ2ûÿÿÿÿÿÿÿRûÿÿÿÿÿÿÿcüÿÿÿÿÿÿÿ¢ûÿÿÿÿÿÿÿ]üÿÿÿÿÿÿÿmüÿÿÿÿÿÿÿŽüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ­üÿÿÿÿÿÿÿ½üÿÿÿÿÿÿÿÍüÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ> üÿÿÿÿÿÿÿM!üÿÿÿÿÿÿÿ]"üÿÿÿÿÿÿÿm#üÿÿÿÿÿÿÿ}$üÿÿÿÿÿÿÿ±&üÿÿÿÿÿÿÿ¹'üÿÿÿÿÿÿÿÁ(üÿÿÿÿÿÿÿñ*üÿÿÿÿÿÿÿù+üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿ!.üÿÿÿÿÿÿÿA0üÿÿÿÿÿÿÿt2üÿÿÿÿÿÿÿ…3üÿÿÿÿÿÿÿ±5üÿÿÿÿÿÿÿhx˜¨ =(¸0È8X@H(PHXX`íhhpxx  $  ø!µ) . :; ¶B €I ‹P ¿W “^ 0l "q ç| v‡ Öœ +¡ ® k½ Ì ©Û ê Kù ] È & 5 UD ïS b  q ñ€ ß ž j­ :½ :Í ×Ý í Uý N  U \- c= jM ] ‡n ¤u Ì H d Fæ Õë ¶ø Ÿý w A Í# ½. 09 ¶L |W Ib .¦ ¬ ² «¸ ž¾ JÄ cÊ ™Ð õØ 9ßç&ï ø Ž L r o$ q+03Ñ; ’A HàPX ök Zr +yÅŽ ã™Ð¡® áµ½%Í n× ïÜ æ í ô0üE  n 5 Å% X2 ~9PA’N U ]µi ÿv ’ƒ Z s ÿª ’· ZÄ s   80|àÀÔÐèü0P$ mtr-0.85/net.h0000664000175000017500000000715412137535115012237 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for functions in net.c */ #include #include #include #include #ifdef ENABLE_IPV6 #include #include #endif int net_preopen(void); int net_selectsocket(void); int net_open(struct hostent *host); void net_reopen(struct hostent *address); int net_set_interfaceaddress (char *InterfaceAddress); void net_reset(void); void net_close(void); int net_waitfd(void); void net_process_return(void); void net_harvest_fds(void); int net_max(void); int net_min(void); int net_last(int at); ip_t * net_addr(int at); void * net_mpls(int at); void * net_mplss(int, int); int net_loss(int at); int net_drop(int at); int net_last(int at); int net_best(int at); int net_worst(int at); int net_avg(int at); int net_gmean(int at); int net_stdev(int at); int net_jitter(int at); int net_jworst(int at); int net_javg(int at); int net_jinta(int at); ip_t * net_addrs(int at, int i); char *net_localaddr(void); int net_send_batch(void); void net_end_transit(void); int calc_deltatime (float WaitTime); int net_returned(int at); int net_xmit(int at); int net_transit(int at); int net_up(int at); #define SAVED_PINGS 200 int* net_saved_pings(int at); void net_save_xmit(int at); void net_save_return(int at, int seq, int ms); int net_duplicate(int at, int seq); void sockaddrtop( struct sockaddr * saddr, char * strptr, size_t len ); int addrcmp( char * a, char * b, int af ); void addrcpy( char * a, char * b, int af ); void net_add_fds(fd_set *writefd, int *maxfd); void net_process_fds(fd_set *writefd); #define MAXPATH 8 #define MaxHost 256 #define MinSequence 33000 #define MaxSequence 65536 #define MinPort 1024 #define MAXPACKET 4470 /* largest test packet size */ #define MINPACKET 28 /* 20 bytes IP header and 8 bytes ICMP or UDP */ #define MAXLABELS 8 /* http://kb.juniper.net/KB2190 (+ 3 just in case) */ /* stuff used by display such as report, curses... */ #define MAXFLD 20 /* max stats fields to display */ #if defined (__STDC__) && __STDC__ #define CONST const #else #define CONST /* */ #endif /* XXX This doesn't really belong in this header file, but as the right c-files include it, it will have to do for now. */ /* dynamic field drawing */ struct fields { CONST unsigned char key; CONST char *descr; CONST char *title; CONST char *format; int length; int (*net_xxx)(); }; extern struct fields data_fields[MAXFLD]; /* keys: the value in the array is the index number in data_fields[] */ extern int fld_index[]; extern unsigned char fld_active[]; extern char available_options[]; ip_t unspec_addr; /* MPLS label object */ struct mplslen { unsigned long label[MAXLABELS]; /* label value */ uint8 exp[MAXLABELS]; /* experimental bits */ uint8 ttl[MAXLABELS]; /* MPLS TTL */ char s[MAXLABELS]; /* bottom of stack */ char labels; /* how many labels did we get? */ }; void decodempls(int, char *, struct mplslen *, int); mtr-0.85/curses.c0000664000175000017500000004110612162522624012742 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #ifndef NO_CURSES #include #include #include /* MacOSX may need this before scoket.h...*/ #if defined(HAVE_SYS_TYPES_H) #include #else /* If a system doesn't have sys/types.h, lets hope that time_t is an int */ #define time_t int #endif #include #include #include #if defined(HAVE_NCURSES_H) # include #elif defined(HAVE_NCURSES_CURSES_H) # include #elif defined(HAVE_CURSES_H) # include #elif defined(HAVE_CURSESX_H) # include #else # error No curses header file available #endif #ifndef HAVE_ATTRON #define attron(x) #define attroff(x) #endif #ifndef getmaxyx # define getmaxyx(win,y,x) ((y) = (win)->_maxy + 1, (x) = (win)->_maxx + 1) #endif #include "mtr.h" #include "mtr-curses.h" #include "display.h" #include "net.h" #include "dns.h" #ifndef NO_IPINFO #include "asn.h" #endif #include "version.h" #endif #include extern char LocalHostname[]; extern int fstTTL; extern int maxTTL; extern int cpacketsize; extern int bitpattern; extern int tos; extern float WaitTime; extern int af; extern int mtrtype; static int __unused_int; void pwcenter(char *str) { int maxx; int cx; getmaxyx(stdscr, __unused_int, maxx); cx = (signed)(maxx - strlen(str)) / 2; while(cx-- > 0) printw(" "); printw(str); } int mtr_curses_keyaction(void) { int c = getch(); int i=0; float f = 0.0; char buf[MAXFLD+1]; if(c == 'q') return ActionQuit; if(c==3) return ActionQuit; if (c==12) return ActionClear; if ((c==19) || (tolower (c) == 'p')) return ActionPause; if ((c==17) || (c == ' ')) return ActionResume; if(tolower(c) == 'r') return ActionReset; if (tolower(c) == 'd') return ActionDisplay; if (tolower(c) == 'e') return ActionMPLS; if (tolower(c) == 'n') return ActionDNS; #ifndef NO_IPINFO if (tolower(c) == 'y') return ActionII; if (tolower(c) == 'z') return ActionAS; #endif if (c == '+') return ActionScrollDown; if (c == '-') return ActionScrollUp; if (tolower(c) == 's') { mvprintw(2, 0, "Change Packet Size: %d\n", cpacketsize ); mvprintw(3, 0, "Size Range: %d-%d, < 0:random.\n", MINPACKET, MAXPACKET); move(2,20); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh (); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; cpacketsize = atoi ( buf ); return ActionNone; } if (tolower(c) == 'b') { mvprintw(2, 0, "Ping Bit Pattern: %d\n", bitpattern ); mvprintw(3, 0, "Pattern Range: 0(0x00)-255(0xff), <0 random.\n"); move(2,18); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh (); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; bitpattern = atoi ( buf ); if( bitpattern > 255 ) { bitpattern = -1; } return ActionNone; } if ( c == 'Q') { /* can not be tolower(c) */ mvprintw(2, 0, "Type of Service(tos): %d\n", tos ); mvprintw(3, 0, "default 0x00, min cost 0x02, rel 0x04,, thr 0x08, low del 0x10...\n"); move(2,22); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh(); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; tos = atoi ( buf ); if( tos > 255 || tos <0 ) { tos = 0; } return ActionNone; } if (tolower(c) == 'i') { mvprintw(2, 0, "Interval : %0.0f\n\n", WaitTime ); move(2,11); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh(); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; f = atof( buf ); if (f <= 0.0) return ActionNone; if (getuid() != 0 && f < 1.0) return ActionNone; WaitTime = f; return ActionNone; } if (tolower(c) == 'f') { mvprintw(2, 0, "First TTL: %d\n\n", fstTTL ); move(2,11); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh(); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; i = atoi( buf ); if ( i < 1 || i> maxTTL ) return ActionNone; fstTTL = i; return ActionNone; } if (tolower(c) == 'm') { mvprintw(2, 0, "Max TTL: %d\n\n", maxTTL ); move(2,9); refresh(); while ( (c=getch ()) != '\n' && i < MAXFLD ) { attron(A_BOLD); printw("%c", c); attroff(A_BOLD); refresh(); buf[i++] = c; /* need more checking on 'c' */ } buf[i] = '\0'; i = atoi( buf ); if ( i < fstTTL || i>(MaxHost-1) ) return ActionNone; maxTTL = i; return ActionNone; } /* fields to display & their ordering */ if (tolower(c) == 'o') { mvprintw(2, 0, "Fields: %s\n\n", fld_active ); for( i=0; i 0 ) strcpy( fld_active, buf ); return ActionNone; } if (tolower(c) == 'j') { if( index(fld_active, 'N') ) { strcpy(fld_active, "DR AGJMXI"); /* GeoMean and jitter */ } else { strcpy(fld_active, "LS NABWV"); /* default */ } return ActionNone; } if (tolower(c) == 'u') { switch ( mtrtype ) { case IPPROTO_ICMP: case IPPROTO_TCP: mtrtype = IPPROTO_UDP; break; case IPPROTO_UDP: mtrtype = IPPROTO_ICMP; break; } return ActionNone; } if (tolower(c) == 't') { switch ( mtrtype ) { case IPPROTO_ICMP: case IPPROTO_UDP: mtrtype = IPPROTO_TCP; break; case IPPROTO_TCP: mtrtype = IPPROTO_ICMP; break; } return ActionNone; } /* reserve to display help message -Min */ if (tolower(c) == '?'|| tolower(c) == 'h') { int pressanykey_row = 20; mvprintw(2, 0, "Command:\n" ); printw(" ?|h help\n" ); printw(" p pause (SPACE to resume)\n" ); printw(" d switching display mode\n" ); printw(" e toggle MPLS information on/off\n" ); printw(" n toggle DNS on/off\n" ); printw(" r reset all counters\n" ); printw(" o str set the columns to display, default str='LRS N BAWV'\n" ); printw(" j toggle latency(LS NABWV)/jitter(DR AGJMXI) stats\n" ); printw(" c report cycle n, default n=infinite\n" ); printw(" i set the ping interval to n seconds, default n=1\n" ); printw(" f set the initial time-to-live(ttl), default n=1\n" ); printw(" m set the max time-to-live, default n= # of hops\n" ); printw(" s set the packet size to n or random(n<0)\n" ); printw(" b set ping bit pattern to c(0..255) or random(c<0)\n" ); printw(" Q set ping packet's TOS to t\n" ); printw(" u switch between ICMP ECHO and UDP datagrams\n" ); #ifndef NO_IPINFO printw(" y switching IP info\n"); printw(" z toggle ASN info on/off\n"); pressanykey_row += 2; #endif printw("\n"); mvprintw(pressanykey_row, 0, " press any key to go back..." ); getch(); /* get any key */ return ActionNone; } return ActionNone; /* ignore unknown input */ } void mtr_curses_hosts(int startstat) { int max; int at; struct mplslen *mpls, *mplss; ip_t *addr, *addrs; int y; char *name; int i, j, k; int hd_len; char buf[1024]; max = net_max(); for(at = net_min () + display_offset; at < max; at++) { printw("%2d. ", at + 1); addr = net_addr(at); mpls = net_mpls(at); if( addrcmp( (void *) addr, (void *) &unspec_addr, af ) != 0 ) { name = dns_lookup(addr); if (! net_up(at)) attron(A_BOLD); #ifndef NO_IPINFO if (is_printii()) printw(fmt_ipinfo(addr)); #endif if(name != NULL) { if (show_ips) printw("%s (%s)", name, strlongip(addr)); else printw("%s", name); } else { printw("%s", strlongip( addr ) ); } attroff(A_BOLD); getyx(stdscr, y, __unused_int); move(y, startstat); /* net_xxx returns times in usecs. Just display millisecs */ hd_len = 0; for( i=0; ilabels && enablempls; k++) { if((k+1 < mpls->labels) || (mpls->labels == 1)) { /* if we have more labels */ printw("\n [MPLS: Lbl %lu Exp %u S %u TTL %u]", mpls->label[k], mpls->exp[k], mpls->s[k], mpls->ttl[k]); } else { /* bottom label */ printw("\n [MPLS: Lbl %lu Exp %u S %u TTL %u]", mpls->label[k], mpls->exp[k], mpls->s[k], mpls->ttl[k]); } } /* Multi path */ for (i=0; i < MAXPATH; i++ ) { addrs = net_addrs(at, i); mplss = net_mplss(at, i); if ( addrcmp( (void *) addrs, (void *) addr, af ) == 0 ) continue; if ( addrcmp( (void *) addrs, (void *) &unspec_addr, af ) == 0 ) break; name = dns_lookup(addrs); if (! net_up(at)) attron(A_BOLD); printw("\n "); #ifndef NO_IPINFO if (is_printii()) printw(fmt_ipinfo(addrs)); #endif if (name != NULL) { if (show_ips) printw("%s (%s)", name, strlongip(addrs)); else printw("%s", name); } else { printw("%s", strlongip( addrs ) ); } for (k=0; k < mplss->labels && enablempls; k++) { printw("\n [MPLS: Lbl %lu Exp %u S %u TTL %u]", mplss->label[k], mplss->exp[k], mplss->s[k], mplss->ttl[k]); } attroff(A_BOLD); } } else { printw("???"); } printw("\n"); } move(2, 0); } #define NUM_FACTORS 8 static double factors[NUM_FACTORS]; static int scale[NUM_FACTORS]; static int low_ms, high_ms; void mtr_gen_scale(void) { int *saved, i, max, at; int range; low_ms = 1000000; high_ms = -1; for (i = 0; i < NUM_FACTORS; i++) { scale[i] = 0; } max = net_max(); for (at = display_offset; at < max; at++) { saved = net_saved_pings(at); for (i = 0; i < SAVED_PINGS; i++) { if (saved[i] < 0) continue; if (saved[i] < low_ms) { low_ms = saved[i]; } if (saved[i] > high_ms) { high_ms = saved[i]; } } } range = high_ms - low_ms; for (i = 0; i < NUM_FACTORS; i++) { scale[i] = low_ms + ((double)range * factors[i]); } } static char block_map[NUM_FACTORS]; void mtr_curses_init() { int i; int block_split; /* Initialize factors to a log scale. */ for (i = 0; i < NUM_FACTORS; i++) { factors[i] = ((double)1 / NUM_FACTORS) * (i + 1); factors[i] *= factors[i]; /* Squared. */ } /* Initialize block_map. */ block_split = (NUM_FACTORS - 2) / 2; if (block_split > 9) { block_split = 9; } for (i = 1; i <= block_split; i++) { block_map[i] = '0' + i; } for (i = block_split+1; i < NUM_FACTORS-1; i++) { block_map[i] = 'a' + i - block_split - 1; } block_map[0] = '.'; block_map[NUM_FACTORS-1] = '>'; } void mtr_print_scaled(int ms) { int i; for (i = 0; i < NUM_FACTORS; i++) { if (ms <= scale[i]) { printw("%c", block_map[i]); return; } } printw(">"); } void mtr_fill_graph(int at, int cols) { int* saved; int i; saved = net_saved_pings(at); for (i = SAVED_PINGS-cols; i < SAVED_PINGS; i++) { if (saved[i] == -2) { printw(" "); } else if (saved[i] == -1) { attron(A_BOLD); printw("?"); attroff(A_BOLD); } else { if (display_mode == 1) { if (saved[i] > scale[6]) { printw("%c", block_map[NUM_FACTORS-1]); } else { printw("."); } } else { mtr_print_scaled(saved[i]); } } } } void mtr_curses_graph(int startstat, int cols) { int max, at, y; ip_t * addr; char* name; max = net_max(); for (at = display_offset; at < max; at++) { printw("%2d. ", at+1); addr = net_addr(at); if (!addr) { printw("???\n"); continue; } if (! net_up(at)) attron(A_BOLD); if (addrcmp((void *) addr, (void *) &unspec_addr, af)) { #ifndef NO_IPINFO if (is_printii()) printw(fmt_ipinfo(addr)); #endif name = dns_lookup(addr); printw("%s", name?name:strlongip(addr)); } else printw("???"); attroff(A_BOLD); getyx(stdscr, y, __unused_int); move(y, startstat); printw(" "); mtr_fill_graph(at, cols); printw("\n"); } } void mtr_curses_redraw(void) { int maxx; int startstat; int rowstat; time_t t; int i, j; int hd_len = 0; char buf[1024]; char fmt[16]; erase(); getmaxyx(stdscr, __unused_int, maxx); rowstat = 5; move(0, 0); attron(A_BOLD); pwcenter("My traceroute [v" MTR_VERSION "]"); attroff(A_BOLD); mvprintw(1, 0, "%s (%s)", LocalHostname, net_localaddr()); /* printw("(tos=0x%X ", tos); printw("psize=%d ", packetsize ); printw("bitpattern=0x%02X)", (unsigned char)(abs(bitpattern))); if( cpacketsize > 0 ){ printw("psize=%d ", cpacketsize); } else { printw("psize=rand(%d,%d) ",MINPACKET, -cpacketsize); } if( bitpattern>=0 ){ printw("bitpattern=0x%02X)", (unsigned char)(bitpattern)); } else { printw("bitpattern=rand(0x00-FF))"); } */ time(&t); mvprintw(1, maxx-25, ctime(&t)); printw("Keys: "); attron(A_BOLD); printw("H"); attroff(A_BOLD); printw("elp "); attron(A_BOLD); printw("D"); attroff(A_BOLD); printw("isplay mode "); attron(A_BOLD); printw("R"); attroff(A_BOLD); printw("estart statistics "); attron(A_BOLD); printw("O"); attroff(A_BOLD); printw("rder of fields "); attron(A_BOLD); printw("q"); attroff(A_BOLD); printw("uit\n"); if (display_mode == 0) { for (i=0; i < MAXFLD; i++ ) { j = fld_index[fld_active[i]]; if (j < 0) continue; sprintf( fmt, "%%%ds", data_fields[j].length ); sprintf( buf + hd_len, fmt, data_fields[j].title ); hd_len += data_fields[j].length; } attron(A_BOLD); mvprintw(rowstat - 1, 0, " Host"); mvprintw(rowstat - 1, maxx-hd_len-1, "%s", buf); mvprintw(rowstat - 2, maxx-hd_len-1, " Packets Pings"); attroff(A_BOLD); move(rowstat, 0); mtr_curses_hosts(maxx-hd_len-1); } else { char msg[80]; int padding = 30; #ifndef NO_IPINFO if (is_printii()) padding += get_iiwidth(); #endif int max_cols = maxx<=SAVED_PINGS+padding ? maxx-padding : SAVED_PINGS; startstat = padding - 2; sprintf(msg, " Last %3d pings", max_cols); mvprintw(rowstat - 1, startstat, msg); attroff(A_BOLD); move(rowstat, 0); mtr_gen_scale(); mtr_curses_graph(startstat, max_cols); printw("\n"); attron(A_BOLD); printw("Scale:"); attroff(A_BOLD); for (i = 0; i < NUM_FACTORS-1; i++) { printw(" %c:%d ms", block_map[i], scale[i]/1000); } } refresh(); } void mtr_curses_open(void) { initscr(); raw(); noecho(); mtr_curses_init(); mtr_curses_redraw(); } void mtr_curses_close(void) { printw("\n"); endwin(); } void mtr_curses_clear(void) { mtr_curses_close(); mtr_curses_open(); } mtr-0.85/FORMATS0000664000175000017500000000625212104177057012335 0ustar wolffwolff The "split" format is for a separating the gui from the main program. The main program can be installed setuid, and you don't want to link a gui-library with a setuid program. The split format is: The "raw" format is: hostline|pingline|dnsline|timestampline hostline: h pingline: p dnsline: d timestampline: t Timestampline is not yet implemented. Need to find out how to do ICMP timestamping first. :-) Someone suggested to put the following text here. As to context: Some people are wondering why mtr sometimes reports hosts beyond the destination host. The FINAL host will occasionally be mentioned at position n, n+1, n+2 etc. You know traceroute, right? It sends a packet, waits for the reply to come back and when it comes back, it sends the next packet. If say hosts 5-8 do not send "time exceeded" packets, you'll wait a 4*3 = twelve seconds extra before you get any results on hosts 9 and further. MTR doesn't work like that. In theory we could send out a probe for host 1-40 all at once. But this would pose an unnecessary burden on the network. So what we do, is we send out probes for a max of 5 hosts beyond where we've seen a reply. So in the example above, we'd see a reply from router at position 4, then we'd send out 5-9 (and because the max-host is now at 9, we'll send them out at 1s/9 = 111ms intervals). When the reply from host 9 comes back, we'll start probing for host 10-15 (at about 60ms intervals). But suppose the network delay upto host 9 is already 200ms and suppose our destination host is at position 11. Then by the time the packet from host 11 comes back, we'll already have sent probe packets for position 12, 13, and 14! Those will come back as "destination reached" and be reported by the "raw" mode. Curses mode will stop showing hosts with position numbers beyond the first reply of the destination host. It could gather the information about replies to packets sent as probes FURTHER than it actually is into the line displayed at its true position, but it doesn't (yet). In fact the above example is almost completely true: % mtr -r -n -c 2 152.179.99.218 | tail -5 13.|-- 144.232.18.238 0.0% 2 94.8 95.4 94.8 96.0 0.8 14.|-- 152.63.16.182 0.0% 2 95.1 95.5 95.1 95.8 0.5 15.|-- 152.63.64.106 0.0% 2 163.9 163.9 163.9 164.0 0.1 16.|-- 152.63.50.89 50.0% 2 163.7 163.7 163.7 163.7 0.0 17.|-- 152.179.99.218 50.0% 2 168.2 168.2 168.2 168.2 0.0 % mtr -l -c 2 152.179.99.218 | grep -v "^[dp]" |tail -7 h 10 144.232.1.41 h 11 144.232.4.96 h 16 152.179.99.218 h 17 152.179.99.218 h 18 152.179.99.218 h 12 144.232.18.238 h 13 152.63.16.182 As you can see we get the reply from the destination host at position 16 AFTER we've sent probes for position 17 and 18. When those come back, they are reported. That's what raw mode does. It reports the raw information. If you write a backend for the raw mode, it's up to you to filter/display the results. h 10 144.232.1.41 h 11 144.232.4.96 h 12 144.232.18.238 h 13 152.63.16.182 h 14 152.63.64.106 h 15 152.63.50.89 h 16 152.179.99.218 h 17 152.179.99.218 h 18 152.179.99.218 mtr-0.85/split.o0000664000175000017500000004144012162522232012601 0ustar wolffwolffELF>( @@AWAVAUATUSHìhdH‹%(H‰„$X1Àè‹A‰Å9Ø},f.„‰Ú1À¾¿ƒëèƒ-D9ëuÞE…í޵A¼½é DL‰ÿèH…ÀI‰Æ„ü‹…À…¦‰ßè‰ß‰D$0è‰ß‰D$8è‰ßA‰Çè‰ß‰D$@è‰ß‰D$Hè‹t$0¿ÓMbA‰Á‹L$8D‹D$@D‹T$HD‰ $M‰ñ‰ðÁþ÷ï‰ÈÁùD‰D$A¸D‰T$Áú)ò¾‰T$(÷ïD‰øAÁÿÁú)ʹ‰T$ ÷ïH|$P1ÀÁúD)ú‰T$ºèH|$PL‰æA‰îè…ÀuNƒÅIÄE9î›]ÿ‰ß苾H‰ÇI‰Çè…À…ÓþÿÿÇD$P???ë§f„HL$P‰ê¾¿1ÀèH‹=èHt$PL‰çè9uÿÿÿ‰-IăÅE9îŒoÿÿÿf.„H‹„$XdH3%(umHÄh[]A\A]A^A_ÃL‰ÿèH¼$PH‰$M‰ñA¸¹º¾1ÀL´$Pèéþÿÿ„L‰ÿèI‰Æéôýÿÿèff.„Çÿÿÿÿ¸Ç???HH=uìóÃf.„óÃfffff.„H‹=Sè‰ÃèH‹H¾Ó‹¸ƒúqt€ût 1Àƒúr”ÀÀ[Ã-%d %s %s%s %d %d %d %d %d %d%d %s  int^Ž^ƒƒÔBØ{ W# }# }# }# }# }#( }#0 }#8 }#@ }#H }#P  }#X "¹#` $¿#h &W#p *W#t ,e#x 04#€ 1I#‚ 2Å#ƒ 6Õ#ˆ ?p# H{#˜ I{#  J{#¨ K{#° L•#¸ NW#À PÛ#Ä ´ º¹ »¹# ¼¿# ÀW#‚® ƒÕB{ ƒëB8ö Æ Ï2# 1- 24 4;È\Ê\ÌlÍ| lB |B 'ŒB ã    b  ƒ0Bÿ B UG` †ê ˆP# ˆP# ‹P# ‹P# ŒP# ŒP# ŽP# ‘ê# ’0# •^# –^#! —^#" ˜^## ™^#$ š^#% ›^#& œ^#' ^#( žW#,  k#0 £P#8 ¤P#: §W#< ¨W#@ ©q#H ±ö#P ³P#\ W0 ¬^ ®P# ®P# ¯P# ¯P# °P# °P# e;gW—gŠ>WÍ__s>}__n>•>Š Wø__s } Šg}"g}gŠH|maxJWatKWL|M ‘°{iNWwZ¬Š :!strd ‘°}d}—lÀµª"—hÀµª Z#u•#u•"w{Šë$†w°iˆW%“w&›W c¬ƒ'²WQ( ¥¿( ¦¿(?W( ~ë) Nq*af;W ƒ‚ BÿBÿ(Al (BW( ¥¿( ¦¿(?W+ ~ë ) Nq*af;W+Al  +BW % $ > $ > : ; I  I&I : ; : ;I8 : ;  : ;  : ; I8 I!I/  : ;  : ; I : ; (  : ; : ;I< .? : ; ' I 4 : ; I: ; I.? : ; ' @4: ; I4: ; I4: ; I 1RUX Y 1 U!4: ; I "1X Y #4: ; I$.? : ; ' @ %.? : ; ' @ &.? : ; ' I@' (4: ; I? < )4: ;I? < *4: ; I? < +4: ; I?  wwww  w( w0 w8:w :;w8;<w0<>w(>@w @BwBDwDHwH¥w 26P6@]E¥]b{0ŸruVu…^ V ^{Ä_ ¤P¤·_E _26 6QSQUQUVsŸV{S6b ŸŽšPš^^E~^~‚Yƒˆ‘°}Ÿˆ—P—›^› Pë^ Ÿë^ Ÿë^‘°{ŸPˆ ŸPˆ ŸPˆ‘°}Ÿ· Ÿº¿0Ÿðøwø(w()wÿP(S,)@NQV€^­ÀH ï !*8ACJP^­À^finP4û /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/netinet/usr/include/arpasplit.cstdio2.hstring3.htypes.hstddef.hlibio.hmtr.hin.hstdint.hncurses.hstdio.hnet.hdisplay.hnameser.h È.Ye=ÖpÖ<rXr`N> ÖsU19U++Uº+òUX+UÖ+U.+tUf4Ö <bžg E L ÈS Âa f q h† – :£ ºª ƒ¯ s¼ Ë Ú Üé hø ; . % v4 (C |R ça Šp ‰ Ž Ô ¯¬ n» 4Ë ÌÛ Aë ©û z  ¦ ­+ ´; »K Â[ ·k Ò| 4ƒ ë b M« rì n÷ Û 2 J T( ð; ?F õQ • œ› I¡ K§ ­ -³ }¹ }¿ ØÅ 1Ë ‰Ñ @× ‘Ý ä èð fö jü Û ­ * ÷ ã R1 < ŠH µU d s ´‚ ®‘ á  Û¯ ¾ Í 9Ü ë [ú X  Ð #' ä6 ýE ½T éc ¥r + Ó òŸ ® ½ ’Ì ëÛ —ë ‚÷ c ³ ¬" ?1 ÿ@ WO a šf ãy ‹  ™ ÉÁ  Ï ]ì  ú ¢  - Ÿ$ ü+3¥; N R\ ›a šk  p º‡ g@˜ § à­ 0Å <Ï  Øïà pï ·ø ã   P" /+ [4 ; ðD aO _ÀgØv §„ r‹°“Ö« Ó² ½¹àÁâÎ ÃÙðá)é ÷ú Cÿÿ  w ö, É9 eF AS 'ƒ § ’ öª É· eÄ AÑ !Ú 'ô §  ’ zóÊ Bº  A p°„à˜ðmtr-0.85/mtr-curses.h0000664000175000017500000000161412104140215013533 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for curses.c */ void mtr_curses_open(void); void mtr_curses_close(void); void mtr_curses_redraw(void); int mtr_curses_keyaction(void); void mtr_curses_clear(void); mtr-0.85/aclocal.m4.abra0000664000175000017500000011563112117071251014036 0ustar wolffwolff# generated automatically by aclocal 1.11.1 -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2007, 2008, 2009 Free Software Foundation, Inc. # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl m4_if(m4_defn([AC_AUTOCONF_VERSION]), [2.65],, [m4_warning([this file was generated for autoconf 2.65. You have another version of autoconf. It may work, but is not guaranteed to. If you have problems, you may need to regenerate the build system entirely. To do so, use the procedure documented by the package, typically `autoreconf'.])]) # pkg.m4 - Macros to locate and utilise pkg-config. -*- Autoconf -*- # # Copyright © 2004 Scott James Remnant . # # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, but # WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU # General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program; if not, write to the Free Software # Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. # # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # PKG_PROG_PKG_CONFIG([MIN-VERSION]) # ---------------------------------- AC_DEFUN([PKG_PROG_PKG_CONFIG], [m4_pattern_forbid([^_?PKG_[A-Z_]+$]) m4_pattern_allow([^PKG_CONFIG(_PATH)?$]) AC_ARG_VAR([PKG_CONFIG], [path to pkg-config utility])dnl if test "x$ac_cv_env_PKG_CONFIG_set" != "xset"; then AC_PATH_TOOL([PKG_CONFIG], [pkg-config]) fi if test -n "$PKG_CONFIG"; then _pkg_min_version=m4_default([$1], [0.9.0]) AC_MSG_CHECKING([pkg-config is at least version $_pkg_min_version]) if $PKG_CONFIG --atleast-pkgconfig-version $_pkg_min_version; then AC_MSG_RESULT([yes]) else AC_MSG_RESULT([no]) PKG_CONFIG="" fi fi[]dnl ])# PKG_PROG_PKG_CONFIG # PKG_CHECK_EXISTS(MODULES, [ACTION-IF-FOUND], [ACTION-IF-NOT-FOUND]) # # Check to see whether a particular set of modules exists. Similar # to PKG_CHECK_MODULES(), but does not set variables or print errors. # # # Similar to PKG_CHECK_MODULES, make sure that the first instance of # this or PKG_CHECK_MODULES is called, or make sure to call # PKG_CHECK_EXISTS manually # -------------------------------------------------------------- AC_DEFUN([PKG_CHECK_EXISTS], [AC_REQUIRE([PKG_PROG_PKG_CONFIG])dnl if test -n "$PKG_CONFIG" && \ AC_RUN_LOG([$PKG_CONFIG --exists --print-errors "$1"]); then m4_ifval([$2], [$2], [:]) m4_ifvaln([$3], [else $3])dnl fi]) # _PKG_CONFIG([VARIABLE], [COMMAND], [MODULES]) # --------------------------------------------- m4_define([_PKG_CONFIG], [if test -n "$PKG_CONFIG"; then if test -n "$$1"; then pkg_cv_[]$1="$$1" else PKG_CHECK_EXISTS([$3], [pkg_cv_[]$1=`$PKG_CONFIG --[]$2 "$3" 2>/dev/null`], [pkg_failed=yes]) fi else pkg_failed=untried fi[]dnl ])# _PKG_CONFIG # _PKG_SHORT_ERRORS_SUPPORTED # ----------------------------- AC_DEFUN([_PKG_SHORT_ERRORS_SUPPORTED], [AC_REQUIRE([PKG_PROG_PKG_CONFIG]) if $PKG_CONFIG --atleast-pkgconfig-version 0.20; then _pkg_short_errors_supported=yes else _pkg_short_errors_supported=no fi[]dnl ])# _PKG_SHORT_ERRORS_SUPPORTED # PKG_CHECK_MODULES(VARIABLE-PREFIX, MODULES, [ACTION-IF-FOUND], # [ACTION-IF-NOT-FOUND]) # # # Note that if there is a possibility the first call to # PKG_CHECK_MODULES might not happen, you should be sure to include an # explicit call to PKG_PROG_PKG_CONFIG in your configure.ac # # # -------------------------------------------------------------- AC_DEFUN([PKG_CHECK_MODULES], [AC_REQUIRE([PKG_PROG_PKG_CONFIG])dnl AC_ARG_VAR([$1][_CFLAGS], [C compiler flags for $1, overriding pkg-config])dnl AC_ARG_VAR([$1][_LIBS], [linker flags for $1, overriding pkg-config])dnl pkg_failed=no AC_MSG_CHECKING([for $1]) _PKG_CONFIG([$1][_CFLAGS], [cflags], [$2]) _PKG_CONFIG([$1][_LIBS], [libs], [$2]) m4_define([_PKG_TEXT], [Alternatively, you may set the environment variables $1[]_CFLAGS and $1[]_LIBS to avoid the need to call pkg-config. See the pkg-config man page for more details.]) if test $pkg_failed = yes; then _PKG_SHORT_ERRORS_SUPPORTED if test $_pkg_short_errors_supported = yes; then $1[]_PKG_ERRORS=`$PKG_CONFIG --short-errors --errors-to-stdout --print-errors "$2"` else $1[]_PKG_ERRORS=`$PKG_CONFIG --errors-to-stdout --print-errors "$2"` fi # Put the nasty error message in config.log where it belongs echo "$$1[]_PKG_ERRORS" >&AS_MESSAGE_LOG_FD ifelse([$4], , [AC_MSG_ERROR(dnl [Package requirements ($2) were not met: $$1_PKG_ERRORS Consider adjusting the PKG_CONFIG_PATH environment variable if you installed software in a non-standard prefix. _PKG_TEXT ])], [AC_MSG_RESULT([no]) $4]) elif test $pkg_failed = untried; then ifelse([$4], , [AC_MSG_FAILURE(dnl [The pkg-config script could not be found or is too old. Make sure it is in your PATH or set the PKG_CONFIG environment variable to the full path to pkg-config. _PKG_TEXT To get pkg-config, see .])], [$4]) else $1[]_CFLAGS=$pkg_cv_[]$1[]_CFLAGS $1[]_LIBS=$pkg_cv_[]$1[]_LIBS AC_MSG_RESULT([yes]) ifelse([$3], , :, [$3]) fi[]dnl ])# PKG_CHECK_MODULES # Copyright (C) 2002, 2003, 2005, 2006, 2007, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_AUTOMAKE_VERSION(VERSION) # ---------------------------- # Automake X.Y traces this macro to ensure aclocal.m4 has been # generated from the m4 files accompanying Automake X.Y. # (This private macro should not be called outside this file.) AC_DEFUN([AM_AUTOMAKE_VERSION], [am__api_version='1.11' dnl Some users find AM_AUTOMAKE_VERSION and mistake it for a way to dnl require some minimum version. Point them to the right macro. m4_if([$1], [1.11.1], [], [AC_FATAL([Do not call $0, use AM_INIT_AUTOMAKE([$1]).])])dnl ]) # _AM_AUTOCONF_VERSION(VERSION) # ----------------------------- # aclocal traces this macro to find the Autoconf version. # This is a private macro too. Using m4_define simplifies # the logic in aclocal, which can simply ignore this definition. m4_define([_AM_AUTOCONF_VERSION], []) # AM_SET_CURRENT_AUTOMAKE_VERSION # ------------------------------- # Call AM_AUTOMAKE_VERSION and AM_AUTOMAKE_VERSION so they can be traced. # This function is AC_REQUIREd by AM_INIT_AUTOMAKE. AC_DEFUN([AM_SET_CURRENT_AUTOMAKE_VERSION], [AM_AUTOMAKE_VERSION([1.11.1])dnl m4_ifndef([AC_AUTOCONF_VERSION], [m4_copy([m4_PACKAGE_VERSION], [AC_AUTOCONF_VERSION])])dnl _AM_AUTOCONF_VERSION(m4_defn([AC_AUTOCONF_VERSION]))]) # AM_AUX_DIR_EXPAND -*- Autoconf -*- # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # For projects using AC_CONFIG_AUX_DIR([foo]), Autoconf sets # $ac_aux_dir to `$srcdir/foo'. In other projects, it is set to # `$srcdir', `$srcdir/..', or `$srcdir/../..'. # # Of course, Automake must honor this variable whenever it calls a # tool from the auxiliary directory. The problem is that $srcdir (and # therefore $ac_aux_dir as well) can be either absolute or relative, # depending on how configure is run. This is pretty annoying, since # it makes $ac_aux_dir quite unusable in subdirectories: in the top # source directory, any form will work fine, but in subdirectories a # relative path needs to be adjusted first. # # $ac_aux_dir/missing # fails when called from a subdirectory if $ac_aux_dir is relative # $top_srcdir/$ac_aux_dir/missing # fails if $ac_aux_dir is absolute, # fails when called from a subdirectory in a VPATH build with # a relative $ac_aux_dir # # The reason of the latter failure is that $top_srcdir and $ac_aux_dir # are both prefixed by $srcdir. In an in-source build this is usually # harmless because $srcdir is `.', but things will broke when you # start a VPATH build or use an absolute $srcdir. # # So we could use something similar to $top_srcdir/$ac_aux_dir/missing, # iff we strip the leading $srcdir from $ac_aux_dir. That would be: # am_aux_dir='\$(top_srcdir)/'`expr "$ac_aux_dir" : "$srcdir//*\(.*\)"` # and then we would define $MISSING as # MISSING="\${SHELL} $am_aux_dir/missing" # This will work as long as MISSING is not called from configure, because # unfortunately $(top_srcdir) has no meaning in configure. # However there are other variables, like CC, which are often used in # configure, and could therefore not use this "fixed" $ac_aux_dir. # # Another solution, used here, is to always expand $ac_aux_dir to an # absolute PATH. The drawback is that using absolute paths prevent a # configured tree to be moved without reconfiguration. AC_DEFUN([AM_AUX_DIR_EXPAND], [dnl Rely on autoconf to set up CDPATH properly. AC_PREREQ([2.50])dnl # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` ]) # AM_CONDITIONAL -*- Autoconf -*- # Copyright (C) 1997, 2000, 2001, 2003, 2004, 2005, 2006, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 9 # AM_CONDITIONAL(NAME, SHELL-CONDITION) # ------------------------------------- # Define a conditional. AC_DEFUN([AM_CONDITIONAL], [AC_PREREQ(2.52)dnl ifelse([$1], [TRUE], [AC_FATAL([$0: invalid condition: $1])], [$1], [FALSE], [AC_FATAL([$0: invalid condition: $1])])dnl AC_SUBST([$1_TRUE])dnl AC_SUBST([$1_FALSE])dnl _AM_SUBST_NOTMAKE([$1_TRUE])dnl _AM_SUBST_NOTMAKE([$1_FALSE])dnl m4_define([_AM_COND_VALUE_$1], [$2])dnl if $2; then $1_TRUE= $1_FALSE='#' else $1_TRUE='#' $1_FALSE= fi AC_CONFIG_COMMANDS_PRE( [if test -z "${$1_TRUE}" && test -z "${$1_FALSE}"; then AC_MSG_ERROR([[conditional "$1" was never defined. Usually this means the macro was only invoked conditionally.]]) fi])]) # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2009 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 10 # There are a few dirty hacks below to avoid letting `AC_PROG_CC' be # written in clear, in which case automake, when reading aclocal.m4, # will think it sees a *use*, and therefore will trigger all it's # C support machinery. Also note that it means that autoscan, seeing # CC etc. in the Makefile, will ask for an AC_PROG_CC use... # _AM_DEPENDENCIES(NAME) # ---------------------- # See how the compiler implements dependency checking. # NAME is "CC", "CXX", "GCJ", or "OBJC". # We try a few techniques and use that to set a single cache variable. # # We don't AC_REQUIRE the corresponding AC_PROG_CC since the latter was # modified to invoke _AM_DEPENDENCIES(CC); we would have a circular # dependency, and given that the user is not expected to run this macro, # just rely on AC_PROG_CC. AC_DEFUN([_AM_DEPENDENCIES], [AC_REQUIRE([AM_SET_DEPDIR])dnl AC_REQUIRE([AM_OUTPUT_DEPENDENCY_COMMANDS])dnl AC_REQUIRE([AM_MAKE_INCLUDE])dnl AC_REQUIRE([AM_DEP_TRACK])dnl ifelse([$1], CC, [depcc="$CC" am_compiler_list=], [$1], CXX, [depcc="$CXX" am_compiler_list=], [$1], OBJC, [depcc="$OBJC" am_compiler_list='gcc3 gcc'], [$1], UPC, [depcc="$UPC" am_compiler_list=], [$1], GCJ, [depcc="$GCJ" am_compiler_list='gcc3 gcc'], [depcc="$$1" am_compiler_list=]) AC_CACHE_CHECK([dependency style of $depcc], [am_cv_$1_dependencies_compiler_type], [if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_$1_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n ['s/^#*\([a-zA-Z0-9]*\))$/\1/p'] < ./depcomp` fi am__universal=false m4_case([$1], [CC], [case " $depcc " in #( *\ -arch\ *\ -arch\ *) am__universal=true ;; esac], [CXX], [case " $depcc " in #( *\ -arch\ *\ -arch\ *) am__universal=true ;; esac]) for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. Also, some Intel # versions had trouble with output in subdirs am__obj=sub/conftest.${OBJEXT-o} am__minus_obj="-o $am__obj" case $depmode in gcc) # This depmode causes a compiler race in universal mode. test "$am__universal" = false || continue ;; nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; msvisualcpp | msvcmsys) # This compiler won't grok `-c -o', but also, the minuso test has # not run yet. These depmodes are late enough in the game, and # so weak that their functioning should not be impacted. am__obj=conftest.${OBJEXT-o} am__minus_obj= ;; none) break ;; esac if depmode=$depmode \ source=sub/conftest.c object=$am__obj \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c $am__minus_obj sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst1.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep $am__obj sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_$1_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_$1_dependencies_compiler_type=none fi ]) AC_SUBST([$1DEPMODE], [depmode=$am_cv_$1_dependencies_compiler_type]) AM_CONDITIONAL([am__fastdep$1], [ test "x$enable_dependency_tracking" != xno \ && test "$am_cv_$1_dependencies_compiler_type" = gcc3]) ]) # AM_SET_DEPDIR # ------------- # Choose a directory name for dependency files. # This macro is AC_REQUIREd in _AM_DEPENDENCIES AC_DEFUN([AM_SET_DEPDIR], [AC_REQUIRE([AM_SET_LEADING_DOT])dnl AC_SUBST([DEPDIR], ["${am__leading_dot}deps"])dnl ]) # AM_DEP_TRACK # ------------ AC_DEFUN([AM_DEP_TRACK], [AC_ARG_ENABLE(dependency-tracking, [ --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors]) if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi AM_CONDITIONAL([AMDEP], [test "x$enable_dependency_tracking" != xno]) AC_SUBST([AMDEPBACKSLASH])dnl _AM_SUBST_NOTMAKE([AMDEPBACKSLASH])dnl ]) # Generate code to set up dependency tracking. -*- Autoconf -*- # Copyright (C) 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. #serial 5 # _AM_OUTPUT_DEPENDENCY_COMMANDS # ------------------------------ AC_DEFUN([_AM_OUTPUT_DEPENDENCY_COMMANDS], [{ # Autoconf 2.62 quotes --file arguments for eval, but not when files # are listed without --file. Let's play safe and only enable the eval # if we detect the quoting. case $CONFIG_FILES in *\'*) eval set x "$CONFIG_FILES" ;; *) set x $CONFIG_FILES ;; esac shift for mf do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`AS_DIRNAME("$mf")` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`AS_DIRNAME(["$file"])` AS_MKDIR_P([$dirpart/$fdir]) # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done } ])# _AM_OUTPUT_DEPENDENCY_COMMANDS # AM_OUTPUT_DEPENDENCY_COMMANDS # ----------------------------- # This macro should only be invoked once -- use via AC_REQUIRE. # # This code is only required when automatic dependency tracking # is enabled. FIXME. This creates each `.P' file that we will # need in order to bootstrap the dependency handling code. AC_DEFUN([AM_OUTPUT_DEPENDENCY_COMMANDS], [AC_CONFIG_COMMANDS([depfiles], [test x"$AMDEP_TRUE" != x"" || _AM_OUTPUT_DEPENDENCY_COMMANDS], [AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir"]) ]) # Do all the work for Automake. -*- Autoconf -*- # Copyright (C) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, # 2005, 2006, 2008, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 16 # This macro actually does too much. Some checks are only needed if # your package does certain things. But this isn't really a big deal. # AM_INIT_AUTOMAKE(PACKAGE, VERSION, [NO-DEFINE]) # AM_INIT_AUTOMAKE([OPTIONS]) # ----------------------------------------------- # The call with PACKAGE and VERSION arguments is the old style # call (pre autoconf-2.50), which is being phased out. PACKAGE # and VERSION should now be passed to AC_INIT and removed from # the call to AM_INIT_AUTOMAKE. # We support both call styles for the transition. After # the next Automake release, Autoconf can make the AC_INIT # arguments mandatory, and then we can depend on a new Autoconf # release and drop the old call support. AC_DEFUN([AM_INIT_AUTOMAKE], [AC_PREREQ([2.62])dnl dnl Autoconf wants to disallow AM_ names. We explicitly allow dnl the ones we care about. m4_pattern_allow([^AM_[A-Z]+FLAGS$])dnl AC_REQUIRE([AM_SET_CURRENT_AUTOMAKE_VERSION])dnl AC_REQUIRE([AC_PROG_INSTALL])dnl if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." AC_SUBST([am__isrc], [' -I$(srcdir)'])_AM_SUBST_NOTMAKE([am__isrc])dnl # test to see if srcdir already configured if test -f $srcdir/config.status; then AC_MSG_ERROR([source directory already configured; run "make distclean" there first]) fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi AC_SUBST([CYGPATH_W]) # Define the identity of the package. dnl Distinguish between old-style and new-style calls. m4_ifval([$2], [m4_ifval([$3], [_AM_SET_OPTION([no-define])])dnl AC_SUBST([PACKAGE], [$1])dnl AC_SUBST([VERSION], [$2])], [_AM_SET_OPTIONS([$1])dnl dnl Diagnose old-style AC_INIT with new-style AM_AUTOMAKE_INIT. m4_if(m4_ifdef([AC_PACKAGE_NAME], 1)m4_ifdef([AC_PACKAGE_VERSION], 1), 11,, [m4_fatal([AC_INIT should be called with package and version arguments])])dnl AC_SUBST([PACKAGE], ['AC_PACKAGE_TARNAME'])dnl AC_SUBST([VERSION], ['AC_PACKAGE_VERSION'])])dnl _AM_IF_OPTION([no-define],, [AC_DEFINE_UNQUOTED(PACKAGE, "$PACKAGE", [Name of package]) AC_DEFINE_UNQUOTED(VERSION, "$VERSION", [Version number of package])])dnl # Some tools Automake needs. AC_REQUIRE([AM_SANITY_CHECK])dnl AC_REQUIRE([AC_ARG_PROGRAM])dnl AM_MISSING_PROG(ACLOCAL, aclocal-${am__api_version}) AM_MISSING_PROG(AUTOCONF, autoconf) AM_MISSING_PROG(AUTOMAKE, automake-${am__api_version}) AM_MISSING_PROG(AUTOHEADER, autoheader) AM_MISSING_PROG(MAKEINFO, makeinfo) AC_REQUIRE([AM_PROG_INSTALL_SH])dnl AC_REQUIRE([AM_PROG_INSTALL_STRIP])dnl AC_REQUIRE([AM_PROG_MKDIR_P])dnl # We need awk for the "check" target. The system "awk" is bad on # some platforms. AC_REQUIRE([AC_PROG_AWK])dnl AC_REQUIRE([AC_PROG_MAKE_SET])dnl AC_REQUIRE([AM_SET_LEADING_DOT])dnl _AM_IF_OPTION([tar-ustar], [_AM_PROG_TAR([ustar])], [_AM_IF_OPTION([tar-pax], [_AM_PROG_TAR([pax])], [_AM_PROG_TAR([v7])])]) _AM_IF_OPTION([no-dependencies],, [AC_PROVIDE_IFELSE([AC_PROG_CC], [_AM_DEPENDENCIES(CC)], [define([AC_PROG_CC], defn([AC_PROG_CC])[_AM_DEPENDENCIES(CC)])])dnl AC_PROVIDE_IFELSE([AC_PROG_CXX], [_AM_DEPENDENCIES(CXX)], [define([AC_PROG_CXX], defn([AC_PROG_CXX])[_AM_DEPENDENCIES(CXX)])])dnl AC_PROVIDE_IFELSE([AC_PROG_OBJC], [_AM_DEPENDENCIES(OBJC)], [define([AC_PROG_OBJC], defn([AC_PROG_OBJC])[_AM_DEPENDENCIES(OBJC)])])dnl ]) _AM_IF_OPTION([silent-rules], [AC_REQUIRE([AM_SILENT_RULES])])dnl dnl The `parallel-tests' driver may need to know about EXEEXT, so add the dnl `am__EXEEXT' conditional if _AM_COMPILER_EXEEXT was seen. This macro dnl is hooked onto _AC_COMPILER_EXEEXT early, see below. AC_CONFIG_COMMANDS_PRE(dnl [m4_provide_if([_AM_COMPILER_EXEEXT], [AM_CONDITIONAL([am__EXEEXT], [test -n "$EXEEXT"])])])dnl ]) dnl Hook into `_AC_COMPILER_EXEEXT' early to learn its expansion. Do not dnl add the conditional right here, as _AC_COMPILER_EXEEXT may be further dnl mangled by Autoconf and run in a shell conditional statement. m4_define([_AC_COMPILER_EXEEXT], m4_defn([_AC_COMPILER_EXEEXT])[m4_provide([_AM_COMPILER_EXEEXT])]) # When config.status generates a header, we must update the stamp-h file. # This file resides in the same directory as the config header # that is generated. The stamp files are numbered to have different names. # Autoconf calls _AC_AM_CONFIG_HEADER_HOOK (when defined) in the # loop where config.status creates the headers, so we can generate # our stamp files there. AC_DEFUN([_AC_AM_CONFIG_HEADER_HOOK], [# Compute $1's index in $config_headers. _am_arg=$1 _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`AS_DIRNAME(["$_am_arg"])`/stamp-h[]$_am_stamp_count]) # Copyright (C) 2001, 2003, 2005, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_SH # ------------------ # Define $install_sh. AC_DEFUN([AM_PROG_INSTALL_SH], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi AC_SUBST(install_sh)]) # Copyright (C) 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # Check whether the underlying file-system supports filenames # with a leading dot. For instance MS-DOS doesn't. AC_DEFUN([AM_SET_LEADING_DOT], [rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null AC_SUBST([am__leading_dot])]) # Check to see how 'make' treats includes. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2009 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 4 # AM_MAKE_INCLUDE() # ----------------- # Check to see how make treats includes. AC_DEFUN([AM_MAKE_INCLUDE], [am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo this is the am__doit target .PHONY: am__doit END # If we don't find an include directive, just comment out the code. AC_MSG_CHECKING([for style of include used by $am_make]) am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # Ignore all kinds of additional output from `make'. case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=include am__quote= _am_result=GNU ;; esac # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=.include am__quote="\"" _am_result=BSD ;; esac fi AC_SUBST([am__include]) AC_SUBST([am__quote]) AC_MSG_RESULT([$_am_result]) rm -f confinc confmf ]) # Fake the existence of programs that GNU maintainers use. -*- Autoconf -*- # Copyright (C) 1997, 1999, 2000, 2001, 2003, 2004, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 6 # AM_MISSING_PROG(NAME, PROGRAM) # ------------------------------ AC_DEFUN([AM_MISSING_PROG], [AC_REQUIRE([AM_MISSING_HAS_RUN]) $1=${$1-"${am_missing_run}$2"} AC_SUBST($1)]) # AM_MISSING_HAS_RUN # ------------------ # Define MISSING if not defined so far and test if it supports --run. # If it does, set am_missing_run to use it, otherwise, to nothing. AC_DEFUN([AM_MISSING_HAS_RUN], [AC_REQUIRE([AM_AUX_DIR_EXPAND])dnl AC_REQUIRE_AUX_FILE([missing])dnl if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= AC_MSG_WARN([`missing' script is too old or missing]) fi ]) # Copyright (C) 2003, 2004, 2005, 2006 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_MKDIR_P # --------------- # Check for `mkdir -p'. AC_DEFUN([AM_PROG_MKDIR_P], [AC_PREREQ([2.60])dnl AC_REQUIRE([AC_PROG_MKDIR_P])dnl dnl Automake 1.8 to 1.9.6 used to define mkdir_p. We now use MKDIR_P, dnl while keeping a definition of mkdir_p for backward compatibility. dnl @MKDIR_P@ is magic: AC_OUTPUT adjusts its value for each Makefile. dnl However we cannot define mkdir_p as $(MKDIR_P) for the sake of dnl Makefile.ins that do not define MKDIR_P, so we do our own dnl adjustment using top_builddir (which is defined more often than dnl MKDIR_P). AC_SUBST([mkdir_p], ["$MKDIR_P"])dnl case $mkdir_p in [[\\/$]]* | ?:[[\\/]]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac ]) # Helper functions for option handling. -*- Autoconf -*- # Copyright (C) 2001, 2002, 2003, 2005, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 4 # _AM_MANGLE_OPTION(NAME) # ----------------------- AC_DEFUN([_AM_MANGLE_OPTION], [[_AM_OPTION_]m4_bpatsubst($1, [[^a-zA-Z0-9_]], [_])]) # _AM_SET_OPTION(NAME) # ------------------------------ # Set option NAME. Presently that only means defining a flag for this option. AC_DEFUN([_AM_SET_OPTION], [m4_define(_AM_MANGLE_OPTION([$1]), 1)]) # _AM_SET_OPTIONS(OPTIONS) # ---------------------------------- # OPTIONS is a space-separated list of Automake options. AC_DEFUN([_AM_SET_OPTIONS], [m4_foreach_w([_AM_Option], [$1], [_AM_SET_OPTION(_AM_Option)])]) # _AM_IF_OPTION(OPTION, IF-SET, [IF-NOT-SET]) # ------------------------------------------- # Execute IF-SET if OPTION is set, IF-NOT-SET otherwise. AC_DEFUN([_AM_IF_OPTION], [m4_ifset(_AM_MANGLE_OPTION([$1]), [$2], [$3])]) # Check to make sure that the build environment is sane. -*- Autoconf -*- # Copyright (C) 1996, 1997, 2000, 2001, 2003, 2005, 2008 # Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 5 # AM_SANITY_CHECK # --------------- AC_DEFUN([AM_SANITY_CHECK], [AC_MSG_CHECKING([whether build environment is sane]) # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[[\\\"\#\$\&\'\`$am_lf]]*) AC_MSG_ERROR([unsafe absolute working directory name]);; esac case $srcdir in *[[\\\"\#\$\&\'\`$am_lf\ \ ]]*) AC_MSG_ERROR([unsafe srcdir value: `$srcdir']);; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$[*]" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$[*]" != "X $srcdir/configure conftest.file" \ && test "$[*]" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". AC_MSG_ERROR([ls -t appears to fail. Make sure there is not a broken alias in your environment]) fi test "$[2]" = conftest.file ) then # Ok. : else AC_MSG_ERROR([newly created file is older than distributed files! Check your system clock]) fi AC_MSG_RESULT(yes)]) # Copyright (C) 2001, 2003, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # AM_PROG_INSTALL_STRIP # --------------------- # One issue with vendor `install' (even GNU) is that you can't # specify the program used to strip binaries. This is especially # annoying in cross-compiling environments, where the build's strip # is unlikely to handle the host's binaries. # Fortunately install-sh will honor a STRIPPROG variable, so we # always use install-sh in `make install-strip', and initialize # STRIPPROG with the value of the STRIP variable (set by the user). AC_DEFUN([AM_PROG_INSTALL_STRIP], [AC_REQUIRE([AM_PROG_INSTALL_SH])dnl # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. dnl Don't test for $cross_compiling = yes, because it might be `maybe'. if test "$cross_compiling" != no; then AC_CHECK_TOOL([STRIP], [strip], :) fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" AC_SUBST([INSTALL_STRIP_PROGRAM])]) # Copyright (C) 2006, 2008 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Prevent Automake from outputting VARIABLE = @VARIABLE@ in Makefile.in. # This macro is traced by Automake. AC_DEFUN([_AM_SUBST_NOTMAKE]) # AM_SUBST_NOTMAKE(VARIABLE) # --------------------------- # Public sister of _AM_SUBST_NOTMAKE. AC_DEFUN([AM_SUBST_NOTMAKE], [_AM_SUBST_NOTMAKE($@)]) # Check how to create a tarball. -*- Autoconf -*- # Copyright (C) 2004, 2005 Free Software Foundation, Inc. # # This file is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # serial 2 # _AM_PROG_TAR(FORMAT) # -------------------- # Check how to create a tarball in format FORMAT. # FORMAT should be one of `v7', `ustar', or `pax'. # # Substitute a variable $(am__tar) that is a command # writing to stdout a FORMAT-tarball containing the directory # $tardir. # tardir=directory && $(am__tar) > result.tar # # Substitute a variable $(am__untar) that extract such # a tarball read from stdin. # $(am__untar) < result.tar AC_DEFUN([_AM_PROG_TAR], [# Always define AMTAR for backward compatibility. AM_MISSING_PROG([AMTAR], [tar]) m4_if([$1], [v7], [am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -'], [m4_case([$1], [ustar],, [pax],, [m4_fatal([Unknown tar format])]) AC_MSG_CHECKING([how to create a $1 tar archive]) # Loop over all known methods to create a tar archive until one works. _am_tools='gnutar m4_if([$1], [ustar], [plaintar]) pax cpio none' _am_tools=${am_cv_prog_tar_$1-$_am_tools} # Do not fold the above two line into one, because Tru64 sh and # Solaris sh will not grok spaces in the rhs of `-'. for _am_tool in $_am_tools do case $_am_tool in gnutar) for _am_tar in tar gnutar gtar; do AM_RUN_LOG([$_am_tar --version]) && break done am__tar="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$$tardir"' am__tar_="$_am_tar --format=m4_if([$1], [pax], [posix], [$1]) -chf - "'"$tardir"' am__untar="$_am_tar -xf -" ;; plaintar) # Must skip GNU tar: if it does not support --format= it doesn't create # ustar tarball either. (tar --version) >/dev/null 2>&1 && continue am__tar='tar chf - "$$tardir"' am__tar_='tar chf - "$tardir"' am__untar='tar xf -' ;; pax) am__tar='pax -L -x $1 -w "$$tardir"' am__tar_='pax -L -x $1 -w "$tardir"' am__untar='pax -r' ;; cpio) am__tar='find "$$tardir" -print | cpio -o -H $1 -L' am__tar_='find "$tardir" -print | cpio -o -H $1 -L' am__untar='cpio -i -H $1 -d' ;; none) am__tar=false am__tar_=false am__untar=false ;; esac # If the value was cached, stop now. We just wanted to have am__tar # and am__untar set. test -n "${am_cv_prog_tar_$1}" && break # tar/untar a dummy directory, and stop if the command works rm -rf conftest.dir mkdir conftest.dir echo GrepMe > conftest.dir/file AM_RUN_LOG([tardir=conftest.dir && eval $am__tar_ >conftest.tar]) rm -rf conftest.dir if test -s conftest.tar; then AM_RUN_LOG([$am__untar /dev/null 2>&1 && break fi done rm -rf conftest.dir AC_CACHE_VAL([am_cv_prog_tar_$1], [am_cv_prog_tar_$1=$_am_tool]) AC_MSG_RESULT([$am_cv_prog_tar_$1])]) AC_SUBST([am__tar]) AC_SUBST([am__untar]) ]) # _AM_PROG_TAR mtr-0.85/split.h0000664000175000017500000000167012104140215012564 0ustar wolffwolff/* mtr -- a network diagnostic tool split.h -- raw output (for inclusion in KDE Network Utilities) Copyright (C) 1998 Bertrand Leconte This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Prototypes for split.c */ void split_open(void); void split_close(void); void split_redraw(void); int split_keyaction(void); mtr-0.85/report.o0000664000175000017500000010767012162522442012774 0ustar wolffwolffELF>˜M@@H‰\$èH‰l$ðH‰õL‰d$øHƒì(‹H‰û¾H‰ïè…ÀtH‹ …ÉuFH‰ïèH‰Áº¾QH‰ß1ÀèH˜H‹\$H‹l$L‹d$ HƒÄ(ÃfD¹ëÉ‹5H‰ïèH…ÀI‰Ät¤‹…Òt ‹…ÀuI‹ $ë˜H‰ïèH‰$M‹ $A¸HÇÁÿÿÿÿº¾QH‰ß1ÀèH˜évÿÿÿ„S1ÿHƒìèH|$H‰D$èH‰ÃH‰ÇèÆDÿHƒÄH‰Ø[Ãfff.„Hƒìè¾H‰Â¿1ÀHƒÄéffffff.„AUI‰ýATUSHƒì€X~FH‰ûH‰ýE1ä@¶K@D¶KH1ÀD¾CPH‹U¾¿AƒÄHƒÃHƒÅèA¾EXD9àÇHƒÄ[]A\A]Ãfff.„AWAVAUATUSHìÈ‹-dH‹%(H‰„$¸1ÀÇD$,!…í…?‹D‹L$,…Àx‰Â‹Áú÷=…Û‰…sH¼$ A¸¹º¾1ÀLt$@èL„$ 1ÀA¹¹º¾L‰÷èD‹D‹d$,E…Òt;M‰ôA‹$IƒÄ‚ÿþþþ÷Ò!Ð%€€€€tç‰ÂÁê©€€DÂIT$LDâÀIƒÜE)ô»€¶‹……ÀxiH˜H¼$ A¸H,@¹º¾1ÀHÁåD‹èL‹IcüL„$ L÷HÇÁÿÿÿÿº¾1ÀèD¥HƒÃHû…xÿÿÿL‰÷èè‰D$<è9D$<ŽƒÀ‰D$(H„$@H‰D$ @D‹d$(AƒìD‰çèD‰çH‰ÃèH‹|$ H‰ÞH‰D$0è2üÿÿè…ÀD‹L$,„äH¼$ A¸¹º¾1ÀèH‰ßè‹T$(D‹L$(L„$ H‰$¹¾L‰÷1À‰T$8H‹T$ H‰T$ºèD‹ D‹l$,E…Ét:M‰õA‹UIƒÅ‚ÿþþþ÷Ò!Ð%€€€€tç‰ÂÁê©€€DÂIULDêÀIƒÝE)õ½ëWfDAÿW ò*ÀM‹GIcýHÇÁÿÿÿÿºL÷¾¸ò^èH[HÁàD¨HƒÅHýto¶E‹……ÛxäHcÛ¾fL<[IÁçIÇI‹èH…ÀD‰ç¸…oÿÿÿAÿW M‹GIcýA‰ÁL÷HÇÁÿÿÿÿº¾1ÀèévÿÿÿL‰÷»è‰ÞD‰çè‰ÞD‰çI‰Çè‹L‰þ¿H‰Åè…À„·E1í„‹D‰îD‰ç‰T$è‹T$H‰ÆL‰ÿè…ÀtxAƒÅA9Ý|Ïè…ÀtfƒûuH‹D$0€xXtD‹E…À…"H‹|$ L‰þèæùÿÿL‰ÿèH‹L$ H‰Â¿1À¾è‹=…ÿ…Ù€ƒÃƒû…ÿÿÿè…Àt#ƒûuH‹D$0€xXt‹5…ö…¹DƒD$(‹T$89T$<ýÿÿH‹„$¸dH3%(…'HÄÈ[]A\A]A^A_ÃH¼$ A¸¹º¾1Àè‹D$(H‹T$ L„$ ¹¾L‰÷‰D$8H‰$A‰Áº1Àèé&ýÿÿH‰ïèé!ÿÿÿH‰ÇèéÑþÿÿH‰Çèé?ÿÿÿ¿è‰D$,è‰Åè9ʼnÃŽúÿÿH”$@D‹d$,I‰Õ‰ßèL‰ïH‰Æèqøÿÿ…ÀtA9ÄDLàƒÃ9ëuÜD‰d$,é_úÿÿD‰ËèD‹L$,D‹ƒÃ‰\$,AÁE…ÛAADDÈé_úÿÿèfóÃfffff.„éff.„óÃfffff.„AWº¾¿AVAUATUSHƒìhH‹ dH‹%(H‰D$X1Àè‹1À¾¿è‹…ÒˆÂ1À¾¿è‹…ÀˆË¶Ð¾¿1À苾¿1ÀèèA‰ÅèA9ʼnÅŽ7‰ïDe»èH‰çH‰Æè÷ÿÿH‰áD‰â¾¿1ÀèëA@AÿW ò*ÀI‹–H‰æ¿¸H‰Ñò^èHƒÃHû„«¶‹……ÀxáI¾ H˜ºQL‰4$L4@H‰çÇD$<%s>ÆD$ IÁæM¾I‹wèºQ¾H‰çèI‹¾fèH…À‰ï¸…HÿÿÿAÿW I‹–‰ÁH‰æ1À¿HƒÃI‰ÐèHû…Uÿÿÿ¿èE9ìtD‰åéÉþÿÿ¿èH‹D$XdH3%(uMHƒÄh[]A\A]A^A_ÉÑ1Àº÷Ù¾¿è‹…À‰5þÿÿ¾¿1Àèé3þÿÿèffff.„óÃfffff.„AWAVAUATUSHì¨dH‹%(H‰„$˜1ÀH‰|$8¸f¶HƒÀH=‹•uêèA‰ÇèA9ÇŽ[D`Ll$@Al$ÿ‰ïèL‰ïH‰ÆI‰Æèîôÿÿ‰ïè‰Â‹…À…GL‰÷‰T$(èH…À‹T$(t H‰Çè‹T$(L‹ H‹L$8A¸‰T$H‰D$º¾¿1ÀE‰æL‰l$D‰$$èÇD$4ë1€ÿR ò*À¾¿¸ò^èƒl$4tnHcÛ¶ƒ‹……ÛxäHcþfH@HÁâH‹ºHÂH‰T$(èH…À‰ïH‹T$(¸uˆÿR ¾‰Â¿1Àèƒl$4u•¿ AƒÄèE9þŒ±þÿÿH‹„$˜dH3%(uSHĨ[]A\A]A^A_Ã@L‹ H‹L$8A¸‰T$¾º¿1ÀE‰æL‰l$D‰$$èéÚþÿÿè%s%s (%s)???Start: %s HOST: %%-%ds%%%ds %%2d. %%s%%-%ds %%2d.|-- %%-%ds %s%s OK0.85MTR.%s;%lu;%s;%s;%d;%s;%s;%dMTR.%s;%lu;%s;%s;%d;%s;%d, %.2f, %d [MPLS: Lbl %lu Exp %u S %u TTL %u] @@int^Ž^•^ŽL{ÔBŽÉB Ø– W# ˆ# ˆ# ˆ# ˆ# ˆ#( ˆ#0 ˆ#8 ˆ#@ ˆ#H ˆ#P  ˆ#X "Ô#` $Ú#h &W#p *W#t ,e#x 04#€ 1I#‚ 2à#ƒ 6ð#ˆ ?p# H†#˜ I†#  J†#¨ K†#° L #¸ NW#À Pö#Ä ´ ºÔ »Ô# ¼Ú# ÀW#ÉŽðB–ŽB Ž1-244; È\ Ê\ Ìl Í|lB|B'ŒB  Ƨ Ï2#ˆ e gˆ# h§# iW# jW# k§# - 8Œ 0 mwkey nw# o# p# q# rW# s‡#(-W‡| ` Þ ‚Þ#exp ƒî#@ttl „î#Hs …¹#P †Ž#XBîBþB>W4__s>ˆ__n> >gWTggˆ~gˆgŽˆ¨ŽˆŽD èdstDˆD DèGî ­¨n¹ÏÄQÛþJ S ' ŸQ!5ˆ°"now7•"t8ˆ#?ö$4A G Ÿ#QQ%QQ"kRW$4TG#Xµ "iZW"jZW"atZW"maxZW"zZW"wZW&[Q&[Q&\è&]è'^µ ‘À~(buf_Å ‘Àv(fmt`Ö ‘ "lenaW&bW&tW)þ~’')þ‚Å')þˆø')þ‰+ ')þ—^ ')þ˜‘ ')þ§À *')þªï *'+) &·W4ÈG,þ›` ')þœ“ '-&kWŽÅ BPŽÖ .BÿŽæ B/ûw0w0w1 ‚ 2iW2jW2atW2maxW3è4µ ‘à~54â G Ÿ64 G Ÿ645 G64[ G64 G54&£ G540Å G545ç G5~, *œ‘6~-= œ‘54_ G74G0Aw1Eí8nowE•2iGW2jGW2atGW2maxGW3Hè4Iµ ‘à~3VW9…3Xˆ:4ZG54g§G64iÍG:4]G; ¥Ú; ¦Ú; =WW; ?W>B; v.WV=; zK-n=; {c; ~ ;W;WŽ­=;)¢;*ˆ;-W;.W ~  ;W;W;)¢;*ˆ;-W;.W $ > : ; I  II!I/  : ; : ;I8 : ;  : ;  : ; I8 &I : ;  : ; I : ; I8 I.? : ; ' I 4 : ; I: ; I.: ; ' I  4: ; I.1@11  U411X Y 1 !.? : ; ' I@"4: ; I#.? : ; ' @$1RUX Y %: ; I&4: ; I'4: ; I (4: ; I )1RUX Y *1+ U,1X Y - .!I//.? : ; ' @ 0.? : ;' @ 1.? : ;' @24: ;I34: ;I44: ;I 51RUX Y61X Y71X Y8: ;I9 :1RUX Y;4: ; I? < <4: ; I? < =!>4: ; I?  wqw0qxwxèw0'U'cSrèS$T$hVrèV”¦P¦è\ðñwñ÷w÷w #w#$w P $‘hP#S#$P04w4LwLQw`bwbgwghwhiw imw(m½w0½¾w(¾¿w ¿ÁwÁÃwÃÄw`|U|Ã]`|0Ÿ¯¹\|¹ ŸÐÒwÒÔwÔÖwÖØw ØÙw(ÙÚw0Úáw8á¹w€ ¹ºw8º»w0»½w(½¿w ¿ÁwÁÃwÃÄwÄÞw€ ÔÙ0Ÿ“š0ŸêPšäSüp2$_S~‹P‹—pŸ—œ‘¨v”1Ÿˆ›‘¨vg}P}«Sy}P}I‘¼v^bPb«VÙÞ‘¼vS\SÜI]"<]ÉÍPÍ›‘°vÄI‘°v˜œPœ›V"IV·»P»šSÄ"S„ŽPúœ0Ÿ‚†P†›_"I_IÙ0ŸúÔ0ŸÔœ\“m]IÙ0Ÿú !Ÿ I‘¬vIW!ŸW[P[}‘¬v}«\«²Y²Â‘¬vÂÙSÙÞ‘¬v 8‘¬v8`Y«²Y²É‘¬vÉÔYÔÙp~Ÿ8I ŸÙÞ Ÿ8I@ŸÙÞ@Ÿ8I‘ ŸÙÞ‘ ŸaI‘ ŸÙÞ‘ ŸaI ŸÙÞ ŸaÁ^ÁÄ‘ÀvŸÄI^ÙÞ^îW ŸîW@ŸîW‘ Ÿ#W‘ Ÿ#W Ÿ#W| $ &‘" ÀŸàH ŸàH@ŸàH‘ Ÿ4H‘ Ÿ4H Ÿ4H^¤Õ Ÿ¤Õ} $ &‘" ÀŸ?_ Ÿ?_} $ &‘" ÀŸ˜›0Ÿ"I0Ÿ"I Ÿ"/ ŸÄ" ŸÄ"@ŸÄ"‘ Ÿ "‘ Ÿ " Ÿ "^«Pw#w#%w%'w '(w(()w0)-w8-% w % & w8& ' w0' ) w() + w + - w- / w/ 0 w0 s w   0ŸO PÊÐPÐ V U ú Vú  \ÀÄPÄ+ ]n s ]àêPn Ÿ¡ Ÿ¡0 Ÿn s Ÿë Ÿ 4 WË ð W 4 W| ð W 4 Ÿ ð Ÿ 4 W ð W0 X ŸX n Ÿ ’ w’ ” w” – w– ˜ w ˜ ™ w(™ š w0š ¡ w8¡ a wàa b w8b c w0c e w(e g w g i wi k wk p wp ² wà Ú UÚ ² ‘Ø~´ ¾ 0Ÿ‡ ‘ 0ŸÔ Ú q2$Ú Ó SÓ Ú p2$Ú b Sl ² Sã õ PÞ â Pâ k _l ² _  P y ^l š ^ ! P! 4 Ql Q § ‘°~5 E PF v Pv † ‘°~y ‡ Ÿ› » Ÿ - Ÿš ­ Ÿ,² 0\xè9HLQ„žª¯8W\aW\aˆðþ##*-58PÕÚà04H¨¬¯»¾ÈÐÕ59B`pP"<ì "!-4DIÖÛë  ' / 4 4 8 Ë ã _ d l o ‡ 2 9 ; J ý ‡ ˜ > p ­ J v y ‡ Ÿ ® ¶ » p — š ­ 9û /usr/include/x86_64-linux-gnu/bits/usr/include/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/netinetreport.cstdio2.hstring3.htypes.htime.hstddef.hlibio.hstdint.hin.hnetdb.hmtr.hnet.hstdio.hasn.h ÃZd>Ÿy‚ /tˆ×;=/x< fw‚ )lä#+MYWYƒÊMK(XYä'Jh<Ê/JjºjX j uf .„‚eYK/e‘-gJfÁÖ¿XÂ,U;-ºŸL¹.ÇÖ¹JǹJÈ.¸<È‚¸<Étz¬eÈ%‚‘YHž9òƒ;=YY[«tÕX«f×$©º×ä©ÖßžGIšJæJš<溚<æžš‚ìXt.‘­M#€j—JéJ—(ÈË<µXÌ‚ŸW=ZÔ>x( ‘.ôÉ¡‚à‚kJ4º‘ò/¦XèÖÉ~)Û$¥ÛJ¥‚‰<Ä$Èý~È×uY-/ZuU= qu>ýòxöøöÜ~.¤äÜ~º¤tÜ~ò«¬Õ~Ö°×Ï~<·(ƒY;/g1Ã~JºXYÅ~¬ÉºH¹~¬Çò¹~‚¾ÉŸÀ~JÞä~.YXÃJä~JY<ÃÈä~¬Ÿžql´~¬¾tÂ~ȹžÇ~ÈÕžYÖÒ~.®tÒ~.°äÐ~ÖÕX$õÜsgs3ƒYsue=Z‘×»~ºñ,=Ž~XÝ!‚~tþä‚~‚øXuM+-YW1€~<ø.ˆ~žéÖû})ô'=‹~X…Öprintf__off_t_IO_read_ptr_chain__in6_usize_t_shortbufxml_openreport_closecsv_open_IO_buf_baselong long unsigned intaddrfmtinfo__srciiwidth_lenlong long intsigned charmplsMaxPing_filenoipinfo_no_IO_read_end__u6_addr16long int__u6_addr32_flagsunsigned int_IO_buf_endcsv_closehostentenablemplsuint16_t_old_offset_offsetsnprint_addrdata_fields__pad1show_ipsstrcpystdinnet_xxxlen_hostsreport.cnlenh_name_IO_write_ptrnameunspec_addr_sbufuint8short unsigned intip_tlast_IO_save_baseh_addrtypeaddr2dst_lenlabel_lock_flags2_modestrcatstdoutmplssmplslenlen_tmptxt_close_IO_write_endh_aliasestitlereportwide_IO_lock_t_IO_FILE/home/wolff/mtrtime_tbitpattern_posh_lengthh_addr_listdescrunsigned charfld_indexHostnameshort int_vtable_offsetformat_markersxml_closein6_addrprint_mplsGNU C 4.6.1long unsigned intlengthcharget_time_stringhost__u6_addr8_next__off64_t_cur_column_IO_read_base_IO_save_end__fmtreport_open__pad2__pad3__pad4__pad5snprintfLocalHostname__time_tfound_unused2txt_open__dest_IO_markerlabelsuint8_t_IO_backup_basefieldscpacketsizefld_active_IO_write_baseuint32_tGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx  èM†ƒI0Œ[ G @4AƒF hD`!DX4xdBEŒA †A(ƒD0P(A ABBL°BBŽB B(ŒA0†A8ƒG€ Ø 8A0A(B BBBA (L<cBQŽB B(ŒA0†A8ƒD ø 8A0A(B BBBA ŒP "BBŽB B(ŒA0†A8ƒGàÀ 8A0A(B BBBE .symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.1.rodata.str1.8.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @² ]&ô ,ô 12ô M@2H+Oxa€\mhm”K€ß"Í{pŒø ¬;0‹hŽ0 ŸÜ;À²œ@=­˜Ž¾0ÙE¨É0J+Ò¬Jç°Jðâ°Ž LñTÀ ØZ"ñÿ è   #(+òÿ7?CMV`ixð4ˆ“š0!¦³`d¾ÐËÖàìú (09BMX^hr}‰šà£ð­¶cÀÉÍÙäìù€  " report.csnprint_addr.constprop.0.LC9afunspec_addraddrcmpdnsstrlongipsnprintfaddr2hostshow_ips__snprintf_chkget_time_stringtimectimestrlenreport_open__printf_chkprint_mplsreport_closereportwideipinfo_noiiwidth_lenLocalHostnamefld_activefld_indexdata_fieldsputsnet_maxnet_minnet_addrnet_mplsis_printiifmt_ipinfoindexnet_addrsnet_mplssenablemplsget_iiwidth__stack_chk_failtxt_opentxt_closexml_openxml_closeHostnametoscpacketsizebitpatternMaxPing__strcat_chkcsv_opencsv_closenet_lasttrimputcharüÿÿÿÿÿÿÿ (üÿÿÿÿÿÿÿ2üÿÿÿÿÿÿÿ>üÿÿÿÿÿÿÿI Xüÿÿÿÿÿÿÿy  ‚üÿÿÿÿÿÿÿŠüÿÿÿÿÿÿÿ˜üÿÿÿÿÿÿÿ¢üÿÿÿÿÿÿÿ´üÿÿÿÿÿÿÿ Ýüÿÿÿÿÿÿÿøüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ5üÿÿÿÿÿÿÿ: • «"üÿÿÿÿÿÿÿã%üÿÿÿÿÿÿÿ &üÿÿÿÿÿÿÿ%üÿÿÿÿÿÿÿ&'üÿÿÿÿÿÿÿ.&üÿÿÿÿÿÿÿB ]üÿÿÿÿÿÿÿm („üÿÿÿÿÿÿÿ‹%üÿÿÿÿÿÿÿÕ )æ *ú ' + üÿÿÿÿÿÿÿ& +LüÿÿÿÿÿÿÿS + ^ )l,üÿÿÿÿÿÿÿq-üÿÿÿÿÿÿÿz.üÿÿÿÿÿÿÿ­/üÿÿÿÿÿÿÿ¸0üÿÿÿÿÿÿÿÏ1üÿÿÿÿÿÿÿê -üÿÿÿÿÿÿÿ2üÿÿÿÿÿÿÿDüÿÿÿÿÿÿÿK%üÿÿÿÿÿÿÿ” )ÌüÿÿÿÿÿÿÿÑüÿÿÿÿÿÿÿà + ë )ø * +3üÿÿÿÿÿÿÿVüÿÿÿÿÿÿÿi,üÿÿÿÿÿÿÿv4üÿÿÿÿÿÿÿƒ5üÿÿÿÿÿÿÿ‰üÿÿÿÿÿÿÿ‘ ™üÿÿÿÿÿÿÿ²üÿÿÿÿÿÿÿÁ4üÿÿÿÿÿÿÿÐüÿÿÿÿÿÿÿâ1üÿÿÿÿÿÿÿ6üÿÿÿÿÿÿÿ2üÿÿÿÿÿÿÿ2 O7"üÿÿÿÿÿÿÿ=6üÿÿÿÿÿÿÿ]1üÿÿÿÿÿÿÿw6üÿÿÿÿÿÿÿÎ >äüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ&#üÿÿÿÿÿÿÿ3#üÿÿÿÿÿÿÿ@#üÿÿÿÿÿÿÿJ (O üÿÿÿÿÿÿÿX-üÿÿÿÿÿÿÿ_.üÿÿÿÿÿÿÿ€/üÿÿÿÿÿÿÿ¯7üÿÿÿÿÿÿÿ»&üÿÿÿÿÿÿÿÚ8üÿÿÿÿÿÿÿ ( Z0=üÿÿÿÿÿÿÿE"üÿÿÿÿÿÿÿK>üÿÿÿÿÿÿÿR m\"üÿÿÿÿÿÿÿb?üÿÿÿÿÿÿÿq w{"üÿÿÿÿÿÿÿ@üÿÿÿÿÿÿÿ‘ ”"üÿÿÿÿÿÿÿ£Aüÿÿÿÿÿÿÿ¨ Á´"üÿÿÿÿÿÿÿ¹-üÿÿÿÿÿÿÿÁ.üÿÿÿÿÿÿÿ× )Ü/üÿÿÿÿÿÿÿò Íþ"üÿÿÿÿÿÿÿ ++ üÿÿÿÿÿÿÿ0 "üÿÿÿÿÿÿÿ; )K *ƒ +Œ Büÿÿÿÿÿÿÿ– éž Büÿÿÿÿÿÿÿ¬ 3üÿÿÿÿÿÿÿÇ +ß "üÿÿÿÿÿÿÿæ )ñ ðö ,üÿÿÿÿÿÿÿ û ,üÿÿÿÿÿÿÿ< F "üÿÿÿÿÿÿÿL @üÿÿÿÿÿÿÿY §e "üÿÿÿÿÿÿÿo 8üÿÿÿÿÿÿÿº )É )Ð *× -üÿÿÿÿÿÿÿß .üÿÿÿÿÿÿÿ /üÿÿÿÿÿÿÿ Eüÿÿÿÿÿÿÿ &üÿÿÿÿÿÿÿ1 2üÿÿÿÿÿÿÿB FüÿÿÿÿÿÿÿM =üÿÿÿÿÿÿÿX f k  ƒ "üÿÿÿÿÿÿÿ  A² üÿÿÿÿÿÿÿ· "üÿÿÿÿÿÿÿÈ )Ï *ê +ñ +û 3üÿÿÿÿÿÿÿ H" "üÿÿÿÿÿÿÿ: Güÿÿÿÿÿÿÿs =üÿÿÿÿÿÿÿ~ ‡ 'Œ ¤ "üÿÿÿÿÿÿÿ® 8üÿÿÿÿÿÿÿM"üÿÿÿÿÿÿÿñ$üÿÿÿÿÿÿÿ Z § °!² ) 0 ò7 ç>  E fL ¬S a ðf q ª|  ‘ – À¡ +® hµ žÊ §× æ õ × À " ¼1 s@ [O ^ m b| ΋ 3š © Ÿ 7Ç KÖ ´æ ö 2 1 W& x6 íF ôV ûf v ?† /— œž Hª ¤¸ ÛÆ Ò Z B( Ÿ; ™F äQ ù F™ #® /º µÈ Ö ä ×ò à á  ú r1 ì? ‹M ,[ xi •Ž Yš +Ð S  ( Û6 H ÛV ˆh As Œ€ E’ A Œ© _Å #Ð Ü ”ùè   ` ©* 3 ò<¸Dá\p „{ðƒ$‹ (ž œ« Ó² á¹0ÁQÉ Ö9Þ 0ëø Oÿ`Ä h ¸" T/ Š8„@ `K ÁY E`ÐhÞp í ?Ž wœ Ö« c¸ ÖÅ ùÊ ¸Ô /Ù Sã |è ò Å÷  ! Ê= ’B L ðQ a[ Ê d8l { R „ š  Ò —WŸ À®  · J À † ÊðÒ ðá å ê  ó 5 ý# 0 [  & § 0 Õ8 pG Ù P  Y ) c k  z O ƒ u Œ › – ¨ž в ¾ » ä Å 5Í á ê <ð Pù ) n " ;# ¦. Ä6 èI îR [ >e ìm €| d… ŠŽ °” }œ 𥠰¯ Óè 8ï à÷ â i ð õ! <) 1 > <F N s V öh Hv l… • þš ¥ Gª ʾ Æ °Ø Zç Iï ` m n 0 j: B ¡V –` ¡h ¸| † ÖŽ ðž ¨  ° À 6Ê 4 Ò Pâ Yì _ ô € |   ¢ / ²8 úB 2 J ÀZ 0d X l n | \„ RŒ € ” ‚ ¡ %©  ± ² ¹ ˆÍ ÚÛ é Jø ¿ â   + Ê- ð2 ÿ= tB) J‡ W „b ÒkJ s 0 ŠŸ ’ `¢ I¬ ´& È uÒp Ú æ ¡î û L 7" ? lW o …| ω Í– ’® »  È yÕ Çï ½ ‘ " L/ 7I V lc p …} ÏŠ“ Í  ’­ º  Ç yÔ Çî ½ ‘Ôe  ø 'ì -¹OÕO>}w©”ÕÁñÁÍÅéáéCo§0 \AˆH´' ' Dðd0|`´Ðàð,@€ ¤ mtr-0.85/README0000664000175000017500000000716612106217520012154 0ustar wolffwolffWHAT IS MTR? mtr combines the functionality of the 'traceroute' and 'ping' programs in a single network diagnostic tool. As mtr starts, it investigates the network connection between the host mtr runs on and a user-specified destination host. After it determines the address of each network hop between the machines, it sends a sequence ICMP ECHO requests to each one to determine the quality of the link to each machine. As it does this, it prints running statistics about each machine. mtr is distributed under the GNU General Public License. See the COPYING file for details. INSTALLING If you're building this from a tarball, compiling mtr should be as simple as: make It should first call the "configure" script and then run "make" again with the makefile that "configure" just generated. If you're building from the git repository, you'll need to run: ./bootstrap.sh && ./configure && make After compiling, install: make install Note that mtr must be suid-root because it requires access to raw IP sockets. See SECURITY for security information. Older versions used to require a non-existant path to GTK for a correct build of a non-gtk version while GTK was installed. This is no longer neccesary. ./configure --WITHOUT_GTK should now work. If it doesn't, try "make WITHOUT_X11=YES" as the make step. On Solaris (and possibly other systems) the "gtk" library may be installed in a directory where the dynamic linker refuses to look when a binary is setuid. Roman Shterenzon reports that adding -Wl,-rpath=/usr/lib to the commandline will work if you are using gnu LD. He tells me that you're out of luck when you use the sun LD. That's not quite true, as you can move the gtk libraries to /usr/lib instead of leaving them in /usr/local/lib. (when the ld tells you that /usr/local/lib is untrusted and /usr/lib is trusted, and you trust hte gtk libs enough to want them in a setuid program, then there is something to say for moving them to the "trusted" directory.) On Solaris, linking usually fails to find "wattr" or something like that. Somehow, I can't seem to be able to automate "configure" finding the right libs on Solaris. So, the solution is that you cut-and-paste the line doing the linking into a terminal window, and add "-lcurses" by hand. Then it will link. Help on how to catch this in autoconf appreciated. On Mac OS X the nameserver8_compat.h needs to be included. I put the include inside an "#if 0" section in the file "dns.c". If someone knows how to make this automatic using autoconf / the configure script, please tell me.... This should now also work: ./configure CFLAGS="-arch i386 -arch x86_64" LIBS="-lresolv" \ --without-gtk --disable-endian-check --disable-dependency-tracking WHERE CAN I GET THE LATEST VERSION OR MORE INFORMATION? mtr is now hosted on github. https://github.com/traviscross/mtr See the mtr web page at http://www.BitWizard.nl/mtr/ There used to be a mailinglist, but all it got was spam. So when the server was upgraded, the mailing list died. Bug reports and feature requests should be submitted to the bug tracker at launchpad: https://launchpad.net/mtr/+bugs Patches can be submitted by Email to me, or submitted to the bug tracker. Or you can clone the github repository and issue a pull request. Please use unified diffs. Usually the diff is sort of messy, so please check that the diff is clean and doesn't contain too much of your local stuff (for example, I don't want/need the "configure" script that /your/ automake made for you). -- REW mtr-0.85/depcomp0000755000175000017500000004426712104737110012652 0ustar wolffwolff#! /bin/sh # depcomp - compile a program generating dependencies as side-effects scriptversion=2009-04-28.21; # UTC # Copyright (C) 1999, 2000, 2003, 2004, 2005, 2006, 2007, 2009 Free # Software Foundation, Inc. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program. If not, see . # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. # Originally written by Alexandre Oliva . case $1 in '') echo "$0: No command. Try \`$0 --help' for more information." 1>&2 exit 1; ;; -h | --h*) cat <<\EOF Usage: depcomp [--help] [--version] PROGRAM [ARGS] Run PROGRAMS ARGS to compile a file, generating dependencies as side-effects. Environment variables: depmode Dependency tracking mode. source Source file read by `PROGRAMS ARGS'. object Object file output by `PROGRAMS ARGS'. DEPDIR directory where to store dependencies. depfile Dependency file to output. tmpdepfile Temporary file to use when outputing dependencies. libtool Whether libtool is used (yes/no). Report bugs to . EOF exit $? ;; -v | --v*) echo "depcomp $scriptversion" exit $? ;; esac if test -z "$depmode" || test -z "$source" || test -z "$object"; then echo "depcomp: Variables source, object and depmode must be set" 1>&2 exit 1 fi # Dependencies for sub/bar.o or sub/bar.obj go into sub/.deps/bar.Po. depfile=${depfile-`echo "$object" | sed 's|[^\\/]*$|'${DEPDIR-.deps}'/&|;s|\.\([^.]*\)$|.P\1|;s|Pobj$|Po|'`} tmpdepfile=${tmpdepfile-`echo "$depfile" | sed 's/\.\([^.]*\)$/.T\1/'`} rm -f "$tmpdepfile" # Some modes work just like other modes, but use different flags. We # parameterize here, but still list the modes in the big case below, # to make depend.m4 easier to write. Note that we *cannot* use a case # here, because this file can only contain one case statement. if test "$depmode" = hp; then # HP compiler uses -M and no extra arg. gccflag=-M depmode=gcc fi if test "$depmode" = dashXmstdout; then # This is just like dashmstdout with a different argument. dashmflag=-xM depmode=dashmstdout fi cygpath_u="cygpath -u -f -" if test "$depmode" = msvcmsys; then # This is just like msvisualcpp but w/o cygpath translation. # Just convert the backslash-escaped backslashes to single forward # slashes to satisfy depend.m4 cygpath_u="sed s,\\\\\\\\,/,g" depmode=msvisualcpp fi case "$depmode" in gcc3) ## gcc 3 implements dependency tracking that does exactly what ## we want. Yay! Note: for some reason libtool 1.4 doesn't like ## it if -MD -MP comes after the -MF stuff. Hmm. ## Unfortunately, FreeBSD c89 acceptance of flags depends upon ## the command line argument order; so add the flags where they ## appear in depend2.am. Note that the slowdown incurred here ## affects only configure: in makefiles, %FASTDEP% shortcuts this. for arg do case $arg in -c) set fnord "$@" -MT "$object" -MD -MP -MF "$tmpdepfile" "$arg" ;; *) set fnord "$@" "$arg" ;; esac shift # fnord shift # $arg done "$@" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi mv "$tmpdepfile" "$depfile" ;; gcc) ## There are various ways to get dependency output from gcc. Here's ## why we pick this rather obscure method: ## - Don't want to use -MD because we'd like the dependencies to end ## up in a subdir. Having to rename by hand is ugly. ## (We might end up doing this anyway to support other compilers.) ## - The DEPENDENCIES_OUTPUT environment variable makes gcc act like ## -MM, not -M (despite what the docs say). ## - Using -M directly means running the compiler twice (even worse ## than renaming). if test -z "$gccflag"; then gccflag=-MD, fi "$@" -Wp,"$gccflag$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" echo "$object : \\" > "$depfile" alpha=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ## The second -e expression handles DOS-style file names with drive letters. sed -e 's/^[^:]*: / /' \ -e 's/^['$alpha']:\/[^:]*: / /' < "$tmpdepfile" >> "$depfile" ## This next piece of magic avoids the `deleted header file' problem. ## The problem is that when a header file which appears in a .P file ## is deleted, the dependency causes make to die (because there is ## typically no way to rebuild the header). We avoid this by adding ## dummy dependencies for each header file. Too bad gcc doesn't do ## this for us directly. tr ' ' ' ' < "$tmpdepfile" | ## Some versions of gcc put a space before the `:'. On the theory ## that the space means something, we add a space to the output as ## well. ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; hp) # This case exists only to let depend.m4 do its work. It works by # looking at the text of this script. This case will never be run, # since it is checked for above. exit 1 ;; sgi) if test "$libtool" = yes; then "$@" "-Wp,-MDupdate,$tmpdepfile" else "$@" -MDupdate "$tmpdepfile" fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" if test -f "$tmpdepfile"; then # yes, the sourcefile depend on other files echo "$object : \\" > "$depfile" # Clip off the initial element (the dependent). Don't try to be # clever and replace this with sed code, as IRIX sed won't handle # lines with more than a fixed number of characters (4096 in # IRIX 6.2 sed, 8192 in IRIX 6.5). We also remove comment lines; # the IRIX cc adds comments like `#:fec' to the end of the # dependency line. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' | \ tr ' ' ' ' >> "$depfile" echo >> "$depfile" # The second pass generates a dummy entry for each header file. tr ' ' ' ' < "$tmpdepfile" \ | sed -e 's/^.*\.o://' -e 's/#.*$//' -e '/^$/ d' -e 's/$/:/' \ >> "$depfile" else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; aix) # The C for AIX Compiler uses -M and outputs the dependencies # in a .u file. In older versions, this file always lives in the # current directory. Also, the AIX compiler puts `$object:' at the # start of each line; $object doesn't have directory information. # Version 6 uses the directory in both cases. dir=`echo "$object" | sed -e 's|/[^/]*$|/|'` test "x$dir" = "x$object" && dir= base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'` if test "$libtool" = yes; then tmpdepfile1=$dir$base.u tmpdepfile2=$base.u tmpdepfile3=$dir.libs/$base.u "$@" -Wc,-M else tmpdepfile1=$dir$base.u tmpdepfile2=$dir$base.u tmpdepfile3=$dir$base.u "$@" -M fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" exit $stat fi for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" do test -f "$tmpdepfile" && break done if test -f "$tmpdepfile"; then # Each line is of the form `foo.o: dependent.h'. # Do two passes, one to just change these to # `$object: dependent.h' and one to simply `dependent.h:'. sed -e "s,^.*\.[a-z]*:,$object:," < "$tmpdepfile" > "$depfile" # That's a tab and a space in the []. sed -e 's,^.*\.[a-z]*:[ ]*,,' -e 's,$,:,' < "$tmpdepfile" >> "$depfile" else # The sourcefile does not contain any dependencies, so just # store a dummy comment line, to avoid errors with the Makefile # "include basename.Plo" scheme. echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; icc) # Intel's C compiler understands `-MD -MF file'. However on # icc -MD -MF foo.d -c -o sub/foo.o sub/foo.c # ICC 7.0 will fill foo.d with something like # foo.o: sub/foo.c # foo.o: sub/foo.h # which is wrong. We want: # sub/foo.o: sub/foo.c # sub/foo.o: sub/foo.h # sub/foo.c: # sub/foo.h: # ICC 7.1 will output # foo.o: sub/foo.c sub/foo.h # and will wrap long lines using \ : # foo.o: sub/foo.c ... \ # sub/foo.h ... \ # ... "$@" -MD -MF "$tmpdepfile" stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile" exit $stat fi rm -f "$depfile" # Each line is of the form `foo.o: dependent.h', # or `foo.o: dep1.h dep2.h \', or ` dep3.h dep4.h \'. # Do two passes, one to just change these to # `$object: dependent.h' and one to simply `dependent.h:'. sed "s,^[^:]*:,$object :," < "$tmpdepfile" > "$depfile" # Some versions of the HPUX 10.20 sed can't process this invocation # correctly. Breaking it into two sed invocations is a workaround. sed 's,^[^:]*: \(.*\)$,\1,;s/^\\$//;/^$/d;/:$/d' < "$tmpdepfile" | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; hp2) # The "hp" stanza above does not work with aCC (C++) and HP's ia64 # compilers, which have integrated preprocessors. The correct option # to use with these is +Maked; it writes dependencies to a file named # 'foo.d', which lands next to the object file, wherever that # happens to be. # Much of this is similar to the tru64 case; see comments there. dir=`echo "$object" | sed -e 's|/[^/]*$|/|'` test "x$dir" = "x$object" && dir= base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'` if test "$libtool" = yes; then tmpdepfile1=$dir$base.d tmpdepfile2=$dir.libs/$base.d "$@" -Wc,+Maked else tmpdepfile1=$dir$base.d tmpdepfile2=$dir$base.d "$@" +Maked fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" exit $stat fi for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" do test -f "$tmpdepfile" && break done if test -f "$tmpdepfile"; then sed -e "s,^.*\.[a-z]*:,$object:," "$tmpdepfile" > "$depfile" # Add `dependent.h:' lines. sed -ne '2,${ s/^ *// s/ \\*$// s/$/:/ p }' "$tmpdepfile" >> "$depfile" else echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" "$tmpdepfile2" ;; tru64) # The Tru64 compiler uses -MD to generate dependencies as a side # effect. `cc -MD -o foo.o ...' puts the dependencies into `foo.o.d'. # At least on Alpha/Redhat 6.1, Compaq CCC V6.2-504 seems to put # dependencies in `foo.d' instead, so we check for that too. # Subdirectories are respected. dir=`echo "$object" | sed -e 's|/[^/]*$|/|'` test "x$dir" = "x$object" && dir= base=`echo "$object" | sed -e 's|^.*/||' -e 's/\.o$//' -e 's/\.lo$//'` if test "$libtool" = yes; then # With Tru64 cc, shared objects can also be used to make a # static library. This mechanism is used in libtool 1.4 series to # handle both shared and static libraries in a single compilation. # With libtool 1.4, dependencies were output in $dir.libs/$base.lo.d. # # With libtool 1.5 this exception was removed, and libtool now # generates 2 separate objects for the 2 libraries. These two # compilations output dependencies in $dir.libs/$base.o.d and # in $dir$base.o.d. We have to check for both files, because # one of the two compilations can be disabled. We should prefer # $dir$base.o.d over $dir.libs/$base.o.d because the latter is # automatically cleaned when .libs/ is deleted, while ignoring # the former would cause a distcleancheck panic. tmpdepfile1=$dir.libs/$base.lo.d # libtool 1.4 tmpdepfile2=$dir$base.o.d # libtool 1.5 tmpdepfile3=$dir.libs/$base.o.d # libtool 1.5 tmpdepfile4=$dir.libs/$base.d # Compaq CCC V6.2-504 "$@" -Wc,-MD else tmpdepfile1=$dir$base.o.d tmpdepfile2=$dir$base.d tmpdepfile3=$dir$base.d tmpdepfile4=$dir$base.d "$@" -MD fi stat=$? if test $stat -eq 0; then : else rm -f "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4" exit $stat fi for tmpdepfile in "$tmpdepfile1" "$tmpdepfile2" "$tmpdepfile3" "$tmpdepfile4" do test -f "$tmpdepfile" && break done if test -f "$tmpdepfile"; then sed -e "s,^.*\.[a-z]*:,$object:," < "$tmpdepfile" > "$depfile" # That's a tab and a space in the []. sed -e 's,^.*\.[a-z]*:[ ]*,,' -e 's,$,:,' < "$tmpdepfile" >> "$depfile" else echo "#dummy" > "$depfile" fi rm -f "$tmpdepfile" ;; #nosideeffect) # This comment above is used by automake to tell side-effect # dependency tracking mechanisms from slower ones. dashmstdout) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout, regardless of -o. "$@" || exit $? # Remove the call to Libtool. if test "$libtool" = yes; then while test "X$1" != 'X--mode=compile'; do shift done shift fi # Remove `-o $object'. IFS=" " for arg do case $arg in -o) shift ;; $object) shift ;; *) set fnord "$@" "$arg" shift # fnord shift # $arg ;; esac done test -z "$dashmflag" && dashmflag=-M # Require at least two characters before searching for `:' # in the target name. This is to cope with DOS-style filenames: # a dependency such as `c:/foo/bar' could be seen as target `c' otherwise. "$@" $dashmflag | sed 's:^[ ]*[^: ][^:][^:]*\:[ ]*:'"$object"'\: :' > "$tmpdepfile" rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" tr ' ' ' ' < "$tmpdepfile" | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; dashXmstdout) # This case only exists to satisfy depend.m4. It is never actually # run, as this mode is specially recognized in the preamble. exit 1 ;; makedepend) "$@" || exit $? # Remove any Libtool call if test "$libtool" = yes; then while test "X$1" != 'X--mode=compile'; do shift done shift fi # X makedepend shift cleared=no eat=no for arg do case $cleared in no) set ""; shift cleared=yes ;; esac if test $eat = yes; then eat=no continue fi case "$arg" in -D*|-I*) set fnord "$@" "$arg"; shift ;; # Strip any option that makedepend may not understand. Remove # the object too, otherwise makedepend will parse it as a source file. -arch) eat=yes ;; -*|$object) ;; *) set fnord "$@" "$arg"; shift ;; esac done obj_suffix=`echo "$object" | sed 's/^.*\././'` touch "$tmpdepfile" ${MAKEDEPEND-makedepend} -o"$obj_suffix" -f"$tmpdepfile" "$@" rm -f "$depfile" cat < "$tmpdepfile" > "$depfile" sed '1,2d' "$tmpdepfile" | tr ' ' ' ' | \ ## Some versions of the HPUX 10.20 sed can't process this invocation ## correctly. Breaking it into two sed invocations is a workaround. sed -e 's/^\\$//' -e '/^$/d' -e '/:$/d' | sed -e 's/$/ :/' >> "$depfile" rm -f "$tmpdepfile" "$tmpdepfile".bak ;; cpp) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout. "$@" || exit $? # Remove the call to Libtool. if test "$libtool" = yes; then while test "X$1" != 'X--mode=compile'; do shift done shift fi # Remove `-o $object'. IFS=" " for arg do case $arg in -o) shift ;; $object) shift ;; *) set fnord "$@" "$arg" shift # fnord shift # $arg ;; esac done "$@" -E | sed -n -e '/^# [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' \ -e '/^#line [0-9][0-9]* "\([^"]*\)".*/ s:: \1 \\:p' | sed '$ s: \\$::' > "$tmpdepfile" rm -f "$depfile" echo "$object : \\" > "$depfile" cat < "$tmpdepfile" >> "$depfile" sed < "$tmpdepfile" '/^$/d;s/^ //;s/ \\$//;s/$/ :/' >> "$depfile" rm -f "$tmpdepfile" ;; msvisualcpp) # Important note: in order to support this mode, a compiler *must* # always write the preprocessed file to stdout. "$@" || exit $? # Remove the call to Libtool. if test "$libtool" = yes; then while test "X$1" != 'X--mode=compile'; do shift done shift fi IFS=" " for arg do case "$arg" in -o) shift ;; $object) shift ;; "-Gm"|"/Gm"|"-Gi"|"/Gi"|"-ZI"|"/ZI") set fnord "$@" shift shift ;; *) set fnord "$@" "$arg" shift shift ;; esac done "$@" -E 2>/dev/null | sed -n '/^#line [0-9][0-9]* "\([^"]*\)"/ s::\1:p' | $cygpath_u | sort -u > "$tmpdepfile" rm -f "$depfile" echo "$object : \\" > "$depfile" sed < "$tmpdepfile" -n -e 's% %\\ %g' -e '/^\(.*\)$/ s:: \1 \\:p' >> "$depfile" echo " " >> "$depfile" sed < "$tmpdepfile" -n -e 's% %\\ %g' -e '/^\(.*\)$/ s::\1\::p' >> "$depfile" rm -f "$tmpdepfile" ;; msvcmsys) # This case exists only to let depend.m4 do its work. It works by # looking at the text of this script. This case will never be run, # since it is checked for above. exit 1 ;; none) exec "$@" ;; *) echo "Unknown depmode $depmode" 1>&2 exit 1 ;; esac exit 0 # Local Variables: # mode: shell-script # sh-indentation: 2 # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: mtr-0.85/mtr.h0000664000175000017500000000352012144202516012236 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball Copyright (C) 2005 R.E.Wolff@BitWizard.nl This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ /* Typedefs */ /* Find the proper type for 8 bits */ #if SIZEOF_UNSIGNED_CHAR == 1 typedef unsigned char uint8; #else #error No 8 bit type #endif /* Find the proper type for 16 bits */ #if SIZEOF_UNSIGNED_SHORT == 2 typedef unsigned short uint16; #elif SIZEOF_UNSIGNED_INT == 2 typedef unsigned int uint16; #elif SIZEOF_UNSIGNED_LONG == 2 typedef unsigned long uint16; #else #error No 16 bit type #endif /* Find the proper type for 32 bits */ #if SIZEOF_UNSIGNED_SHORT == 4 typedef unsigned short uint32; #elif SIZEOF_UNSIGNED_INT == 4 typedef unsigned int uint32; #elif SIZEOF_UNSIGNED_LONG == 4 typedef unsigned long uint32; #else #error No 32 bit type #endif typedef unsigned char byte; typedef unsigned short word; typedef unsigned long dword; #ifdef ENABLE_IPV6 typedef struct in6_addr ip_t; #else typedef struct in_addr ip_t; #endif extern int enablempls; extern int dns; extern int show_ips; extern int use_dns; #ifdef __GNUC__ #define UNUSED __attribute__((__unused__)) #else #define UNUSED #endif #ifndef HAVE_SOCKLEN_T typedef int socklen_t; #endif char * trim(char * s); mtr-0.85/configure0000775000175000017500000063123012162521447013206 0ustar wolffwolff#! /bin/sh # Guess values for system-dependent variables and create Makefiles. # Generated by GNU Autoconf 2.68 for mtr 0.85. # # # Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, # 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software # Foundation, Inc. # # # This configure script is free software; the Free Software Foundation # gives unlimited permission to copy, distribute and modify it. ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH if test "x$CONFIG_SHELL" = x; then as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which # is contrary to our usage. Disable this feature. alias -g '\${1+\"\$@\"}'='\"\$@\"' setopt NO_GLOB_SUBST else case \`(set -o) 2>/dev/null\` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi " as_required="as_fn_return () { (exit \$1); } as_fn_success () { as_fn_return 0; } as_fn_failure () { as_fn_return 1; } as_fn_ret_success () { return 0; } as_fn_ret_failure () { return 1; } exitcode=0 as_fn_success || { exitcode=1; echo as_fn_success failed.; } as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; } as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; } as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; } if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then : else exitcode=1; echo positional parameters were not saved. fi test x\$exitcode = x0 || exit 1" as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" && test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1 test \$(( 1 + 1 )) = 2 || exit 1" if (eval "$as_required") 2>/dev/null; then : as_have_required=yes else as_have_required=no fi if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then : else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR as_found=false for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. as_found=: case $as_dir in #( /*) for as_base in sh bash ksh sh5; do # Try only shells that exist, to save several forks. as_shell=$as_dir/$as_base if { test -f "$as_shell" || test -f "$as_shell.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then : CONFIG_SHELL=$as_shell as_have_required=yes if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then : break 2 fi fi done;; esac as_found=false done $as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } && { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then : CONFIG_SHELL=$SHELL as_have_required=yes fi; } IFS=$as_save_IFS if test "x$CONFIG_SHELL" != x; then : # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also # works around shells that cannot unset nonexistent variables. # Preserve -v and -x to the replacement shell. BASH_ENV=/dev/null ENV=/dev/null (unset BASH_ENV) >/dev/null 2>&1 && unset BASH_ENV ENV export CONFIG_SHELL case $- in # (((( *v*x* | *x*v* ) as_opts=-vx ;; *v* ) as_opts=-v ;; *x* ) as_opts=-x ;; * ) as_opts= ;; esac exec "$CONFIG_SHELL" $as_opts "$as_myself" ${1+"$@"} fi if test x$as_have_required = xno; then : $as_echo "$0: This script requires a shell more modern than all" $as_echo "$0: the shells that I found on your system." if test x${ZSH_VERSION+set} = xset ; then $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should" $as_echo "$0: be upgraded to zsh 4.3.4 or later." else $as_echo "$0: Please tell bug-autoconf@gnu.org about your system, $0: including any error possibly output before this $0: message. Then install a modern shell, or manually run $0: the script under such a shell if you do have one." fi exit 1 fi fi fi SHELL=${CONFIG_SHELL-/bin/sh} export SHELL # Unset more variables known to interfere with behavior of common tools. CLICOLOR_FORCE= GREP_OPTIONS= unset CLICOLOR_FORCE GREP_OPTIONS ## --------------------- ## ## M4sh Shell Functions. ## ## --------------------- ## # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits as_lineno_1=$LINENO as_lineno_1a=$LINENO as_lineno_2=$LINENO as_lineno_2a=$LINENO eval 'test "x$as_lineno_1'$as_run'" != "x$as_lineno_2'$as_run'" && test "x`expr $as_lineno_1'$as_run' + 1`" = "x$as_lineno_2'$as_run'"' || { # Blame Lee E. McMahon (1931-1989) for sed's syntax. :-) sed -n ' p /[$]LINENO/= ' <$as_myself | sed ' s/[$]LINENO.*/&-/ t lineno b :lineno N :loop s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ t loop s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; } # Don't try to exec as it changes $[0], causing all sort of problems # (the dirname of $[0] is not the place where we might find the # original and so on. Autoconf is especially sensitive to this). . "./$as_me.lineno" # Exit status is that of the last command. exit } ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in #( -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in #(( ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" test -n "$DJDIR" || exec 7<&0 &1 # Name of the host. # hostname on some systems (SVR3.2, old GNU/Linux) returns a bogus exit status, # so uname gets run too. ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` # # Initializations. # ac_default_prefix=/usr/local ac_clean_files= ac_config_libobj_dir=. LIBOBJS= cross_compiling=no subdirs= MFLAGS= MAKEFLAGS= # Identity of this package. PACKAGE_NAME='mtr' PACKAGE_TARNAME='mtr' PACKAGE_VERSION='0.85' PACKAGE_STRING='mtr 0.85' PACKAGE_BUGREPORT='' PACKAGE_URL='' ac_unique_file="mtr.c" # Factoring default headers for most tests. ac_includes_default="\ #include #ifdef HAVE_SYS_TYPES_H # include #endif #ifdef HAVE_SYS_STAT_H # include #endif #ifdef STDC_HEADERS # include # include #else # ifdef HAVE_STDLIB_H # include # endif #endif #ifdef HAVE_STRING_H # if !defined STDC_HEADERS && defined HAVE_MEMORY_H # include # endif # include #endif #ifdef HAVE_STRINGS_H # include #endif #ifdef HAVE_INTTYPES_H # include #endif #ifdef HAVE_STDINT_H # include #endif #ifdef HAVE_UNISTD_H # include #endif" ac_subst_vars='am__EXEEXT_FALSE am__EXEEXT_TRUE LTLIBOBJS LIBOBJS RESOLV_LIBS GLIB_LIBS GLIB_CFLAGS PKG_CONFIG_LIBDIR PKG_CONFIG_PATH GTK_LIBS GTK_CFLAGS PKG_CONFIG IPINFO_FALSE IPINFO_TRUE EGREP GREP CPP am__fastdepCC_FALSE am__fastdepCC_TRUE CCDEPMODE AMDEPBACKSLASH AMDEP_FALSE AMDEP_TRUE am__quote am__include DEPDIR OBJEXT EXEEXT ac_ct_CC CPPFLAGS LDFLAGS CFLAGS CC CURSES_OBJ GTK_OBJ am__untar am__tar AMTAR am__leading_dot SET_MAKE AWK mkdir_p MKDIR_P INSTALL_STRIP_PROGRAM STRIP install_sh MAKEINFO AUTOHEADER AUTOMAKE AUTOCONF ACLOCAL VERSION PACKAGE CYGPATH_W am__isrc INSTALL_DATA INSTALL_SCRIPT INSTALL_PROGRAM target_alias host_alias build_alias LIBS ECHO_T ECHO_N ECHO_C DEFS mandir localedir libdir psdir pdfdir dvidir htmldir infodir docdir oldincludedir includedir localstatedir sharedstatedir sysconfdir datadir datarootdir libexecdir sbindir bindir program_transform_name prefix exec_prefix PACKAGE_URL PACKAGE_BUGREPORT PACKAGE_STRING PACKAGE_VERSION PACKAGE_TARNAME PACKAGE_NAME PATH_SEPARATOR SHELL' ac_subst_files='' ac_user_opts=' enable_option_checking enable_dependency_tracking with_gtk with_glib with_ipinfo enable_ipv6 enable_gtktest ' ac_precious_vars='build_alias host_alias target_alias CC CFLAGS LDFLAGS LIBS CPPFLAGS CPP PKG_CONFIG PKG_CONFIG_PATH PKG_CONFIG_LIBDIR GLIB_CFLAGS GLIB_LIBS' # Initialize some variables set by options. ac_init_help= ac_init_version=false ac_unrecognized_opts= ac_unrecognized_sep= # The variables have the same names as the options, with # dashes changed to underlines. cache_file=/dev/null exec_prefix=NONE no_create= no_recursion= prefix=NONE program_prefix=NONE program_suffix=NONE program_transform_name=s,x,x, silent= site= srcdir= verbose= x_includes=NONE x_libraries=NONE # Installation directory options. # These are left unexpanded so users can "make install exec_prefix=/foo" # and all the variables that are supposed to be based on exec_prefix # by default will actually change. # Use braces instead of parens because sh, perl, etc. also accept them. # (The list follows the same order as the GNU Coding Standards.) bindir='${exec_prefix}/bin' sbindir='${exec_prefix}/sbin' libexecdir='${exec_prefix}/libexec' datarootdir='${prefix}/share' datadir='${datarootdir}' sysconfdir='${prefix}/etc' sharedstatedir='${prefix}/com' localstatedir='${prefix}/var' includedir='${prefix}/include' oldincludedir='/usr/include' docdir='${datarootdir}/doc/${PACKAGE_TARNAME}' infodir='${datarootdir}/info' htmldir='${docdir}' dvidir='${docdir}' pdfdir='${docdir}' psdir='${docdir}' libdir='${exec_prefix}/lib' localedir='${datarootdir}/locale' mandir='${datarootdir}/man' ac_prev= ac_dashdash= for ac_option do # If the previous option needs an argument, assign it. if test -n "$ac_prev"; then eval $ac_prev=\$ac_option ac_prev= continue fi case $ac_option in *=?*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; *=) ac_optarg= ;; *) ac_optarg=yes ;; esac # Accept the important Cygnus configure options, so we can diagnose typos. case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; -bindir | --bindir | --bindi | --bind | --bin | --bi) ac_prev=bindir ;; -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) bindir=$ac_optarg ;; -build | --build | --buil | --bui | --bu) ac_prev=build_alias ;; -build=* | --build=* | --buil=* | --bui=* | --bu=*) build_alias=$ac_optarg ;; -cache-file | --cache-file | --cache-fil | --cache-fi \ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) ac_prev=cache_file ;; -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) cache_file=$ac_optarg ;; --config-cache | -C) cache_file=config.cache ;; -datadir | --datadir | --datadi | --datad) ac_prev=datadir ;; -datadir=* | --datadir=* | --datadi=* | --datad=*) datadir=$ac_optarg ;; -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ | --dataroo | --dataro | --datar) ac_prev=datarootdir ;; -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) datarootdir=$ac_optarg ;; -disable-* | --disable-*) ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--disable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=no ;; -docdir | --docdir | --docdi | --doc | --do) ac_prev=docdir ;; -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) docdir=$ac_optarg ;; -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) ac_prev=dvidir ;; -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) dvidir=$ac_optarg ;; -enable-* | --enable-*) ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid feature name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--enable-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval enable_$ac_useropt=\$ac_optarg ;; -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ | --exec | --exe | --ex) ac_prev=exec_prefix ;; -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ | --exec=* | --exe=* | --ex=*) exec_prefix=$ac_optarg ;; -gas | --gas | --ga | --g) # Obsolete; use --with-gas. with_gas=yes ;; -help | --help | --hel | --he | -h) ac_init_help=long ;; -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) ac_init_help=recursive ;; -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) ac_init_help=short ;; -host | --host | --hos | --ho) ac_prev=host_alias ;; -host=* | --host=* | --hos=* | --ho=*) host_alias=$ac_optarg ;; -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) ac_prev=htmldir ;; -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ | --ht=*) htmldir=$ac_optarg ;; -includedir | --includedir | --includedi | --included | --include \ | --includ | --inclu | --incl | --inc) ac_prev=includedir ;; -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ | --includ=* | --inclu=* | --incl=* | --inc=*) includedir=$ac_optarg ;; -infodir | --infodir | --infodi | --infod | --info | --inf) ac_prev=infodir ;; -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) infodir=$ac_optarg ;; -libdir | --libdir | --libdi | --libd) ac_prev=libdir ;; -libdir=* | --libdir=* | --libdi=* | --libd=*) libdir=$ac_optarg ;; -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ | --libexe | --libex | --libe) ac_prev=libexecdir ;; -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ | --libexe=* | --libex=* | --libe=*) libexecdir=$ac_optarg ;; -localedir | --localedir | --localedi | --localed | --locale) ac_prev=localedir ;; -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) localedir=$ac_optarg ;; -localstatedir | --localstatedir | --localstatedi | --localstated \ | --localstate | --localstat | --localsta | --localst | --locals) ac_prev=localstatedir ;; -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) localstatedir=$ac_optarg ;; -mandir | --mandir | --mandi | --mand | --man | --ma | --m) ac_prev=mandir ;; -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) mandir=$ac_optarg ;; -nfp | --nfp | --nf) # Obsolete; use --without-fp. with_fp=no ;; -no-create | --no-create | --no-creat | --no-crea | --no-cre \ | --no-cr | --no-c | -n) no_create=yes ;; -no-recursion | --no-recursion | --no-recursio | --no-recursi \ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) no_recursion=yes ;; -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ | --oldin | --oldi | --old | --ol | --o) ac_prev=oldincludedir ;; -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) oldincludedir=$ac_optarg ;; -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) ac_prev=prefix ;; -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) prefix=$ac_optarg ;; -program-prefix | --program-prefix | --program-prefi | --program-pref \ | --program-pre | --program-pr | --program-p) ac_prev=program_prefix ;; -program-prefix=* | --program-prefix=* | --program-prefi=* \ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) program_prefix=$ac_optarg ;; -program-suffix | --program-suffix | --program-suffi | --program-suff \ | --program-suf | --program-su | --program-s) ac_prev=program_suffix ;; -program-suffix=* | --program-suffix=* | --program-suffi=* \ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) program_suffix=$ac_optarg ;; -program-transform-name | --program-transform-name \ | --program-transform-nam | --program-transform-na \ | --program-transform-n | --program-transform- \ | --program-transform | --program-transfor \ | --program-transfo | --program-transf \ | --program-trans | --program-tran \ | --progr-tra | --program-tr | --program-t) ac_prev=program_transform_name ;; -program-transform-name=* | --program-transform-name=* \ | --program-transform-nam=* | --program-transform-na=* \ | --program-transform-n=* | --program-transform-=* \ | --program-transform=* | --program-transfor=* \ | --program-transfo=* | --program-transf=* \ | --program-trans=* | --program-tran=* \ | --progr-tra=* | --program-tr=* | --program-t=*) program_transform_name=$ac_optarg ;; -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) ac_prev=pdfdir ;; -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) pdfdir=$ac_optarg ;; -psdir | --psdir | --psdi | --psd | --ps) ac_prev=psdir ;; -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) psdir=$ac_optarg ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) silent=yes ;; -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) ac_prev=sbindir ;; -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ | --sbi=* | --sb=*) sbindir=$ac_optarg ;; -sharedstatedir | --sharedstatedir | --sharedstatedi \ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ | --sharedst | --shareds | --shared | --share | --shar \ | --sha | --sh) ac_prev=sharedstatedir ;; -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ | --sha=* | --sh=*) sharedstatedir=$ac_optarg ;; -site | --site | --sit) ac_prev=site ;; -site=* | --site=* | --sit=*) site=$ac_optarg ;; -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) ac_prev=srcdir ;; -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) srcdir=$ac_optarg ;; -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ | --syscon | --sysco | --sysc | --sys | --sy) ac_prev=sysconfdir ;; -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) sysconfdir=$ac_optarg ;; -target | --target | --targe | --targ | --tar | --ta | --t) ac_prev=target_alias ;; -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) target_alias=$ac_optarg ;; -v | -verbose | --verbose | --verbos | --verbo | --verb) verbose=yes ;; -version | --version | --versio | --versi | --vers | -V) ac_init_version=: ;; -with-* | --with-*) ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--with-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=\$ac_optarg ;; -without-* | --without-*) ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && as_fn_error $? "invalid package name: $ac_useropt" ac_useropt_orig=$ac_useropt ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" "*) ;; *) ac_unrecognized_opts="$ac_unrecognized_opts$ac_unrecognized_sep--without-$ac_useropt_orig" ac_unrecognized_sep=', ';; esac eval with_$ac_useropt=no ;; --x) # Obsolete; use --with-x. with_x=yes ;; -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ | --x-incl | --x-inc | --x-in | --x-i) ac_prev=x_includes ;; -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) x_includes=$ac_optarg ;; -x-libraries | --x-libraries | --x-librarie | --x-librari \ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) ac_prev=x_libraries ;; -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) x_libraries=$ac_optarg ;; -*) as_fn_error $? "unrecognized option: \`$ac_option' Try \`$0 --help' for more information" ;; *=*) ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` # Reject names that are not valid shell variable names. case $ac_envvar in #( '' | [0-9]* | *[!_$as_cr_alnum]* ) as_fn_error $? "invalid variable name: \`$ac_envvar'" ;; esac eval $ac_envvar=\$ac_optarg export $ac_envvar ;; *) # FIXME: should be removed in autoconf 3.0. $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2 : "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}" ;; esac done if test -n "$ac_prev"; then ac_option=--`echo $ac_prev | sed 's/_/-/g'` as_fn_error $? "missing argument to $ac_option" fi if test -n "$ac_unrecognized_opts"; then case $enable_option_checking in no) ;; fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;; *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; esac fi # Check all directory arguments for consistency. for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ datadir sysconfdir sharedstatedir localstatedir includedir \ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ libdir localedir mandir do eval ac_val=\$$ac_var # Remove trailing slashes. case $ac_val in */ ) ac_val=`expr "X$ac_val" : 'X\(.*[^/]\)' \| "X$ac_val" : 'X\(.*\)'` eval $ac_var=\$ac_val;; esac # Be sure to have absolute directory names. case $ac_val in [\\/$]* | ?:[\\/]* ) continue;; NONE | '' ) case $ac_var in *prefix ) continue;; esac;; esac as_fn_error $? "expected an absolute directory name for --$ac_var: $ac_val" done # There might be people who depend on the old broken behavior: `$host' # used to hold the argument of --host etc. # FIXME: To remove some day. build=$build_alias host=$host_alias target=$target_alias # FIXME: To remove some day. if test "x$host_alias" != x; then if test "x$build_alias" = x; then cross_compiling=maybe $as_echo "$as_me: WARNING: if you wanted to set the --build type, don't use --host. If a cross compiler is detected then cross compile mode will be used" >&2 elif test "x$build_alias" != "x$host_alias"; then cross_compiling=yes fi fi ac_tool_prefix= test -n "$host_alias" && ac_tool_prefix=$host_alias- test "$silent" = yes && exec 6>/dev/null ac_pwd=`pwd` && test -n "$ac_pwd" && ac_ls_di=`ls -di .` && ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || as_fn_error $? "working directory cannot be determined" test "X$ac_ls_di" = "X$ac_pwd_ls_di" || as_fn_error $? "pwd does not report name of working directory" # Find the source files, if location was not specified. if test -z "$srcdir"; then ac_srcdir_defaulted=yes # Try the directory containing this script, then the parent directory. ac_confdir=`$as_dirname -- "$as_myself" || $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_myself" : 'X\(//\)[^/]' \| \ X"$as_myself" : 'X\(//\)$' \| \ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_myself" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` srcdir=$ac_confdir if test ! -r "$srcdir/$ac_unique_file"; then srcdir=.. fi else ac_srcdir_defaulted=no fi if test ! -r "$srcdir/$ac_unique_file"; then test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." as_fn_error $? "cannot find sources ($ac_unique_file) in $srcdir" fi ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" ac_abs_confdir=`( cd "$srcdir" && test -r "./$ac_unique_file" || as_fn_error $? "$ac_msg" pwd)` # When building in place, set srcdir=. if test "$ac_abs_confdir" = "$ac_pwd"; then srcdir=. fi # Remove unnecessary trailing slashes from srcdir. # Double slashes in file names in object file debugging info # mess up M-x gdb in Emacs. case $srcdir in */) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; esac for ac_var in $ac_precious_vars; do eval ac_env_${ac_var}_set=\${${ac_var}+set} eval ac_env_${ac_var}_value=\$${ac_var} eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} eval ac_cv_env_${ac_var}_value=\$${ac_var} done # # Report the --help message. # if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF \`configure' configures mtr 0.85 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... To assign environment variables (e.g., CC, CFLAGS...), specify them as VAR=VALUE. See below for descriptions of some of the useful variables. Defaults for the options are specified in brackets. Configuration: -h, --help display this help and exit --help=short display options specific to this package --help=recursive display the short help of all the included packages -V, --version display version information and exit -q, --quiet, --silent do not print \`checking ...' messages --cache-file=FILE cache test results in FILE [disabled] -C, --config-cache alias for \`--cache-file=config.cache' -n, --no-create do not create output files --srcdir=DIR find the sources in DIR [configure dir or \`..'] Installation directories: --prefix=PREFIX install architecture-independent files in PREFIX [$ac_default_prefix] --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX [PREFIX] By default, \`make install' will install all the files in \`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify an installation prefix other than \`$ac_default_prefix' using \`--prefix', for instance \`--prefix=\$HOME'. For better control, use the options below. Fine tuning of the installation directories: --bindir=DIR user executables [EPREFIX/bin] --sbindir=DIR system admin executables [EPREFIX/sbin] --libexecdir=DIR program executables [EPREFIX/libexec] --sysconfdir=DIR read-only single-machine data [PREFIX/etc] --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] --localstatedir=DIR modifiable single-machine data [PREFIX/var] --libdir=DIR object code libraries [EPREFIX/lib] --includedir=DIR C header files [PREFIX/include] --oldincludedir=DIR C header files for non-gcc [/usr/include] --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] --datadir=DIR read-only architecture-independent data [DATAROOTDIR] --infodir=DIR info documentation [DATAROOTDIR/info] --localedir=DIR locale-dependent data [DATAROOTDIR/locale] --mandir=DIR man documentation [DATAROOTDIR/man] --docdir=DIR documentation root [DATAROOTDIR/doc/mtr] --htmldir=DIR html documentation [DOCDIR] --dvidir=DIR dvi documentation [DOCDIR] --pdfdir=DIR pdf documentation [DOCDIR] --psdir=DIR ps documentation [DOCDIR] _ACEOF cat <<\_ACEOF Program names: --program-prefix=PREFIX prepend PREFIX to installed program names --program-suffix=SUFFIX append SUFFIX to installed program names --program-transform-name=PROGRAM run sed PROGRAM on installed program names _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in short | recursive ) echo "Configuration of mtr 0.85:";; esac cat <<\_ACEOF Optional Features: --disable-option-checking ignore unrecognized --enable/--with options --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) --enable-FEATURE[=ARG] include FEATURE [ARG=yes] --disable-dependency-tracking speeds up one-time build --enable-dependency-tracking do not reject slow dependency extractors --disable-ipv6 Do not enable IPv6 --disable-gtktest do not try to compile and run a test GTK+ program Optional Packages: --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) --without-gtk Do not try to use GTK+ at all --without-glib Do not try to use glib at all --without-ipinfo Do not try to use ipinfo lookup at all Some influential environment variables: CC C compiler command CFLAGS C compiler flags LDFLAGS linker flags, e.g. -L if you have libraries in a nonstandard directory LIBS libraries to pass to the linker, e.g. -l CPPFLAGS (Objective) C/C++ preprocessor flags, e.g. -I if you have headers in a nonstandard directory CPP C preprocessor PKG_CONFIG path to pkg-config utility PKG_CONFIG_PATH directories to add to pkg-config's search path PKG_CONFIG_LIBDIR path overriding pkg-config's built-in search path GLIB_CFLAGS C compiler flags for GLIB, overriding pkg-config GLIB_LIBS linker flags for GLIB, overriding pkg-config Use these variables to override the choices made by `configure' or to help it to find libraries and programs with nonstandard names/locations. Report bugs to the package provider. _ACEOF ac_status=$? fi if test "$ac_init_help" = "recursive"; then # If there are subdirs, report their specific --help. for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue test -d "$ac_dir" || { cd "$srcdir" && ac_pwd=`pwd` && srcdir=. && test -d "$ac_dir"; } || continue ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } # Check for guested configure. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive elif test -f "$ac_srcdir/configure"; then echo && $SHELL "$ac_srcdir/configure" --help=recursive else $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF mtr configure 0.85 generated by GNU Autoconf 2.68 Copyright (C) 2010 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF exit fi ## ------------------------ ## ## Autoconf initialization. ## ## ------------------------ ## # ac_fn_c_try_compile LINENO # -------------------------- # Try to compile conftest.$ac_ext, and return whether this succeeded. ac_fn_c_try_compile () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack rm -f conftest.$ac_objext if { { ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_compile") 2>conftest.err ac_status=$? if test -s conftest.err; then grep -v '^ *+' conftest.err >conftest.er1 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest.$ac_objext; then : ac_retval=0 else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 fi eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno as_fn_set_status $ac_retval } # ac_fn_c_try_compile # ac_fn_c_try_run LINENO # ---------------------- # Try to link conftest.$ac_ext, and return whether this succeeded. Assumes # that executables *can* be run. ac_fn_c_try_run () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack if { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { ac_try='./conftest$ac_exeext' { { case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; }; then : ac_retval=0 else $as_echo "$as_me: program exited with status $ac_status" >&5 $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=$ac_status fi rm -rf conftest.dSYM conftest_ipa8_conftest.oo eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno as_fn_set_status $ac_retval } # ac_fn_c_try_run # ac_fn_c_compute_int LINENO EXPR VAR INCLUDES # -------------------------------------------- # Tries to find the compile-time value of EXPR in a program that includes # INCLUDES, setting VAR accordingly. Returns whether the value could be # computed ac_fn_c_compute_int () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack if test "$cross_compiling" = yes; then # Depending upon the size, compute the lo and hi bounds. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { static int test_array [1 - 2 * !(($2) >= 0)]; test_array [0] = 0 ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_lo=0 ac_mid=0 while :; do cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { static int test_array [1 - 2 * !(($2) <= $ac_mid)]; test_array [0] = 0 ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_hi=$ac_mid; break else as_fn_arith $ac_mid + 1 && ac_lo=$as_val if test $ac_lo -le $ac_mid; then ac_lo= ac_hi= break fi as_fn_arith 2 '*' $ac_mid + 1 && ac_mid=$as_val fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext done else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { static int test_array [1 - 2 * !(($2) < 0)]; test_array [0] = 0 ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_hi=-1 ac_mid=-1 while :; do cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { static int test_array [1 - 2 * !(($2) >= $ac_mid)]; test_array [0] = 0 ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_lo=$ac_mid; break else as_fn_arith '(' $ac_mid ')' - 1 && ac_hi=$as_val if test $ac_mid -le $ac_hi; then ac_lo= ac_hi= break fi as_fn_arith 2 '*' $ac_mid && ac_mid=$as_val fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext done else ac_lo= ac_hi= fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext # Binary search between lo and hi bounds. while test "x$ac_lo" != "x$ac_hi"; do as_fn_arith '(' $ac_hi - $ac_lo ')' / 2 + $ac_lo && ac_mid=$as_val cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { static int test_array [1 - 2 * !(($2) <= $ac_mid)]; test_array [0] = 0 ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_hi=$ac_mid else as_fn_arith '(' $ac_mid ')' + 1 && ac_lo=$as_val fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext done case $ac_lo in #(( ?*) eval "$3=\$ac_lo"; ac_retval=0 ;; '') ac_retval=1 ;; esac else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 static long int longval () { return $2; } static unsigned long int ulongval () { return $2; } #include #include int main () { FILE *f = fopen ("conftest.val", "w"); if (! f) return 1; if (($2) < 0) { long int i = longval (); if (i != ($2)) return 1; fprintf (f, "%ld", i); } else { unsigned long int i = ulongval (); if (i != ($2)) return 1; fprintf (f, "%lu", i); } /* Do not output a trailing newline, as this causes \r\n confusion on some platforms. */ return ferror (f) || fclose (f) != 0; ; return 0; } _ACEOF if ac_fn_c_try_run "$LINENO"; then : echo >>conftest.val; read $3 &5 (eval "$ac_cpp conftest.$ac_ext") 2>conftest.err ac_status=$? if test -s conftest.err; then grep -v '^ *+' conftest.err >conftest.er1 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } > conftest.i && { test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || test ! -s conftest.err }; then : ac_retval=0 else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 fi eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno as_fn_set_status $ac_retval } # ac_fn_c_try_cpp # ac_fn_c_check_header_compile LINENO HEADER VAR INCLUDES # ------------------------------------------------------- # Tests whether HEADER exists and can be compiled using the include files in # INCLUDES, setting the cache variable VAR accordingly. ac_fn_c_check_header_compile () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 $as_echo_n "checking for $2... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 #include <$2> _ACEOF if ac_fn_c_try_compile "$LINENO"; then : eval "$3=yes" else eval "$3=no" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_header_compile # ac_fn_c_check_header_mongrel LINENO HEADER VAR INCLUDES # ------------------------------------------------------- # Tests whether HEADER exists, giving a warning if it cannot be compiled using # the include files in INCLUDES and setting the cache variable VAR # accordingly. ac_fn_c_check_header_mongrel () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack if eval \${$3+:} false; then : { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 $as_echo_n "checking for $2... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } else # Is the header compilable? { $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 usability" >&5 $as_echo_n "checking $2 usability... " >&6; } cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 #include <$2> _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_header_compiler=yes else ac_header_compiler=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_compiler" >&5 $as_echo "$ac_header_compiler" >&6; } # Is the header present? { $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 presence" >&5 $as_echo_n "checking $2 presence... " >&6; } cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include <$2> _ACEOF if ac_fn_c_try_cpp "$LINENO"; then : ac_header_preproc=yes else ac_header_preproc=no fi rm -f conftest.err conftest.i conftest.$ac_ext { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_preproc" >&5 $as_echo "$ac_header_preproc" >&6; } # So? What about this header? case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in #(( yes:no: ) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&5 $as_echo "$as_me: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5 $as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;} ;; no:yes:* ) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: present but cannot be compiled" >&5 $as_echo "$as_me: WARNING: $2: present but cannot be compiled" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: check for missing prerequisite headers?" >&5 $as_echo "$as_me: WARNING: $2: check for missing prerequisite headers?" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: see the Autoconf documentation" >&5 $as_echo "$as_me: WARNING: $2: see the Autoconf documentation" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&5 $as_echo "$as_me: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5 $as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;} ;; esac { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 $as_echo_n "checking for $2... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 else eval "$3=\$ac_header_compiler" fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } fi eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_header_mongrel # ac_fn_c_try_link LINENO # ----------------------- # Try to link conftest.$ac_ext, and return whether this succeeded. ac_fn_c_try_link () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack rm -f conftest.$ac_objext conftest$ac_exeext if { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_link") 2>conftest.err ac_status=$? if test -s conftest.err; then grep -v '^ *+' conftest.err >conftest.er1 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || $as_test_x conftest$ac_exeext }; then : ac_retval=0 else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 fi # Delete the IPA/IPO (Inter Procedural Analysis/Optimization) information # created by the PGI compiler (conftest_ipa8_conftest.oo), as it would # interfere with the next link command; also delete a directory that is # left behind by Apple's compiler. We do this before executing the actions. rm -rf conftest.dSYM conftest_ipa8_conftest.oo eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno as_fn_set_status $ac_retval } # ac_fn_c_try_link # ac_fn_c_check_func LINENO FUNC VAR # ---------------------------------- # Tests whether FUNC exists, setting the cache variable VAR accordingly ac_fn_c_check_func () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 $as_echo_n "checking for $2... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Define $2 to an innocuous variant, in case declares $2. For example, HP-UX 11i declares gettimeofday. */ #define $2 innocuous_$2 /* System header to define __stub macros and hopefully few prototypes, which can conflict with char $2 (); below. Prefer to if __STDC__ is defined, since exists even on freestanding compilers. */ #ifdef __STDC__ # include #else # include #endif #undef $2 /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char $2 (); /* The GNU C library defines this for functions which it implements to always fail with ENOSYS. Some functions are actually named something starting with __ and the normal name is an alias. */ #if defined __stub_$2 || defined __stub___$2 choke me #endif int main () { return $2 (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : eval "$3=yes" else eval "$3=no" fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_func # ac_fn_c_check_decl LINENO SYMBOL VAR INCLUDES # --------------------------------------------- # Tests whether SYMBOL is declared in INCLUDES, setting cache variable VAR # accordingly. ac_fn_c_check_decl () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack as_decl_name=`echo $2|sed 's/ *(.*//'` as_decl_use=`echo $2|sed -e 's/(/((/' -e 's/)/) 0&/' -e 's/,/) 0& (/g'` { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $as_decl_name is declared" >&5 $as_echo_n "checking whether $as_decl_name is declared... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { #ifndef $as_decl_name #ifdef __cplusplus (void) $as_decl_use; #else (void) $as_decl_name; #endif #endif ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : eval "$3=yes" else eval "$3=no" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_decl # ac_fn_c_check_type LINENO TYPE VAR INCLUDES # ------------------------------------------- # Tests whether TYPE exists after having included INCLUDES, setting cache # variable VAR accordingly. ac_fn_c_check_type () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 $as_echo_n "checking for $2... " >&6; } if eval \${$3+:} false; then : $as_echo_n "(cached) " >&6 else eval "$3=no" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { if (sizeof ($2)) return 0; ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int main () { if (sizeof (($2))) return 0; ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : else eval "$3=yes" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi eval ac_res=\$$3 { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 $as_echo "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_type cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by mtr $as_me 0.85, which was generated by GNU Autoconf 2.68. Invocation command line was $ $0 $@ _ACEOF exec 5>>config.log { cat <<_ASUNAME ## --------- ## ## Platform. ## ## --------- ## hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` uname -m = `(uname -m) 2>/dev/null || echo unknown` uname -r = `(uname -r) 2>/dev/null || echo unknown` uname -s = `(uname -s) 2>/dev/null || echo unknown` uname -v = `(uname -v) 2>/dev/null || echo unknown` /usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` /bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` /bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` /usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` /usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` /usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` /bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` /usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` /bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` _ASUNAME as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. $as_echo "PATH: $as_dir" done IFS=$as_save_IFS } >&5 cat >&5 <<_ACEOF ## ----------- ## ## Core tests. ## ## ----------- ## _ACEOF # Keep a trace of the command line. # Strip out --no-create and --no-recursion so they do not pile up. # Strip out --silent because we don't want to record it for future runs. # Also quote any args containing shell meta-characters. # Make two passes to allow for proper duplicate-argument suppression. ac_configure_args= ac_configure_args0= ac_configure_args1= ac_must_keep_next=false for ac_pass in 1 2 do for ac_arg do case $ac_arg in -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) as_fn_append ac_configure_args0 " '$ac_arg'" ;; 2) as_fn_append ac_configure_args1 " '$ac_arg'" if test $ac_must_keep_next = true; then ac_must_keep_next=false # Got value, back to normal. else case $ac_arg in *=* | --config-cache | -C | -disable-* | --disable-* \ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ | -with-* | --with-* | -without-* | --without-* | --x) case "$ac_configure_args0 " in "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; esac ;; -* ) ac_must_keep_next=true ;; esac fi as_fn_append ac_configure_args " '$ac_arg'" ;; esac done done { ac_configure_args0=; unset ac_configure_args0;} { ac_configure_args1=; unset ac_configure_args1;} # When interrupted or exit'd, cleanup temporary files, and complete # config.log. We remove comments because anyway the quotes in there # would cause problems or look ugly. # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? # Save into config.log some information that might help in debugging. { echo $as_echo "## ---------------- ## ## Cache variables. ## ## ---------------- ##" echo # The following way of writing the cache mishandles newlines in values, ( for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( *${as_nl}ac_space=\ *) sed -n \ "s/'\''/'\''\\\\'\'''\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" ;; #( *) sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) echo $as_echo "## ----------------- ## ## Output variables. ## ## ----------------- ##" echo for ac_var in $ac_subst_vars do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then $as_echo "## ------------------- ## ## File substitutions. ## ## ------------------- ##" echo for ac_var in $ac_subst_files do eval ac_val=\$$ac_var case $ac_val in *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac $as_echo "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then $as_echo "## ----------- ## ## confdefs.h. ## ## ----------- ##" echo cat confdefs.h echo fi test "$ac_signal" != 0 && $as_echo "$as_me: caught signal $ac_signal" $as_echo "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && exit $exit_status ' 0 for ac_signal in 1 2 13 15; do trap 'ac_signal='$ac_signal'; as_fn_exit 1' $ac_signal done ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h $as_echo "/* confdefs.h */" > confdefs.h # Predefined preprocessor variables. cat >>confdefs.h <<_ACEOF #define PACKAGE_NAME "$PACKAGE_NAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_TARNAME "$PACKAGE_TARNAME" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_VERSION "$PACKAGE_VERSION" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_STRING "$PACKAGE_STRING" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" _ACEOF cat >>confdefs.h <<_ACEOF #define PACKAGE_URL "$PACKAGE_URL" _ACEOF # Let the site file select an alternate cache file if it wants to. # Prefer an explicitly selected file to automatically selected ones. ac_site_file1=NONE ac_site_file2=NONE if test -n "$CONFIG_SITE"; then # We do not want a PATH search for config.site. case $CONFIG_SITE in #(( -*) ac_site_file1=./$CONFIG_SITE;; */*) ac_site_file1=$CONFIG_SITE;; *) ac_site_file1=./$CONFIG_SITE;; esac elif test "x$prefix" != xNONE; then ac_site_file1=$prefix/share/config.site ac_site_file2=$prefix/etc/config.site else ac_site_file1=$ac_default_prefix/share/config.site ac_site_file2=$ac_default_prefix/etc/config.site fi for ac_site_file in "$ac_site_file1" "$ac_site_file2" do test "x$ac_site_file" = xNONE && continue if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5 $as_echo "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" \ || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "failed to load site script $ac_site_file See \`config.log' for more details" "$LINENO" 5; } fi done if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special files # actually), so we avoid doing that. DJGPP emulates it as a regular file. if test /dev/null != "$cache_file" && test -f "$cache_file"; then { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5 $as_echo "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5 $as_echo "$as_me: creating cache $cache_file" >&6;} >$cache_file fi # Check that the precious variables saved in the cache have kept the same # value. ac_cache_corrupted=false for ac_var in $ac_precious_vars; do eval ac_old_set=\$ac_cv_env_${ac_var}_set eval ac_new_set=\$ac_env_${ac_var}_set eval ac_old_val=\$ac_cv_env_${ac_var}_value eval ac_new_val=\$ac_env_${ac_var}_value case $ac_old_set,$ac_new_set in set,) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} ac_cache_corrupted=: ;; ,set) { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5 $as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} ac_cache_corrupted=: ;; ,);; *) if test "x$ac_old_val" != "x$ac_new_val"; then # differences in whitespace do not lead to failure. ac_old_val_w=`echo x $ac_old_val` ac_new_val_w=`echo x $ac_new_val` if test "$ac_old_val_w" != "$ac_new_val_w"; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5 $as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} ac_cache_corrupted=: else { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 $as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} eval $ac_var=\$ac_old_val fi { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5 $as_echo "$as_me: former value: \`$ac_old_val'" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5 $as_echo "$as_me: current value: \`$ac_new_val'" >&2;} fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. *) as_fn_append ac_configure_args " '$ac_arg'" ;; esac fi done if $ac_cache_corrupted; then { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5 $as_echo "$as_me: error: changes in the environment can compromise the build" >&2;} as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5 fi ## -------------------- ## ## Main body of script. ## ## -------------------- ## ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu am__api_version='1.11' ac_aux_dir= for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do if test -f "$ac_dir/install-sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install-sh -c" break elif test -f "$ac_dir/install.sh"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/install.sh -c" break elif test -f "$ac_dir/shtool"; then ac_aux_dir=$ac_dir ac_install_sh="$ac_aux_dir/shtool install -c" break fi done if test -z "$ac_aux_dir"; then as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5 fi # These three variables are undocumented and unsupported, # and are intended to be withdrawn in a future Autoconf release. # They can cause serious problems if a builder's source tree is in a directory # whose full name contains unusual characters. ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install # SunOS /usr/etc/install # IRIX /sbin/install # AIX /bin/install # AmigaOS /C/install, which installs bootblocks on floppy discs # AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag # AFS /usr/afsws/bin/install, which mishandles nonexistent args # SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. # Reject install programs that cannot install multiple files. { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5 $as_echo_n "checking for a BSD-compatible install... " >&6; } if test -z "$INSTALL"; then if ${ac_cv_path_install+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. # Account for people who put trailing slashes in PATH elements. case $as_dir/ in #(( ./ | .// | /[cC]/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \ /usr/ucb/* ) ;; *) # OSF1 and SCO ODT 3.0 have their own names for install. # Don't use installbsd from OSF since it installs stuff as root # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then if test $ac_prog = install && grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else rm -rf conftest.one conftest.two conftest.dir echo one > conftest.one echo two > conftest.two mkdir conftest.dir if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" && test -s conftest.one && test -s conftest.two && test -s conftest.dir/conftest.one && test -s conftest.dir/conftest.two then ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" break 3 fi fi fi done done ;; esac done IFS=$as_save_IFS rm -rf conftest.one conftest.two conftest.dir fi if test "${ac_cv_path_install+set}" = set; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a # value for INSTALL within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. INSTALL=$ac_install_sh fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5 $as_echo "$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether build environment is sane" >&5 $as_echo_n "checking whether build environment is sane... " >&6; } # Just in case sleep 1 echo timestamp > conftest.file # Reject unsafe characters in $srcdir or the absolute working directory # name. Accept space and tab only in the latter. am_lf=' ' case `pwd` in *[\\\"\#\$\&\'\`$am_lf]*) as_fn_error $? "unsafe absolute working directory name" "$LINENO" 5;; esac case $srcdir in *[\\\"\#\$\&\'\`$am_lf\ \ ]*) as_fn_error $? "unsafe srcdir value: \`$srcdir'" "$LINENO" 5;; esac # Do `set' in a subshell so we don't clobber the current shell's # arguments. Must try -L first in case configure is actually a # symlink; some systems play weird games with the mod time of symlinks # (eg FreeBSD returns the mod time of the symlink's containing # directory). if ( set X `ls -Lt "$srcdir/configure" conftest.file 2> /dev/null` if test "$*" = "X"; then # -L didn't work. set X `ls -t "$srcdir/configure" conftest.file` fi rm -f conftest.file if test "$*" != "X $srcdir/configure conftest.file" \ && test "$*" != "X conftest.file $srcdir/configure"; then # If neither matched, then we have a broken ls. This can happen # if, for instance, CONFIG_SHELL is bash and it inherits a # broken ls alias from the environment. This has actually # happened. Such a system could not be considered "sane". as_fn_error $? "ls -t appears to fail. Make sure there is not a broken alias in your environment" "$LINENO" 5 fi test "$2" = conftest.file ) then # Ok. : else as_fn_error $? "newly created file is older than distributed files! Check your system clock" "$LINENO" 5 fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } test "$program_prefix" != NONE && program_transform_name="s&^&$program_prefix&;$program_transform_name" # Use a double $ so make ignores it. test "$program_suffix" != NONE && program_transform_name="s&\$&$program_suffix&;$program_transform_name" # Double any \ or $. # By default was `s,x,x', remove it if useless. ac_script='s/[\\$]/&&/g;s/;s,x,x,$//' program_transform_name=`$as_echo "$program_transform_name" | sed "$ac_script"` # expand $ac_aux_dir to an absolute path am_aux_dir=`cd $ac_aux_dir && pwd` if test x"${MISSING+set}" != xset; then case $am_aux_dir in *\ * | *\ *) MISSING="\${SHELL} \"$am_aux_dir/missing\"" ;; *) MISSING="\${SHELL} $am_aux_dir/missing" ;; esac fi # Use eval to expand $SHELL if eval "$MISSING --run true"; then am_missing_run="$MISSING --run " else am_missing_run= { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: \`missing' script is too old or missing" >&5 $as_echo "$as_me: WARNING: \`missing' script is too old or missing" >&2;} fi if test x"${install_sh}" != xset; then case $am_aux_dir in *\ * | *\ *) install_sh="\${SHELL} '$am_aux_dir/install-sh'" ;; *) install_sh="\${SHELL} $am_aux_dir/install-sh" esac fi # Installed binaries are usually stripped using `strip' when the user # run `make install-strip'. However `strip' might not be the right # tool to use in cross-compilation environments, therefore Automake # will honor the `STRIP' environment variable to overrule this program. if test "$cross_compiling" != no; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}strip", so it can be a program name with args. set dummy ${ac_tool_prefix}strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$STRIP"; then ac_cv_prog_STRIP="$STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_STRIP="${ac_tool_prefix}strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi STRIP=$ac_cv_prog_STRIP if test -n "$STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $STRIP" >&5 $as_echo "$STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_prog_STRIP"; then ac_ct_STRIP=$STRIP # Extract the first word of "strip", so it can be a program name with args. set dummy strip; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_ac_ct_STRIP+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_STRIP"; then ac_cv_prog_ac_ct_STRIP="$ac_ct_STRIP" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_STRIP="strip" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_STRIP=$ac_cv_prog_ac_ct_STRIP if test -n "$ac_ct_STRIP"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_STRIP" >&5 $as_echo "$ac_ct_STRIP" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_ct_STRIP" = x; then STRIP=":" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac STRIP=$ac_ct_STRIP fi else STRIP="$ac_cv_prog_STRIP" fi fi INSTALL_STRIP_PROGRAM="\$(install_sh) -c -s" { $as_echo "$as_me:${as_lineno-$LINENO}: checking for a thread-safe mkdir -p" >&5 $as_echo_n "checking for a thread-safe mkdir -p... " >&6; } if test -z "$MKDIR_P"; then if ${ac_cv_path_mkdir+:} false; then : $as_echo_n "(cached) " >&6 else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/opt/sfw/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in mkdir gmkdir; do for ac_exec_ext in '' $ac_executable_extensions; do { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; } || continue case `"$as_dir/$ac_prog$ac_exec_ext" --version 2>&1` in #( 'mkdir (GNU coreutils) '* | \ 'mkdir (coreutils) '* | \ 'mkdir (fileutils) '4.1*) ac_cv_path_mkdir=$as_dir/$ac_prog$ac_exec_ext break 3;; esac done done done IFS=$as_save_IFS fi test -d ./--version && rmdir ./--version if test "${ac_cv_path_mkdir+set}" = set; then MKDIR_P="$ac_cv_path_mkdir -p" else # As a last resort, use the slow shell script. Don't cache a # value for MKDIR_P within a source directory, because that will # break other packages using the cache if that directory is # removed, or if the value is a relative name. MKDIR_P="$ac_install_sh -d" fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $MKDIR_P" >&5 $as_echo "$MKDIR_P" >&6; } mkdir_p="$MKDIR_P" case $mkdir_p in [\\/$]* | ?:[\\/]*) ;; */*) mkdir_p="\$(top_builddir)/$mkdir_p" ;; esac for ac_prog in gawk mawk nawk awk do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_AWK+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$AWK"; then ac_cv_prog_AWK="$AWK" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_AWK="$ac_prog" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi AWK=$ac_cv_prog_AWK if test -n "$AWK"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $AWK" >&5 $as_echo "$AWK" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi test -n "$AWK" && break done { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5 $as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } set x ${MAKE-make} ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then : $as_echo_n "(cached) " >&6 else cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @echo '@@@%%%=$(MAKE)=@@@%%%' _ACEOF # GNU make sometimes prints "make[1]: Entering ...", which would confuse us. case `${MAKE-make} -f conftest.make 2>/dev/null` in *@@@%%%=?*=@@@%%%*) eval ac_cv_prog_make_${ac_make}_set=yes;; *) eval ac_cv_prog_make_${ac_make}_set=no;; esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } SET_MAKE= else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi rm -rf .tst 2>/dev/null mkdir .tst 2>/dev/null if test -d .tst; then am__leading_dot=. else am__leading_dot=_ fi rmdir .tst 2>/dev/null if test "`cd $srcdir && pwd`" != "`pwd`"; then # Use -I$(srcdir) only when $(srcdir) != ., so that make's output # is not polluted with repeated "-I." am__isrc=' -I$(srcdir)' # test to see if srcdir already configured if test -f $srcdir/config.status; then as_fn_error $? "source directory already configured; run \"make distclean\" there first" "$LINENO" 5 fi fi # test whether we have cygpath if test -z "$CYGPATH_W"; then if (cygpath --version) >/dev/null 2>/dev/null; then CYGPATH_W='cygpath -w' else CYGPATH_W=echo fi fi # Define the identity of the package. PACKAGE='mtr' VERSION='0.85' cat >>confdefs.h <<_ACEOF #define PACKAGE "$PACKAGE" _ACEOF cat >>confdefs.h <<_ACEOF #define VERSION "$VERSION" _ACEOF # Some tools Automake needs. ACLOCAL=${ACLOCAL-"${am_missing_run}aclocal-${am__api_version}"} AUTOCONF=${AUTOCONF-"${am_missing_run}autoconf"} AUTOMAKE=${AUTOMAKE-"${am_missing_run}automake-${am__api_version}"} AUTOHEADER=${AUTOHEADER-"${am_missing_run}autoheader"} MAKEINFO=${MAKEINFO-"${am_missing_run}makeinfo"} # We need awk for the "check" target. The system "awk" is bad on # some platforms. # Always define AMTAR for backward compatibility. AMTAR=${AMTAR-"${am_missing_run}tar"} am__tar='${AMTAR} chof - "$$tardir"'; am__untar='${AMTAR} xf -' ac_config_files="$ac_config_files version.h.tmp:version.h.in" GTK_OBJ=gtk.o CURSES_OBJ=curses.o ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. set dummy ${ac_tool_prefix}gcc; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}gcc" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_ac_ct_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="gcc" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 $as_echo "$ac_ct_CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi else CC="$ac_cv_prog_CC" fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. set dummy ${ac_tool_prefix}cc; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="${ac_tool_prefix}cc" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else ac_prog_rejected=no as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS if test $ac_prog_rejected = yes; then # We found a bogon in the path, so make sure we never use it. set dummy $ac_cv_prog_CC shift if test $# != 0; then # We chose a different compiler from the bogus one. # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" fi fi fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$CC"; then if test -n "$ac_tool_prefix"; then for ac_prog in cl.exe do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_CC="$ac_tool_prefix$ac_prog" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 $as_echo "$CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi test -n "$CC" && break done fi if test -z "$CC"; then ac_ct_CC=$CC for ac_prog in cl.exe do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_prog_ac_ct_CC+:} false; then : $as_echo_n "(cached) " >&6 else if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_prog_ac_ct_CC="$ac_prog" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 $as_echo "$ac_ct_CC" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi test -n "$ac_ct_CC" && break done if test "x$ac_ct_CC" = x; then CC="" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi fi fi test -z "$CC" && { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "no acceptable C compiler found in \$PATH See \`config.log' for more details" "$LINENO" 5; } # Provide some information about the compiler. $as_echo "$as_me:${as_lineno-$LINENO}: checking for C compiler version" >&5 set X $ac_compile ac_compiler=$2 for ac_option in --version -v -V -qversion; do { { ac_try="$ac_compiler $ac_option >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_compiler $ac_option >&5") 2>conftest.err ac_status=$? if test -s conftest.err; then sed '10a\ ... rest of stderr output deleted ... 10q' conftest.err >conftest.er1 cat conftest.er1 >&5 fi rm -f conftest.er1 conftest.err $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } done cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { ; return 0; } _ACEOF ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files a.out a.out.dSYM a.exe b.out" # Try to create an executable without -o first, disregard a.out. # It will help us diagnose broken compilers, and finding out an intuition # of exeext. { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether the C compiler works" >&5 $as_echo_n "checking whether the C compiler works... " >&6; } ac_link_default=`$as_echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` # The possible output files: ac_files="a.out conftest.exe conftest a.exe a_out.exe b.out conftest.*" ac_rmfiles= for ac_file in $ac_files do case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; * ) ac_rmfiles="$ac_rmfiles $ac_file";; esac done rm -f $ac_rmfiles if { { ac_try="$ac_link_default" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_link_default") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; then : # Autoconf-2.13 could set the ac_cv_exeext variable to `no'. # So ignore a value of `no', otherwise this would lead to `EXEEXT = no' # in a Makefile. We should not override ac_cv_exeext if it was cached, # so that the user can short-circuit this test for compilers unknown to # Autoconf. for ac_file in $ac_files '' do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; [ab].out ) # We found the default executable, but exeext='' is most # certainly right. break;; *.* ) if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no; then :; else ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` fi # We set ac_cv_exeext here because the later test for it is not # safe: cross compilers may not add the suffix if given an `-o' # argument, so we may need to know it at that point already. # Even if this section looks crufty: it has the advantage of # actually working. break;; * ) break;; esac done test "$ac_cv_exeext" = no && ac_cv_exeext= else ac_file='' fi if test -z "$ac_file"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "C compiler cannot create executables See \`config.log' for more details" "$LINENO" 5; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } fi { $as_echo "$as_me:${as_lineno-$LINENO}: checking for C compiler default output file name" >&5 $as_echo_n "checking for C compiler default output file name... " >&6; } { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_file" >&5 $as_echo "$ac_file" >&6; } ac_exeext=$ac_cv_exeext rm -f -r a.out a.out.dSYM a.exe conftest$ac_cv_exeext b.out ac_clean_files=$ac_clean_files_save { $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of executables" >&5 $as_echo_n "checking for suffix of executables... " >&6; } if { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; then : # If both `conftest.exe' and `conftest' are `present' (well, observable) # catch `conftest.exe'. For instance with Cygwin, `ls conftest' will # work properly (i.e., refer to `conftest.exe'), while it won't with # `rm'. for ac_file in conftest.exe conftest conftest.*; do test -f "$ac_file" || continue case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM | *.o | *.obj ) ;; *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` break;; * ) break;; esac done else { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "cannot compute suffix of executables: cannot compile and link See \`config.log' for more details" "$LINENO" 5; } fi rm -f conftest conftest$ac_cv_exeext { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_exeext" >&5 $as_echo "$ac_cv_exeext" >&6; } rm -f conftest.$ac_ext EXEEXT=$ac_cv_exeext ac_exeext=$EXEEXT cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include int main () { FILE *f = fopen ("conftest.out", "w"); return ferror (f) || fclose (f) != 0; ; return 0; } _ACEOF ac_clean_files="$ac_clean_files conftest.out" # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are cross compiling" >&5 $as_echo_n "checking whether we are cross compiling... " >&6; } if test "$cross_compiling" != yes; then { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_link") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } if { ac_try='./conftest$ac_cv_exeext' { { case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_try") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; }; then cross_compiling=no else if test "$cross_compiling" = maybe; then cross_compiling=yes else { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "cannot run C compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details" "$LINENO" 5; } fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $cross_compiling" >&5 $as_echo "$cross_compiling" >&6; } rm -f conftest.$ac_ext conftest$ac_cv_exeext conftest.out ac_clean_files=$ac_clean_files_save { $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of object files" >&5 $as_echo_n "checking for suffix of object files... " >&6; } if ${ac_cv_objext+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { ; return 0; } _ACEOF rm -f conftest.o conftest.obj if { { ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" $as_echo "$ac_try_echo"; } >&5 (eval "$ac_compile") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; then : for ac_file in conftest.o conftest.obj conftest.*; do test -f "$ac_file" || continue; case $ac_file in *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.dSYM ) ;; *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'` break;; esac done else $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "cannot compute suffix of object files: cannot compile See \`config.log' for more details" "$LINENO" 5; } fi rm -f conftest.$ac_cv_objext conftest.$ac_ext fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_objext" >&5 $as_echo "$ac_cv_objext" >&6; } OBJEXT=$ac_cv_objext ac_objext=$OBJEXT { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are using the GNU C compiler" >&5 $as_echo_n "checking whether we are using the GNU C compiler... " >&6; } if ${ac_cv_c_compiler_gnu+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { #ifndef __GNUC__ choke me #endif ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_compiler_gnu=yes else ac_compiler_gnu=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_cv_c_compiler_gnu=$ac_compiler_gnu fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_compiler_gnu" >&5 $as_echo "$ac_cv_c_compiler_gnu" >&6; } if test $ac_compiler_gnu = yes; then GCC=yes else GCC= fi ac_test_CFLAGS=${CFLAGS+set} ac_save_CFLAGS=$CFLAGS { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CC accepts -g" >&5 $as_echo_n "checking whether $CC accepts -g... " >&6; } if ${ac_cv_prog_cc_g+:} false; then : $as_echo_n "(cached) " >&6 else ac_save_c_werror_flag=$ac_c_werror_flag ac_c_werror_flag=yes ac_cv_prog_cc_g=no CFLAGS="-g" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_cv_prog_cc_g=yes else CFLAGS="" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : else ac_c_werror_flag=$ac_save_c_werror_flag CFLAGS="-g" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int main () { ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_cv_prog_cc_g=yes fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ac_c_werror_flag=$ac_save_c_werror_flag fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_g" >&5 $as_echo "$ac_cv_prog_cc_g" >&6; } if test "$ac_test_CFLAGS" = set; then CFLAGS=$ac_save_CFLAGS elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then CFLAGS="-g -O2" else CFLAGS="-g" fi else if test "$GCC" = yes; then CFLAGS="-O2" else CFLAGS= fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $CC option to accept ISO C89" >&5 $as_echo_n "checking for $CC option to accept ISO C89... " >&6; } if ${ac_cv_prog_cc_c89+:} false; then : $as_echo_n "(cached) " >&6 else ac_cv_prog_cc_c89=no ac_save_CC=$CC cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #include #include /* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ struct buf { int x; }; FILE * (*rcsopen) (struct buf *, struct stat *, int); static char *e (p, i) char **p; int i; { return p[i]; } static char *f (char * (*g) (char **, int), char **p, ...) { char *s; va_list v; va_start (v,p); s = g (p, va_arg (v,int)); va_end (v); return s; } /* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has function prototypes and stuff, but not '\xHH' hex character constants. These don't provoke an error unfortunately, instead are silently treated as 'x'. The following induces an error, until -std is added to get proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an array size at least. It's necessary to write '\x00'==0 to get something that's true only with -std. */ int osf4_cc_array ['\x00' == 0 ? 1 : -1]; /* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters inside strings and character constants. */ #define FOO(x) 'x' int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1]; int test (int i, double x); struct s1 {int (*f) (int a);}; struct s2 {int (*f) (double a);}; int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); int argc; char **argv; int main () { return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; ; return 0; } _ACEOF for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \ -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" do CC="$ac_save_CC $ac_arg" if ac_fn_c_try_compile "$LINENO"; then : ac_cv_prog_cc_c89=$ac_arg fi rm -f core conftest.err conftest.$ac_objext test "x$ac_cv_prog_cc_c89" != "xno" && break done rm -f conftest.$ac_ext CC=$ac_save_CC fi # AC_CACHE_VAL case "x$ac_cv_prog_cc_c89" in x) { $as_echo "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 $as_echo "none needed" >&6; } ;; xno) { $as_echo "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 $as_echo "unsupported" >&6; } ;; *) CC="$CC $ac_cv_prog_cc_c89" { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c89" >&5 $as_echo "$ac_cv_prog_cc_c89" >&6; } ;; esac if test "x$ac_cv_prog_cc_c89" != xno; then : fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu DEPDIR="${am__leading_dot}deps" ac_config_commands="$ac_config_commands depfiles" am_make=${MAKE-make} cat > confinc << 'END' am__doit: @echo this is the am__doit target .PHONY: am__doit END # If we don't find an include directive, just comment out the code. { $as_echo "$as_me:${as_lineno-$LINENO}: checking for style of include used by $am_make" >&5 $as_echo_n "checking for style of include used by $am_make... " >&6; } am__include="#" am__quote= _am_result=none # First try GNU make style include. echo "include confinc" > confmf # Ignore all kinds of additional output from `make'. case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=include am__quote= _am_result=GNU ;; esac # Now try BSD make style include. if test "$am__include" = "#"; then echo '.include "confinc"' > confmf case `$am_make -s -f confmf 2> /dev/null` in #( *the\ am__doit\ target*) am__include=.include am__quote="\"" _am_result=BSD ;; esac fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $_am_result" >&5 $as_echo "$_am_result" >&6; } rm -f confinc confmf # Check whether --enable-dependency-tracking was given. if test "${enable_dependency_tracking+set}" = set; then : enableval=$enable_dependency_tracking; fi if test "x$enable_dependency_tracking" != xno; then am_depcomp="$ac_aux_dir/depcomp" AMDEPBACKSLASH='\' fi if test "x$enable_dependency_tracking" != xno; then AMDEP_TRUE= AMDEP_FALSE='#' else AMDEP_TRUE='#' AMDEP_FALSE= fi depcc="$CC" am_compiler_list= { $as_echo "$as_me:${as_lineno-$LINENO}: checking dependency style of $depcc" >&5 $as_echo_n "checking dependency style of $depcc... " >&6; } if ${am_cv_CC_dependencies_compiler_type+:} false; then : $as_echo_n "(cached) " >&6 else if test -z "$AMDEP_TRUE" && test -f "$am_depcomp"; then # We make a subdir and do the tests there. Otherwise we can end up # making bogus files that we don't know about and never remove. For # instance it was reported that on HP-UX the gcc test will end up # making a dummy file named `D' -- because `-MD' means `put the output # in D'. mkdir conftest.dir # Copy depcomp to subdir because otherwise we won't find it if we're # using a relative directory. cp "$am_depcomp" conftest.dir cd conftest.dir # We will build objects and dependencies in a subdirectory because # it helps to detect inapplicable dependency modes. For instance # both Tru64's cc and ICC support -MD to output dependencies as a # side effect of compilation, but ICC will put the dependencies in # the current directory while Tru64 will put them in the object # directory. mkdir sub am_cv_CC_dependencies_compiler_type=none if test "$am_compiler_list" = ""; then am_compiler_list=`sed -n 's/^#*\([a-zA-Z0-9]*\))$/\1/p' < ./depcomp` fi am__universal=false case " $depcc " in #( *\ -arch\ *\ -arch\ *) am__universal=true ;; esac for depmode in $am_compiler_list; do # Setup a source with many dependencies, because some compilers # like to wrap large dependency lists on column 80 (with \), and # we should not choose a depcomp mode which is confused by this. # # We need to recreate these files for each test, as the compiler may # overwrite some of them when testing with obscure command lines. # This happens at least with the AIX C compiler. : > sub/conftest.c for i in 1 2 3 4 5 6; do echo '#include "conftst'$i'.h"' >> sub/conftest.c # Using `: > sub/conftst$i.h' creates only sub/conftst1.h with # Solaris 8's {/usr,}/bin/sh. touch sub/conftst$i.h done echo "${am__include} ${am__quote}sub/conftest.Po${am__quote}" > confmf # We check with `-c' and `-o' for the sake of the "dashmstdout" # mode. It turns out that the SunPro C++ compiler does not properly # handle `-M -o', and we need to detect this. Also, some Intel # versions had trouble with output in subdirs am__obj=sub/conftest.${OBJEXT-o} am__minus_obj="-o $am__obj" case $depmode in gcc) # This depmode causes a compiler race in universal mode. test "$am__universal" = false || continue ;; nosideeffect) # after this tag, mechanisms are not by side-effect, so they'll # only be used when explicitly requested if test "x$enable_dependency_tracking" = xyes; then continue else break fi ;; msvisualcpp | msvcmsys) # This compiler won't grok `-c -o', but also, the minuso test has # not run yet. These depmodes are late enough in the game, and # so weak that their functioning should not be impacted. am__obj=conftest.${OBJEXT-o} am__minus_obj= ;; none) break ;; esac if depmode=$depmode \ source=sub/conftest.c object=$am__obj \ depfile=sub/conftest.Po tmpdepfile=sub/conftest.TPo \ $SHELL ./depcomp $depcc -c $am__minus_obj sub/conftest.c \ >/dev/null 2>conftest.err && grep sub/conftst1.h sub/conftest.Po > /dev/null 2>&1 && grep sub/conftst6.h sub/conftest.Po > /dev/null 2>&1 && grep $am__obj sub/conftest.Po > /dev/null 2>&1 && ${MAKE-make} -s -f confmf > /dev/null 2>&1; then # icc doesn't choke on unknown options, it will just issue warnings # or remarks (even with -Werror). So we grep stderr for any message # that says an option was ignored or not supported. # When given -MP, icc 7.0 and 7.1 complain thusly: # icc: Command line warning: ignoring option '-M'; no argument required # The diagnosis changed in icc 8.0: # icc: Command line remark: option '-MP' not supported if (grep 'ignoring option' conftest.err || grep 'not supported' conftest.err) >/dev/null 2>&1; then :; else am_cv_CC_dependencies_compiler_type=$depmode break fi fi done cd .. rm -rf conftest.dir else am_cv_CC_dependencies_compiler_type=none fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $am_cv_CC_dependencies_compiler_type" >&5 $as_echo "$am_cv_CC_dependencies_compiler_type" >&6; } CCDEPMODE=depmode=$am_cv_CC_dependencies_compiler_type if test "x$enable_dependency_tracking" != xno \ && test "$am_cv_CC_dependencies_compiler_type" = gcc3; then am__fastdepCC_TRUE= am__fastdepCC_FALSE='#' else am__fastdepCC_TRUE='#' am__fastdepCC_FALSE= fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu { $as_echo "$as_me:${as_lineno-$LINENO}: checking how to run the C preprocessor" >&5 $as_echo_n "checking how to run the C preprocessor... " >&6; } # On Suns, sometimes $CPP names a directory. if test -n "$CPP" && test -d "$CPP"; then CPP= fi if test -z "$CPP"; then if ${ac_cv_prog_CPP+:} false; then : $as_echo_n "(cached) " >&6 else # Double quotes because CPP needs to be expanded for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp" do ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if ac_fn_c_try_cpp "$LINENO"; then : else # Broken: fails on valid input. continue fi rm -f conftest.err conftest.i conftest.$ac_ext # OK, works on sane cases. Now check whether nonexistent headers # can be detected and how. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include _ACEOF if ac_fn_c_try_cpp "$LINENO"; then : # Broken: success on invalid input. continue else # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.i conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.i conftest.err conftest.$ac_ext if $ac_preproc_ok; then : break fi done ac_cv_prog_CPP=$CPP fi CPP=$ac_cv_prog_CPP else ac_cv_prog_CPP=$CPP fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CPP" >&5 $as_echo "$CPP" >&6; } ac_preproc_ok=false for ac_c_preproc_warn_flag in '' yes do # Use a header file that comes with gcc, so configuring glibc # with a fresh cross-compiler works. # Prefer to if __STDC__ is defined, since # exists even on freestanding compilers. # On the NeXT, cc -E runs the code through the compiler's parser, # not just through cpp. "Syntax error" is here to catch this case. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #ifdef __STDC__ # include #else # include #endif Syntax error _ACEOF if ac_fn_c_try_cpp "$LINENO"; then : else # Broken: fails on valid input. continue fi rm -f conftest.err conftest.i conftest.$ac_ext # OK, works on sane cases. Now check whether nonexistent headers # can be detected and how. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include _ACEOF if ac_fn_c_try_cpp "$LINENO"; then : # Broken: success on invalid input. continue else # Passes both tests. ac_preproc_ok=: break fi rm -f conftest.err conftest.i conftest.$ac_ext done # Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. rm -f conftest.i conftest.err conftest.$ac_ext if $ac_preproc_ok; then : else { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "C preprocessor \"$CPP\" fails sanity check See \`config.log' for more details" "$LINENO" 5; } fi ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu { $as_echo "$as_me:${as_lineno-$LINENO}: checking for grep that handles long lines and -e" >&5 $as_echo_n "checking for grep that handles long lines and -e... " >&6; } if ${ac_cv_path_GREP+:} false; then : $as_echo_n "(cached) " >&6 else if test -z "$GREP"; then ac_path_GREP_found=false # Loop through the user's path and test for each of PROGNAME-LIST as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in grep ggrep; do for ac_exec_ext in '' $ac_executable_extensions; do ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext" { test -f "$ac_path_GREP" && $as_test_x "$ac_path_GREP"; } || continue # Check for GNU ac_path_GREP and select it if it is found. # Check for GNU $ac_path_GREP case `"$ac_path_GREP" --version 2>&1` in *GNU*) ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;; *) ac_count=0 $as_echo_n 0123456789 >"conftest.in" while : do cat "conftest.in" "conftest.in" >"conftest.tmp" mv "conftest.tmp" "conftest.in" cp "conftest.in" "conftest.nl" $as_echo 'GREP' >> "conftest.nl" "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break as_fn_arith $ac_count + 1 && ac_count=$as_val if test $ac_count -gt ${ac_path_GREP_max-0}; then # Best one so far, save it but keep looking for a better one ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_max=$ac_count fi # 10*(2^10) chars as input seems more than enough test $ac_count -gt 10 && break done rm -f conftest.in conftest.tmp conftest.nl conftest.out;; esac $ac_path_GREP_found && break 3 done done done IFS=$as_save_IFS if test -z "$ac_cv_path_GREP"; then as_fn_error $? "no acceptable grep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5 fi else ac_cv_path_GREP=$GREP fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_GREP" >&5 $as_echo "$ac_cv_path_GREP" >&6; } GREP="$ac_cv_path_GREP" { $as_echo "$as_me:${as_lineno-$LINENO}: checking for egrep" >&5 $as_echo_n "checking for egrep... " >&6; } if ${ac_cv_path_EGREP+:} false; then : $as_echo_n "(cached) " >&6 else if echo a | $GREP -E '(a|b)' >/dev/null 2>&1 then ac_cv_path_EGREP="$GREP -E" else if test -z "$EGREP"; then ac_path_EGREP_found=false # Loop through the user's path and test for each of PROGNAME-LIST as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_prog in egrep; do for ac_exec_ext in '' $ac_executable_extensions; do ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext" { test -f "$ac_path_EGREP" && $as_test_x "$ac_path_EGREP"; } || continue # Check for GNU ac_path_EGREP and select it if it is found. # Check for GNU $ac_path_EGREP case `"$ac_path_EGREP" --version 2>&1` in *GNU*) ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;; *) ac_count=0 $as_echo_n 0123456789 >"conftest.in" while : do cat "conftest.in" "conftest.in" >"conftest.tmp" mv "conftest.tmp" "conftest.in" cp "conftest.in" "conftest.nl" $as_echo 'EGREP' >> "conftest.nl" "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break as_fn_arith $ac_count + 1 && ac_count=$as_val if test $ac_count -gt ${ac_path_EGREP_max-0}; then # Best one so far, save it but keep looking for a better one ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_max=$ac_count fi # 10*(2^10) chars as input seems more than enough test $ac_count -gt 10 && break done rm -f conftest.in conftest.tmp conftest.nl conftest.out;; esac $ac_path_EGREP_found && break 3 done done done IFS=$as_save_IFS if test -z "$ac_cv_path_EGREP"; then as_fn_error $? "no acceptable egrep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5 fi else ac_cv_path_EGREP=$EGREP fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_EGREP" >&5 $as_echo "$ac_cv_path_EGREP" >&6; } EGREP="$ac_cv_path_EGREP" { $as_echo "$as_me:${as_lineno-$LINENO}: checking for ANSI C header files" >&5 $as_echo_n "checking for ANSI C header files... " >&6; } if ${ac_cv_header_stdc+:} false; then : $as_echo_n "(cached) " >&6 else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #include #include int main () { ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : ac_cv_header_stdc=yes else ac_cv_header_stdc=no fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext if test $ac_cv_header_stdc = yes; then # SunOS 4.x string.h does not declare mem*, contrary to ANSI. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "memchr" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | $EGREP "free" >/dev/null 2>&1; then : else ac_cv_header_stdc=no fi rm -f conftest* fi if test $ac_cv_header_stdc = yes; then # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. if test "$cross_compiling" = yes; then : : else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #if ((' ' & 0x0FF) == 0x020) # define ISLOWER(c) ('a' <= (c) && (c) <= 'z') # define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) #else # define ISLOWER(c) \ (('a' <= (c) && (c) <= 'i') \ || ('j' <= (c) && (c) <= 'r') \ || ('s' <= (c) && (c) <= 'z')) # define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) #endif #define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) int main () { int i; for (i = 0; i < 256; i++) if (XOR (islower (i), ISLOWER (i)) || toupper (i) != TOUPPER (i)) return 2; return 0; } _ACEOF if ac_fn_c_try_run "$LINENO"; then : else ac_cv_header_stdc=no fi rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \ conftest.$ac_objext conftest.beam conftest.$ac_ext fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdc" >&5 $as_echo "$ac_cv_header_stdc" >&6; } if test $ac_cv_header_stdc = yes; then $as_echo "#define STDC_HEADERS 1" >>confdefs.h fi # On IRIX 5.3, sys/types and inttypes.h are conflicting. for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \ inttypes.h stdint.h unistd.h do : as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` ac_fn_c_check_header_compile "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default " if eval test \"x\$"$as_ac_Header"\" = x"yes"; then : cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done # The cast to long int works around a bug in the HP C Compiler # version HP92453-01 B.11.11.23709.GP, which incorrectly rejects # declarations like `int a3[[(sizeof (unsigned char)) >= 0]];'. # This bug is HP SR number 8606223364. { $as_echo "$as_me:${as_lineno-$LINENO}: checking size of unsigned char" >&5 $as_echo_n "checking size of unsigned char... " >&6; } if ${ac_cv_sizeof_unsigned_char+:} false; then : $as_echo_n "(cached) " >&6 else if ac_fn_c_compute_int "$LINENO" "(long int) (sizeof (unsigned char))" "ac_cv_sizeof_unsigned_char" "$ac_includes_default"; then : else if test "$ac_cv_type_unsigned_char" = yes; then { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "cannot compute sizeof (unsigned char) See \`config.log' for more details" "$LINENO" 5; } else ac_cv_sizeof_unsigned_char=0 fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_sizeof_unsigned_char" >&5 $as_echo "$ac_cv_sizeof_unsigned_char" >&6; } cat >>confdefs.h <<_ACEOF #define SIZEOF_UNSIGNED_CHAR $ac_cv_sizeof_unsigned_char _ACEOF # The cast to long int works around a bug in the HP C Compiler # version HP92453-01 B.11.11.23709.GP, which incorrectly rejects # declarations like `int a3[[(sizeof (unsigned char)) >= 0]];'. # This bug is HP SR number 8606223364. { $as_echo "$as_me:${as_lineno-$LINENO}: checking size of unsigned short" >&5 $as_echo_n "checking size of unsigned short... " >&6; } if ${ac_cv_sizeof_unsigned_short+:} false; then : $as_echo_n "(cached) " >&6 else if ac_fn_c_compute_int "$LINENO" "(long int) (sizeof (unsigned short))" "ac_cv_sizeof_unsigned_short" "$ac_includes_default"; then : else if test "$ac_cv_type_unsigned_short" = yes; then { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "cannot compute sizeof (unsigned short) See \`config.log' for more details" "$LINENO" 5; } else ac_cv_sizeof_unsigned_short=0 fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_sizeof_unsigned_short" >&5 $as_echo "$ac_cv_sizeof_unsigned_short" >&6; } cat >>confdefs.h <<_ACEOF #define SIZEOF_UNSIGNED_SHORT $ac_cv_sizeof_unsigned_short _ACEOF # The cast to long int works around a bug in the HP C Compiler # version HP92453-01 B.11.11.23709.GP, which incorrectly rejects # declarations like `int a3[[(sizeof (unsigned char)) >= 0]];'. # This bug is HP SR number 8606223364. { $as_echo "$as_me:${as_lineno-$LINENO}: checking size of unsigned int" >&5 $as_echo_n "checking size of unsigned int... " >&6; } if ${ac_cv_sizeof_unsigned_int+:} false; then : $as_echo_n "(cached) " >&6 else if ac_fn_c_compute_int "$LINENO" "(long int) (sizeof (unsigned int))" "ac_cv_sizeof_unsigned_int" "$ac_includes_default"; then : else if test "$ac_cv_type_unsigned_int" = yes; then { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "cannot compute sizeof (unsigned int) See \`config.log' for more details" "$LINENO" 5; } else ac_cv_sizeof_unsigned_int=0 fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_sizeof_unsigned_int" >&5 $as_echo "$ac_cv_sizeof_unsigned_int" >&6; } cat >>confdefs.h <<_ACEOF #define SIZEOF_UNSIGNED_INT $ac_cv_sizeof_unsigned_int _ACEOF # The cast to long int works around a bug in the HP C Compiler # version HP92453-01 B.11.11.23709.GP, which incorrectly rejects # declarations like `int a3[[(sizeof (unsigned char)) >= 0]];'. # This bug is HP SR number 8606223364. { $as_echo "$as_me:${as_lineno-$LINENO}: checking size of unsigned long" >&5 $as_echo_n "checking size of unsigned long... " >&6; } if ${ac_cv_sizeof_unsigned_long+:} false; then : $as_echo_n "(cached) " >&6 else if ac_fn_c_compute_int "$LINENO" "(long int) (sizeof (unsigned long))" "ac_cv_sizeof_unsigned_long" "$ac_includes_default"; then : else if test "$ac_cv_type_unsigned_long" = yes; then { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "cannot compute sizeof (unsigned long) See \`config.log' for more details" "$LINENO" 5; } else ac_cv_sizeof_unsigned_long=0 fi fi fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_sizeof_unsigned_long" >&5 $as_echo "$ac_cv_sizeof_unsigned_long" >&6; } cat >>confdefs.h <<_ACEOF #define SIZEOF_UNSIGNED_LONG $ac_cv_sizeof_unsigned_long _ACEOF for ac_header in ncurses.h ncurses/curses.h curses.h cursesX.h sys/types.h fcntl.h do : as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` ac_fn_c_check_header_mongrel "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default" if eval test \"x\$"$as_ac_Header"\" = x"yes"; then : cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done for ac_header in socket.h sys/socket.h sys/xti.h arpa/nameser_compat.h do : as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` ac_fn_c_check_header_mongrel "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default" if eval test \"x\$"$as_ac_Header"\" = x"yes"; then : cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 _ACEOF fi done # We don't refer to any symbols in termcap, but -lcurses on SunOS does. # We have to trust the linker not to mess things up... (It should not # pull in anything if we don't refer to anything in the lib). { $as_echo "$as_me:${as_lineno-$LINENO}: checking for tgetent in -ltermcap" >&5 $as_echo_n "checking for tgetent in -ltermcap... " >&6; } if ${ac_cv_lib_termcap_tgetent+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ltermcap $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char tgetent (); int main () { return tgetent (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_termcap_tgetent=yes else ac_cv_lib_termcap_tgetent=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_termcap_tgetent" >&5 $as_echo "$ac_cv_lib_termcap_tgetent" >&6; } if test "x$ac_cv_lib_termcap_tgetent" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBTERMCAP 1 _ACEOF LIBS="-ltermcap $LIBS" fi { $as_echo "$as_me:${as_lineno-$LINENO}: checking for tgetent in -ltinfo" >&5 $as_echo_n "checking for tgetent in -ltinfo... " >&6; } if ${ac_cv_lib_tinfo_tgetent+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-ltinfo $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char tgetent (); int main () { return tgetent (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_tinfo_tgetent=yes else ac_cv_lib_tinfo_tgetent=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_tinfo_tgetent" >&5 $as_echo "$ac_cv_lib_tinfo_tgetent" >&6; } if test "x$ac_cv_lib_tinfo_tgetent" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBTINFO 1 _ACEOF LIBS="-ltinfo $LIBS" fi ac_fn_c_check_func "$LINENO" "initscr" "ac_cv_func_initscr" if test "x$ac_cv_func_initscr" = xyes; then : else { $as_echo "$as_me:${as_lineno-$LINENO}: checking for initscr in -lncurses" >&5 $as_echo_n "checking for initscr in -lncurses... " >&6; } if ${ac_cv_lib_ncurses_initscr+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lncurses $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char initscr (); int main () { return initscr (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_ncurses_initscr=yes else ac_cv_lib_ncurses_initscr=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_ncurses_initscr" >&5 $as_echo "$ac_cv_lib_ncurses_initscr" >&6; } if test "x$ac_cv_lib_ncurses_initscr" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBNCURSES 1 _ACEOF LIBS="-lncurses $LIBS" else { $as_echo "$as_me:${as_lineno-$LINENO}: checking for initscr in -lcurses" >&5 $as_echo_n "checking for initscr in -lcurses... " >&6; } if ${ac_cv_lib_curses_initscr+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lcurses $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char initscr (); int main () { return initscr (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_curses_initscr=yes else ac_cv_lib_curses_initscr=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_curses_initscr" >&5 $as_echo "$ac_cv_lib_curses_initscr" >&6; } if test "x$ac_cv_lib_curses_initscr" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBCURSES 1 _ACEOF LIBS="-lcurses $LIBS" else { $as_echo "$as_me:${as_lineno-$LINENO}: checking for initscr in -lcursesX" >&5 $as_echo_n "checking for initscr in -lcursesX... " >&6; } if ${ac_cv_lib_cursesX_initscr+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lcursesX $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char initscr (); int main () { return initscr (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_cursesX_initscr=yes else ac_cv_lib_cursesX_initscr=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_cursesX_initscr" >&5 $as_echo "$ac_cv_lib_cursesX_initscr" >&6; } if test "x$ac_cv_lib_cursesX_initscr" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBCURSESX 1 _ACEOF LIBS="-lcursesX $LIBS" else { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: Building without curses display support" >&5 $as_echo "$as_me: WARNING: Building without curses display support" >&2;} $as_echo "#define NO_CURSES 1" >>confdefs.h CURSES_OBJ= fi fi fi fi for ac_func in attron fcntl do : as_ac_var=`$as_echo "ac_cv_func_$ac_func" | $as_tr_sh` ac_fn_c_check_func "$LINENO" "$ac_func" "$as_ac_var" if eval test \"x\$"$as_ac_var"\" = x"yes"; then : cat >>confdefs.h <<_ACEOF #define `$as_echo "HAVE_$ac_func" | $as_tr_cpp` 1 _ACEOF fi done { $as_echo "$as_me:${as_lineno-$LINENO}: checking for floor in -lm" >&5 $as_echo_n "checking for floor in -lm... " >&6; } if ${ac_cv_lib_m_floor+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lm $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char floor (); int main () { return floor (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_m_floor=yes else ac_cv_lib_m_floor=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_m_floor" >&5 $as_echo "$ac_cv_lib_m_floor" >&6; } if test "x$ac_cv_lib_m_floor" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBM 1 _ACEOF LIBS="-lm $LIBS" else as_fn_error $? "No math library found" "$LINENO" 5 fi # Check whether --with-gtk was given. if test "${with_gtk+set}" = set; then : withval=$with_gtk; WANTS_GTK=$withval else WANTS_GTK=yes fi # Check whether --with-glib was given. if test "${with_glib+set}" = set; then : withval=$with_glib; WANTS_GLIB=$withval else WANTS_GLIB=yes fi # Check whether --with-ipinfo was given. if test "${with_ipinfo+set}" = set; then : withval=$with_ipinfo; case "${withval}" in yes) ipinfo=true ;; no) ipinfo=false ;; *) as_fn_error $? "bad value ${withval} for --with-ipinfo" "$LINENO" 5 ;; esac else ipinfo=true fi if test x$ipinfo = xtrue; then IPINFO_TRUE= IPINFO_FALSE='#' else IPINFO_TRUE='#' IPINFO_FALSE= fi if test "x$ipinfo" = "xfalse"; then $as_echo "#define NO_IPINFO 1" >>confdefs.h fi # Check whether --enable-ipv6 was given. if test "${enable_ipv6+set}" = set; then : enableval=$enable_ipv6; WANTS_IPV6=$enableval else WANTS_IPV6=yes fi if test "x$WANTS_GTK" = "xyes"; then # Check whether --enable-gtktest was given. if test "${enable_gtktest+set}" = set; then : enableval=$enable_gtktest; else enable_gtktest=yes fi pkg_config_args=gtk+-2.0 for module in . do case "$module" in gthread) pkg_config_args="$pkg_config_args gthread-2.0" ;; esac done no_gtk="" # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_path_PKG_CONFIG+:} false; then : $as_echo_n "(cached) " >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS test -z "$ac_cv_path_PKG_CONFIG" && ac_cv_path_PKG_CONFIG="no" ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $PKG_CONFIG" >&5 $as_echo "$PKG_CONFIG" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test x$PKG_CONFIG != xno ; then if pkg-config --atleast-pkgconfig-version 0.7 ; then : else echo "*** pkg-config too old; version 0.7 or better required." no_gtk=yes PKG_CONFIG=no fi else no_gtk=yes fi min_gtk_version=2.6.0 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for GTK+ - version >= $min_gtk_version" >&5 $as_echo_n "checking for GTK+ - version >= $min_gtk_version... " >&6; } if test x$PKG_CONFIG != xno ; then ## don't try to run the test against uninstalled libtool libs if $PKG_CONFIG --uninstalled $pkg_config_args; then echo "Will use uninstalled version of GTK+ found in PKG_CONFIG_PATH" enable_gtktest=no fi if $PKG_CONFIG --atleast-version $min_gtk_version $pkg_config_args; then : else no_gtk=yes fi fi if test x"$no_gtk" = x ; then GTK_CFLAGS=`$PKG_CONFIG $pkg_config_args --cflags` GTK_LIBS=`$PKG_CONFIG $pkg_config_args --libs` gtk_config_major_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\1/'` gtk_config_minor_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\2/'` gtk_config_micro_version=`$PKG_CONFIG --modversion gtk+-2.0 | \ sed 's/\([0-9]*\).\([0-9]*\).\([0-9]*\)/\3/'` if test "x$enable_gtktest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$GTK_LIBS $LIBS" rm -f conf.gtktest if test "$cross_compiling" = yes; then : echo $ac_n "cross compiling; assumed OK... $ac_c" else cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #include int main () { int major, minor, micro; char *tmp_version; fclose (fopen ("conf.gtktest", "w")); /* HP/UX 9 (%@#!) writes to sscanf strings */ tmp_version = g_strdup("$min_gtk_version"); if (sscanf(tmp_version, "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_gtk_version"); exit(1); } if ((gtk_major_version != $gtk_config_major_version) || (gtk_minor_version != $gtk_config_minor_version) || (gtk_micro_version != $gtk_config_micro_version)) { printf("\n*** 'pkg-config --modversion gtk+-2.0' returned %d.%d.%d, but GTK+ (%d.%d.%d)\n", $gtk_config_major_version, $gtk_config_minor_version, $gtk_config_micro_version, gtk_major_version, gtk_minor_version, gtk_micro_version); printf ("*** was found! If pkg-config was correct, then it is best\n"); printf ("*** to remove the old version of GTK+. You may also be able to fix the error\n"); printf("*** by modifying your LD_LIBRARY_PATH enviroment variable, or by editing\n"); printf("*** /etc/ld.so.conf. Make sure you have run ldconfig if that is\n"); printf("*** required on your system.\n"); printf("*** If pkg-config was wrong, set the environment variable PKG_CONFIG_PATH\n"); printf("*** to point to the correct configuration files\n"); } else if ((gtk_major_version != GTK_MAJOR_VERSION) || (gtk_minor_version != GTK_MINOR_VERSION) || (gtk_micro_version != GTK_MICRO_VERSION)) { printf("*** GTK+ header files (version %d.%d.%d) do not match\n", GTK_MAJOR_VERSION, GTK_MINOR_VERSION, GTK_MICRO_VERSION); printf("*** library (version %d.%d.%d)\n", gtk_major_version, gtk_minor_version, gtk_micro_version); } else { if ((gtk_major_version > major) || ((gtk_major_version == major) && (gtk_minor_version > minor)) || ((gtk_major_version == major) && (gtk_minor_version == minor) && (gtk_micro_version >= micro))) { return 0; } else { printf("\n*** An old version of GTK+ (%d.%d.%d) was found.\n", gtk_major_version, gtk_minor_version, gtk_micro_version); printf("*** You need a version of GTK+ newer than %d.%d.%d. The latest version of\n", major, minor, micro); printf("*** GTK+ is always available from ftp://ftp.gtk.org.\n"); printf("***\n"); printf("*** If you have already installed a sufficiently new version, this error\n"); printf("*** probably means that the wrong copy of the pkg-config shell script is\n"); printf("*** being found. The easiest way to fix this is to remove the old version\n"); printf("*** of GTK+, but you can also set the PKG_CONFIG environment to point to the\n"); printf("*** correct copy of pkg-config. (In this case, you will have to\n"); printf("*** modify your LD_LIBRARY_PATH enviroment variable, or edit /etc/ld.so.conf\n"); printf("*** so that the correct libraries are found at run-time))\n"); } } return 1; } _ACEOF if ac_fn_c_try_run "$LINENO"; then : else no_gtk=yes fi rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \ conftest.$ac_objext conftest.beam conftest.$ac_ext fi CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_gtk" = x ; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes (version $gtk_config_major_version.$gtk_config_minor_version.$gtk_config_micro_version)" >&5 $as_echo "yes (version $gtk_config_major_version.$gtk_config_minor_version.$gtk_config_micro_version)" >&6; } CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$LIBS $GTK_LIBS -lm" else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } if test "$PKG_CONFIG" = "no" ; then echo "*** A new enough version of pkg-config was not found." echo "*** See http://pkgconfig.sourceforge.net" else if test -f conf.gtktest ; then : else echo "*** Could not run GTK+ test program, checking why..." ac_save_CFLAGS="$CFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $GTK_CFLAGS" LIBS="$LIBS $GTK_LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include int main () { return ((gtk_major_version) || (gtk_minor_version) || (gtk_micro_version)); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding GTK+ or finding the wrong" echo "*** version of GTK+. If it is not finding GTK+, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH" else echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means GTK+ is incorrectly installed." fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext CFLAGS="$ac_save_CFLAGS" LIBS="$ac_save_LIBS" fi fi GTK_CFLAGS="" GTK_LIBS="" { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: Building without GTK2 display support" >&5 $as_echo "$as_me: WARNING: Building without GTK2 display support" >&2;} $as_echo "#define NO_GTK 1" >>confdefs.h GTK_OBJ="" fi rm -f conf.gtktest else $as_echo "#define NO_GTK 1" >>confdefs.h GTK_OBJ="" if test "x$WANTS_GLIB" = "xyes"; then if test "x$ac_cv_env_PKG_CONFIG_set" != "xset"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}pkg-config", so it can be a program name with args. set dummy ${ac_tool_prefix}pkg-config; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_path_PKG_CONFIG+:} false; then : $as_echo_n "(cached) " >&6 else case $PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_PKG_CONFIG="$PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_path_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS ;; esac fi PKG_CONFIG=$ac_cv_path_PKG_CONFIG if test -n "$PKG_CONFIG"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $PKG_CONFIG" >&5 $as_echo "$PKG_CONFIG" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi fi if test -z "$ac_cv_path_PKG_CONFIG"; then ac_pt_PKG_CONFIG=$PKG_CONFIG # Extract the first word of "pkg-config", so it can be a program name with args. set dummy pkg-config; ac_word=$2 { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 $as_echo_n "checking for $ac_word... " >&6; } if ${ac_cv_path_ac_pt_PKG_CONFIG+:} false; then : $as_echo_n "(cached) " >&6 else case $ac_pt_PKG_CONFIG in [\\/]* | ?:[\\/]*) ac_cv_path_ac_pt_PKG_CONFIG="$ac_pt_PKG_CONFIG" # Let the user override the test with a path. ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. for ac_exec_ext in '' $ac_executable_extensions; do if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then ac_cv_path_ac_pt_PKG_CONFIG="$as_dir/$ac_word$ac_exec_ext" $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 break 2 fi done done IFS=$as_save_IFS ;; esac fi ac_pt_PKG_CONFIG=$ac_cv_path_ac_pt_PKG_CONFIG if test -n "$ac_pt_PKG_CONFIG"; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_pt_PKG_CONFIG" >&5 $as_echo "$ac_pt_PKG_CONFIG" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi if test "x$ac_pt_PKG_CONFIG" = x; then PKG_CONFIG="" else case $cross_compiling:$ac_tool_warned in yes:) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 $as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac PKG_CONFIG=$ac_pt_PKG_CONFIG fi else PKG_CONFIG="$ac_cv_path_PKG_CONFIG" fi fi if test -n "$PKG_CONFIG"; then _pkg_min_version=0.9.0 { $as_echo "$as_me:${as_lineno-$LINENO}: checking pkg-config is at least version $_pkg_min_version" >&5 $as_echo_n "checking pkg-config is at least version $_pkg_min_version... " >&6; } if $PKG_CONFIG --atleast-pkgconfig-version $_pkg_min_version; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } PKG_CONFIG="" fi fi pkg_failed=no { $as_echo "$as_me:${as_lineno-$LINENO}: checking for GLIB" >&5 $as_echo_n "checking for GLIB... " >&6; } if test -n "$GLIB_CFLAGS"; then pkg_cv_GLIB_CFLAGS="$GLIB_CFLAGS" elif test -n "$PKG_CONFIG"; then if test -n "$PKG_CONFIG" && \ { { $as_echo "$as_me:${as_lineno-$LINENO}: \$PKG_CONFIG --exists --print-errors \"glib-2.0\""; } >&5 ($PKG_CONFIG --exists --print-errors "glib-2.0") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; then pkg_cv_GLIB_CFLAGS=`$PKG_CONFIG --cflags "glib-2.0" 2>/dev/null` test "x$?" != "x0" && pkg_failed=yes else pkg_failed=yes fi else pkg_failed=untried fi if test -n "$GLIB_LIBS"; then pkg_cv_GLIB_LIBS="$GLIB_LIBS" elif test -n "$PKG_CONFIG"; then if test -n "$PKG_CONFIG" && \ { { $as_echo "$as_me:${as_lineno-$LINENO}: \$PKG_CONFIG --exists --print-errors \"glib-2.0\""; } >&5 ($PKG_CONFIG --exists --print-errors "glib-2.0") 2>&5 ac_status=$? $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; then pkg_cv_GLIB_LIBS=`$PKG_CONFIG --libs "glib-2.0" 2>/dev/null` test "x$?" != "x0" && pkg_failed=yes else pkg_failed=yes fi else pkg_failed=untried fi if test $pkg_failed = yes; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } if $PKG_CONFIG --atleast-pkgconfig-version 0.20; then _pkg_short_errors_supported=yes else _pkg_short_errors_supported=no fi if test $_pkg_short_errors_supported = yes; then GLIB_PKG_ERRORS=`$PKG_CONFIG --short-errors --print-errors --cflags --libs "glib-2.0" 2>&1` else GLIB_PKG_ERRORS=`$PKG_CONFIG --print-errors --cflags --libs "glib-2.0" 2>&1` fi # Put the nasty error message in config.log where it belongs echo "$GLIB_PKG_ERRORS" >&5 as_fn_error $? "Package requirements (glib-2.0) were not met: $GLIB_PKG_ERRORS Consider adjusting the PKG_CONFIG_PATH environment variable if you installed software in a non-standard prefix. Alternatively, you may set the environment variables GLIB_CFLAGS and GLIB_LIBS to avoid the need to call pkg-config. See the pkg-config man page for more details." "$LINENO" 5 elif test $pkg_failed = untried; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 $as_echo "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "The pkg-config script could not be found or is too old. Make sure it is in your PATH or set the PKG_CONFIG environment variable to the full path to pkg-config. Alternatively, you may set the environment variables GLIB_CFLAGS and GLIB_LIBS to avoid the need to call pkg-config. See the pkg-config man page for more details. To get pkg-config, see . See \`config.log' for more details" "$LINENO" 5; } else GLIB_CFLAGS=$pkg_cv_GLIB_CFLAGS GLIB_LIBS=$pkg_cv_GLIB_LIBS { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } fi else $as_echo "#define NO_GLIB 1" >>confdefs.h fi fi ac_fn_c_check_func "$LINENO" "socket" "ac_cv_func_socket" if test "x$ac_cv_func_socket" = xyes; then : else { $as_echo "$as_me:${as_lineno-$LINENO}: checking for socket in -lsocket" >&5 $as_echo_n "checking for socket in -lsocket... " >&6; } if ${ac_cv_lib_socket_socket+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lsocket $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char socket (); int main () { return socket (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_socket_socket=yes else ac_cv_lib_socket_socket=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_socket_socket" >&5 $as_echo "$ac_cv_lib_socket_socket" >&6; } if test "x$ac_cv_lib_socket_socket" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBSOCKET 1 _ACEOF LIBS="-lsocket $LIBS" else as_fn_error $? "No socket library found" "$LINENO" 5 fi fi ac_fn_c_check_func "$LINENO" "gethostbyname" "ac_cv_func_gethostbyname" if test "x$ac_cv_func_gethostbyname" = xyes; then : else { $as_echo "$as_me:${as_lineno-$LINENO}: checking for gethostbyname in -lnsl" >&5 $as_echo_n "checking for gethostbyname in -lnsl... " >&6; } if ${ac_cv_lib_nsl_gethostbyname+:} false; then : $as_echo_n "(cached) " >&6 else ac_check_lib_save_LIBS=$LIBS LIBS="-lnsl $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ #ifdef __cplusplus extern "C" #endif char gethostbyname (); int main () { return gethostbyname (); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : ac_cv_lib_nsl_gethostbyname=yes else ac_cv_lib_nsl_gethostbyname=no fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_nsl_gethostbyname" >&5 $as_echo "$ac_cv_lib_nsl_gethostbyname" >&6; } if test "x$ac_cv_lib_nsl_gethostbyname" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_LIBNSL 1 _ACEOF LIBS="-lnsl $LIBS" else as_fn_error $? "No nameservice library found" "$LINENO" 5 fi fi #AC_CHECK_FUNC(res_init, , # AC_CHECK_LIB(bind, res_init, , # AC_CHECK_LIB(resolv, res_init, , AC_MSG_ERROR(No resolver library found)))) for ac_func in seteuid do : ac_fn_c_check_func "$LINENO" "seteuid" "ac_cv_func_seteuid" if test "x$ac_cv_func_seteuid" = xyes; then : cat >>confdefs.h <<_ACEOF #define HAVE_SETEUID 1 _ACEOF fi done # AC_CHECK_FUNC(setuid, , AC_MSG_ERROR (I Need either seteuid or setuid)) #AC_CHECK_FUNC(res_mkquery, , # AC_CHECK_LIB(bind, res_mkquery, , # AC_CHECK_LIB(resolv, res_mkquery, , # AC_CHECK_LIB(resolv, __res_mkquery, , AC_MSG_ERROR(No resolver library found))))) # See if a library is needed for res_mkquery and if so put it in RESOLV_LIBS RESOLV_LIBS= { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether library required for res_mkquery" >&5 $as_echo_n "checking whether library required for res_mkquery... " >&6; } RESOLV_LIB_NONE= cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include int main () { int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; (void)(*res_mkquery_func)(0); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } RESOLV_LIB_NONE=yes else { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test "x$RESOLV_LIB_NONE" = "x"; then { $as_echo "$as_me:${as_lineno-$LINENO}: checking for res_mkquery in -lbind" >&5 $as_echo_n "checking for res_mkquery in -lbind... " >&6; } STASH_LIBS="$LIBS" LIBS="$STASH_LIBS -lbind" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include int main () { int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; (void)(*res_mkquery_func)(0); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } RESOLV_LIBS=-lbind else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext if test "x$RESOLV_LIBS" = "x"; then { $as_echo "$as_me:${as_lineno-$LINENO}: checking for res_mkquery in -lresolv" >&5 $as_echo_n "checking for res_mkquery in -lresolv... " >&6; } LIBS="$STASH_LIBS -lresolv" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include int main () { int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; (void)(*res_mkquery_func)(0); ; return 0; } _ACEOF if ac_fn_c_try_link "$LINENO"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } RESOLV_LIBS=-lresolv else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } as_fn_error $? "No resolver library found" "$LINENO" 5 fi rm -f core conftest.err conftest.$ac_objext \ conftest$ac_exeext conftest.$ac_ext fi LIBS="$STASH_LIBS" fi ac_fn_c_check_func "$LINENO" "herror" "ac_cv_func_herror" if test "x$ac_cv_func_herror" = xyes; then : else $as_echo "#define NO_HERROR 1" >>confdefs.h fi ac_fn_c_check_func "$LINENO" "strerror" "ac_cv_func_strerror" if test "x$ac_cv_func_strerror" = xyes; then : else $as_echo "#define NO_STRERROR 1" >>confdefs.h fi USES_IPV6= ac_fn_c_check_func "$LINENO" "getaddrinfo" "ac_cv_func_getaddrinfo" if test "x$ac_cv_func_getaddrinfo" = xyes; then : if test "$WANTS_IPV6" = "yes"; then $as_echo "#define ENABLE_IPV6 /**/" >>confdefs.h USES_IPV6=yes fi fi if test "x$USES_IPV6" = "xyes"; then { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether __res_state_ext needs to be defined" >&5 $as_echo_n "checking whether __res_state_ext needs to be defined... " >&6; } cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #ifdef __GLIBC__ #define RESEXTIN6(r,i) (*(r._u._ext.nsaddrs[i])) #else #define RESEXTIN6(r,i) (r._u._ext.ext->nsaddrs[i].sin6) #endif int main () { struct __res_state res; return RESEXTIN6(res,0).sin6_addr.s6_addr[0]; ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } else { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } { $as_echo "$as_me:${as_lineno-$LINENO}: checking whether provided __res_state_ext definition can be compiled" >&5 $as_echo_n "checking whether provided __res_state_ext definition can be compiled... " >&6; } cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include #include #ifdef __GLIBC__ #define RESEXTIN6(r,i) (*(r._u._ext.nsaddrs[i])) #else #define RESEXTIN6(r,i) (r._u._ext.ext->nsaddrs[i].sin6) struct __res_state_ext { union res_sockaddr_union nsaddrs[MAXNS]; struct sort_list { int af; union { struct in_addr ina; struct in6_addr in6a; } addr, mask; } sort_list[MAXRESOLVSORT]; char nsuffix[64]; char nsuffix2[64]; }; #endif int main () { struct __res_state res; return RESEXTIN6(res,0).sin6_addr.s6_addr[0]; ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 $as_echo "yes" >&6; } $as_echo "#define NEED_RES_STATE_EXT 1" >>confdefs.h else { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 $as_echo "no" >&6; } as_fn_error $? "Need definition for struct __res_state_ext but unable to define it." "$LINENO" 5 fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi ac_fn_c_check_decl "$LINENO" "errno" "ac_cv_have_decl_errno" " #include #include " if test "x$ac_cv_have_decl_errno" = xyes; then : ac_have_decl=1 else ac_have_decl=0 fi cat >>confdefs.h <<_ACEOF #define HAVE_DECL_ERRNO $ac_have_decl _ACEOF ac_fn_c_check_type "$LINENO" "socklen_t" "ac_cv_type_socklen_t" " #include #ifdef HAVE_SOCKET_H #include #endif #ifdef HAVE_SYS_SOCKET_H #include #endif " if test "x$ac_cv_type_socklen_t" = xyes; then : $as_echo "#define HAVE_SOCKLEN_T /**/" >>confdefs.h fi ac_fn_c_check_type "$LINENO" "struct in_addr" "ac_cv_type_struct_in_addr" " #include " if test "x$ac_cv_type_struct_in_addr" = xyes; then : $as_echo "#define HAVE_STRUCT_INADDR /**/" >>confdefs.h fi { $as_echo "$as_me:${as_lineno-$LINENO}: checking for C flags to get more warnings" >&5 $as_echo_n "checking for C flags to get more warnings... " >&6; } ac_save_CFLAGS="$CFLAGS" if test "x$ac_cv_c_compiler_gnu" = "xyes" ; then warning_CFLAGS="-Wall" # Check if compiler supports -Wno-pointer-sign and add it if supports CFLAGS_saved="$CFLAGS" CFLAGS="$CFLAGS -Wno-pointer-sign" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int foo; _ACEOF if ac_fn_c_try_compile "$LINENO"; then : warning_CFLAGS="${warning_CFLAGS} -Wno-pointer-sign" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext CFLAGS="$CFLAGS_saved" else case "$host_os" in irix*) CFLAGS="$CFLAGS -fullwarn" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include int main () { printf("test"); ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : warning_CFLAGS="-fullwarn" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext ;; sunos*) if "$CC" = "acc" ; then CFLAGS="$CFLAGS -vc" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include int main () { printf("test"); ; return 0; } _ACEOF if ac_fn_c_try_compile "$LINENO"; then : warning_CFLAGS="-vc" fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext fi ;; *) warning_CFLAGS="none" ;; esac fi CFLAGS="$ac_save_CFLAGS" if test "$warning_CFLAGS" = "none" ; then { $as_echo "$as_me:${as_lineno-$LINENO}: result: none" >&5 $as_echo "none" >&6; } else CFLAGS="$CFLAGS $warning_CFLAGS" { $as_echo "$as_me:${as_lineno-$LINENO}: result: $warning_CFLAGS" >&5 $as_echo "$warning_CFLAGS" >&6; } fi ac_config_headers="$ac_config_headers config.h" ac_config_files="$ac_config_files Makefile img/Makefile" cat >confcache <<\_ACEOF # This file is a shell script that caches the results of configure # tests run on this system so they can be shared between configure # scripts and configure runs, see configure's option --config-cache. # It is not useful on other systems. If it contains results you don't # want to keep, you may remove or edit it. # # config.status only pays attention to the cache file if you give it # the --recheck option to rerun configure. # # `ac_cv_env_foo' variables (set or unset) will be overridden when # loading this file, other *unset* `ac_cv_foo' will be assigned the # following values. _ACEOF # The following way of writing the cache mishandles newlines in values, # but we know of no workaround that is simple, portable, and efficient. # So, we kill variables containing newlines. # Ultrix sh set writes to stderr and can't be redirected directly, # and sets the high bit in the cache file unless we assign to the vars. ( for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do eval ac_val=\$$ac_var case $ac_val in #( *${as_nl}*) case $ac_var in #( *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( BASH_ARGV | BASH_SOURCE) eval $ac_var= ;; #( *) { eval $ac_var=; unset $ac_var;} ;; esac ;; esac done (set) 2>&1 | case $as_nl`(ac_space=' '; set) 2>&1` in #( *${as_nl}ac_space=\ *) # `set' does not quote correctly, so add quotes: double-quote # substitution turns \\\\ into \\, and sed turns \\ into \. sed -n \ "s/'/'\\\\''/g; s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" ;; #( *) # `set' quotes correctly as required by POSIX, so do not add quotes. sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" ;; esac | sort ) | sed ' /^ac_cv_env_/b end t clear :clear s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then if test "x$cache_file" != "x/dev/null"; then { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5 $as_echo "$as_me: updating cache $cache_file" >&6;} if test ! -f "$cache_file" || test -h "$cache_file"; then cat confcache >"$cache_file" else case $cache_file in #( */* | ?:*) mv -f confcache "$cache_file"$$ && mv -f "$cache_file"$$ "$cache_file" ;; #( *) mv -f confcache "$cache_file" ;; esac fi fi else { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5 $as_echo "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache test "x$prefix" = xNONE && prefix=$ac_default_prefix # Let make expand exec_prefix. test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' DEFS=-DHAVE_CONFIG_H ac_libobjs= ac_ltlibobjs= U= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' ac_i=`$as_echo "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext" as_fn_append ac_ltlibobjs " \${LIBOBJDIR}$ac_i"'$U.lo' done LIBOBJS=$ac_libobjs LTLIBOBJS=$ac_ltlibobjs if test -n "$EXEEXT"; then am__EXEEXT_TRUE= am__EXEEXT_FALSE='#' else am__EXEEXT_TRUE='#' am__EXEEXT_FALSE= fi if test -z "${AMDEP_TRUE}" && test -z "${AMDEP_FALSE}"; then as_fn_error $? "conditional \"AMDEP\" was never defined. Usually this means the macro was only invoked conditionally." "$LINENO" 5 fi if test -z "${am__fastdepCC_TRUE}" && test -z "${am__fastdepCC_FALSE}"; then as_fn_error $? "conditional \"am__fastdepCC\" was never defined. Usually this means the macro was only invoked conditionally." "$LINENO" 5 fi if test -z "${IPINFO_TRUE}" && test -z "${IPINFO_FALSE}"; then as_fn_error $? "conditional \"IPINFO\" was never defined. Usually this means the macro was only invoked conditionally." "$LINENO" 5 fi : "${CONFIG_STATUS=./config.status}" ac_write_fail=0 ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5 $as_echo "$as_me: creating $CONFIG_STATUS" >&6;} as_write_fail=0 cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1 #! $SHELL # Generated by $as_me. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=\${CONFIG_SHELL-$SHELL} export SHELL _ASEOF cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1 ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in #( -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in #(( ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 ## ----------------------------------- ## ## Main body of $CONFIG_STATUS script. ## ## ----------------------------------- ## _ASEOF test $as_write_fail = 0 && chmod +x $CONFIG_STATUS || ac_write_fail=1 cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Save the log message, to keep $0 and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by mtr $as_me 0.85, which was generated by GNU Autoconf 2.68. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " _ACEOF case $ac_config_files in *" "*) set x $ac_config_files; shift; ac_config_files=$*;; esac case $ac_config_headers in *" "*) set x $ac_config_headers; shift; ac_config_headers=$*;; esac cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 # Files that config.status was made for. config_files="$ac_config_files" config_headers="$ac_config_headers" config_commands="$ac_config_commands" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 ac_cs_usage="\ \`$as_me' instantiates files and other configuration actions from templates according to the current configuration. Unless the files and actions are specified as TAGs, all are instantiated by default. Usage: $0 [OPTION]... [TAG]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit --config print configuration, then exit -q, --quiet, --silent do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE --header=FILE[:TEMPLATE] instantiate the configuration header FILE Configuration files: $config_files Configuration headers: $config_headers Configuration commands: $config_commands Report bugs to the package provider." _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`" ac_cs_version="\\ mtr config.status 0.85 configured by $0, generated by GNU Autoconf 2.68, with options \\"\$ac_cs_config\\" Copyright (C) 2010 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='$ac_pwd' srcdir='$srcdir' INSTALL='$INSTALL' MKDIR_P='$MKDIR_P' AWK='$AWK' test -n "\$AWK" || AWK=awk _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # The default lists apply if the user does not specify any file. ac_need_defaults=: while test $# != 0 do case $1 in --*=?*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; --*=) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg= ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) $as_echo "$ac_cs_version"; exit ;; --config | --confi | --conf | --con | --co | --c ) $as_echo "$ac_cs_config"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; '') as_fn_error $? "missing file argument" ;; esac as_fn_append CONFIG_FILES " '$ac_optarg'" ac_need_defaults=false;; --header | --heade | --head | --hea ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; esac as_fn_append CONFIG_HEADERS " '$ac_optarg'" ac_need_defaults=false;; --he | --h) # Conflict between --help and --header as_fn_error $? "ambiguous option: \`$1' Try \`$0 --help' for more information.";; --help | --hel | -h ) $as_echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) as_fn_error $? "unrecognized option: \`$1' Try \`$0 --help' for more information." ;; *) as_fn_append ac_config_targets " $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 if \$ac_cs_recheck; then set X '$SHELL' '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion shift \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6 CONFIG_SHELL='$SHELL' export CONFIG_SHELL exec "\$@" fi _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX $as_echo "$ac_log" } >&5 _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 # # INIT-COMMANDS # AMDEP_TRUE="$AMDEP_TRUE" ac_aux_dir="$ac_aux_dir" _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "version.h.tmp") CONFIG_FILES="$CONFIG_FILES version.h.tmp:version.h.in" ;; "depfiles") CONFIG_COMMANDS="$CONFIG_COMMANDS depfiles" ;; "config.h") CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;; "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; "img/Makefile") CONFIG_FILES="$CONFIG_FILES img/Makefile" ;; *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5;; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers test "${CONFIG_COMMANDS+set}" = set || CONFIG_COMMANDS=$config_commands fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= ac_tmp= trap 'exit_status=$? : "${ac_tmp:=$tmp}" { test ! -d "$ac_tmp" || rm -fr "$ac_tmp"; } && exit $exit_status ' 0 trap 'as_fn_exit 1' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5 ac_tmp=$tmp # Set up the scripts for CONFIG_FILES section. # No need to generate them if there are no CONFIG_FILES. # This happens for instance with `./config.status config.h'. if test -n "$CONFIG_FILES"; then ac_cr=`echo X | tr X '\015'` # On cygwin, bash can eat \r inside `` if the user requested igncr. # But we know of no other shell where ac_cr would be empty at this # point, so we can use a bashism as a fallback. if test "x$ac_cr" = x; then eval ac_cr=\$\'\\r\' fi ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' /dev/null` if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then ac_cs_awk_cr='\\r' else ac_cs_awk_cr=$ac_cr fi echo 'BEGIN {' >"$ac_tmp/subs1.awk" && _ACEOF { echo "cat >conf$$subs.awk <<_ACEOF" && echo "$ac_subst_vars" | sed 's/.*/&!$&$ac_delim/' && echo "_ACEOF" } >conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_num=`echo "$ac_subst_vars" | grep -c '^'` ac_delim='%!_!# ' for ac_last_try in false false false false false :; do . ./conf$$subs.sh || as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 ac_delim_n=`sed -n "s/.*$ac_delim\$/X/p" conf$$subs.awk | grep -c X` if test $ac_delim_n = $ac_delim_num; then break elif $ac_last_try; then as_fn_error $? "could not make $CONFIG_STATUS" "$LINENO" 5 else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done rm -f conf$$subs.sh cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 cat >>"\$ac_tmp/subs1.awk" <<\\_ACAWK && _ACEOF sed -n ' h s/^/S["/; s/!.*/"]=/ p g s/^[^!]*!// :repl t repl s/'"$ac_delim"'$// t delim :nl h s/\(.\{148\}\)..*/\1/ t more1 s/["\\]/\\&/g; s/^/"/; s/$/\\n"\\/ p n b repl :more1 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t nl :delim h s/\(.\{148\}\)..*/\1/ t more2 s/["\\]/\\&/g; s/^/"/; s/$/"/ p b :more2 s/["\\]/\\&/g; s/^/"/; s/$/"\\/ p g s/.\{148\}// t delim ' >$CONFIG_STATUS || ac_write_fail=1 rm -f conf$$subs.awk cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 _ACAWK cat >>"\$ac_tmp/subs1.awk" <<_ACAWK && for (key in S) S_is_set[key] = 1 FS = "" } { line = $ 0 nfields = split(line, field, "@") substed = 0 len = length(field[1]) for (i = 2; i < nfields; i++) { key = field[i] keylen = length(key) if (S_is_set[key]) { value = S[key] line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3) len += length(value) + length(field[++i]) substed = 1 } else len += 1 + keylen } print line } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g" else cat fi < "$ac_tmp/subs1.awk" > "$ac_tmp/subs.awk" \ || as_fn_error $? "could not setup config files machinery" "$LINENO" 5 _ACEOF # VPATH may cause trouble with some makes, so we remove sole $(srcdir), # ${srcdir} and @srcdir@ entries from VPATH if srcdir is ".", strip leading and # trailing colons and then remove the whole line if VPATH becomes empty # (actually we leave an empty line to preserve line numbers). if test "x$srcdir" = x.; then ac_vpsub='/^[ ]*VPATH[ ]*=[ ]*/{ h s/// s/^/:/ s/[ ]*$/:/ s/:\$(srcdir):/:/g s/:\${srcdir}:/:/g s/:@srcdir@:/:/g s/^:*// s/:*$// x s/\(=[ ]*\).*/\1/ G s/\n// s/^[^=]*=[ ]*$// }' fi cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 fi # test -n "$CONFIG_FILES" # Set up the scripts for CONFIG_HEADERS section. # No need to generate them if there are no CONFIG_HEADERS. # This happens for instance with `./config.status Makefile'. if test -n "$CONFIG_HEADERS"; then cat >"$ac_tmp/defines.awk" <<\_ACAWK || BEGIN { _ACEOF # Transform confdefs.h into an awk script `defines.awk', embedded as # here-document in config.status, that substitutes the proper values into # config.h.in to produce config.h. # Create a delimiter string that does not exist in confdefs.h, to ease # handling of long lines. ac_delim='%!_!# ' for ac_last_try in false false :; do ac_tt=`sed -n "/$ac_delim/p" confdefs.h` if test -z "$ac_tt"; then break elif $ac_last_try; then as_fn_error $? "could not make $CONFIG_HEADERS" "$LINENO" 5 else ac_delim="$ac_delim!$ac_delim _$ac_delim!! " fi done # For the awk script, D is an array of macro values keyed by name, # likewise P contains macro parameters if any. Preserve backslash # newline sequences. ac_word_re=[_$as_cr_Letters][_$as_cr_alnum]* sed -n ' s/.\{148\}/&'"$ac_delim"'/g t rset :rset s/^[ ]*#[ ]*define[ ][ ]*/ / t def d :def s/\\$// t bsnl s/["\\]/\\&/g s/^ \('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/P["\1"]="\2"\ D["\1"]=" \3"/p s/^ \('"$ac_word_re"'\)[ ]*\(.*\)/D["\1"]=" \2"/p d :bsnl s/["\\]/\\&/g s/^ \('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/P["\1"]="\2"\ D["\1"]=" \3\\\\\\n"\\/p t cont s/^ \('"$ac_word_re"'\)[ ]*\(.*\)/D["\1"]=" \2\\\\\\n"\\/p t cont d :cont n s/.\{148\}/&'"$ac_delim"'/g t clear :clear s/\\$// t bsnlc s/["\\]/\\&/g; s/^/"/; s/$/"/p d :bsnlc s/["\\]/\\&/g; s/^/"/; s/$/\\\\\\n"\\/p b cont ' >$CONFIG_STATUS || ac_write_fail=1 cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 for (key in D) D_is_set[key] = 1 FS = "" } /^[\t ]*#[\t ]*(define|undef)[\t ]+$ac_word_re([\t (]|\$)/ { line = \$ 0 split(line, arg, " ") if (arg[1] == "#") { defundef = arg[2] mac1 = arg[3] } else { defundef = substr(arg[1], 2) mac1 = arg[2] } split(mac1, mac2, "(") #) macro = mac2[1] prefix = substr(line, 1, index(line, defundef) - 1) if (D_is_set[macro]) { # Preserve the white space surrounding the "#". print prefix "define", macro P[macro] D[macro] next } else { # Replace #undef with comments. This is necessary, for example, # in the case of _POSIX_SOURCE, which is predefined and required # on some systems where configure will not decide to define it. if (defundef == "undef") { print "/*", prefix defundef, macro, "*/" next } } } { print } _ACAWK _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 as_fn_error $? "could not setup config headers machinery" "$LINENO" 5 fi # test -n "$CONFIG_HEADERS" eval set X " :F $CONFIG_FILES :H $CONFIG_HEADERS :C $CONFIG_COMMANDS" shift for ac_tag do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5;; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$ac_tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;; esac case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac as_fn_append ac_file_inputs " '$ac_f'" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 $as_echo "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) ac_sed_conf_input=`$as_echo "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac case $ac_tag in *:-:* | *:-) cat >"$ac_tmp/stdin" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir="$ac_dir"; as_fn_mkdir_p ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac ac_MKDIR_P=$MKDIR_P case $MKDIR_P in [\\/$]* | ?:[\\/]* ) ;; */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;; esac _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= ac_sed_dataroot=' /datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 $as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_datarootdir_hack=' s&@datadir@&$datadir&g s&@docdir@&$docdir&g s&@infodir@&$infodir&g s&@localedir@&$localedir&g s&@mandir@&$mandir&g s&\\\${datarootdir}&$datarootdir&g' ;; esac _ACEOF # Neutralize VPATH when `$srcdir' = `.'. # Shell code in configure.ac might set extrasub. # FIXME: do we really want to maintain this feature? cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_sed_extra="$ac_vpsub $extrasub _ACEOF cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s|@configure_input@|$ac_sed_conf_input|;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@top_build_prefix@&$ac_top_build_prefix&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t s&@MKDIR_P@&$ac_MKDIR_P&;t t $ac_datarootdir_hack " eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$ac_tmp/subs.awk" \ >$ac_tmp/out || as_fn_error $? "could not create $ac_file" "$LINENO" 5 test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \ "$ac_tmp/out"`; test -z "$ac_out"; } && { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&5 $as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&2;} rm -f "$ac_tmp/stdin" case $ac_file in -) cat "$ac_tmp/out" && rm -f "$ac_tmp/out";; *) rm -f "$ac_file" && mv "$ac_tmp/out" "$ac_file";; esac \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; :H) # # CONFIG_HEADER # if test x"$ac_file" != x-; then { $as_echo "/* $configure_input */" \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" } >"$ac_tmp/config.h" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 if diff "$ac_file" "$ac_tmp/config.h" >/dev/null 2>&1; then { $as_echo "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5 $as_echo "$as_me: $ac_file is unchanged" >&6;} else rm -f "$ac_file" mv "$ac_tmp/config.h" "$ac_file" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 fi else $as_echo "/* $configure_input */" \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" \ || as_fn_error $? "could not create -" "$LINENO" 5 fi # Compute "$ac_file"'s index in $config_headers. _am_arg="$ac_file" _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`$as_dirname -- "$_am_arg" || $as_expr X"$_am_arg" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$_am_arg" : 'X\(//\)[^/]' \| \ X"$_am_arg" : 'X\(//\)$' \| \ X"$_am_arg" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$_am_arg" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'`/stamp-h$_am_stamp_count ;; :C) { $as_echo "$as_me:${as_lineno-$LINENO}: executing $ac_file commands" >&5 $as_echo "$as_me: executing $ac_file commands" >&6;} ;; esac case $ac_file$ac_mode in "depfiles":C) test x"$AMDEP_TRUE" != x"" || { # Autoconf 2.62 quotes --file arguments for eval, but not when files # are listed without --file. Let's play safe and only enable the eval # if we detect the quoting. case $CONFIG_FILES in *\'*) eval set x "$CONFIG_FILES" ;; *) set x $CONFIG_FILES ;; esac shift for mf do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`$as_dirname -- "$mf" || $as_expr X"$mf" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$mf" : 'X\(//\)[^/]' \| \ X"$mf" : 'X\(//\)$' \| \ X"$mf" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$mf" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`$as_dirname -- "$file" || $as_expr X"$file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$file" : 'X\(//\)[^/]' \| \ X"$file" : 'X\(//\)$' \| \ X"$file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir=$dirpart/$fdir; as_fn_mkdir_p # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done } ;; esac done # for ac_tag as_fn_exit 0 _ACEOF ac_clean_files=$ac_clean_files_save test $ac_write_fail = 0 || as_fn_error $? "write failure creating $CONFIG_STATUS" "$LINENO" 5 # configure is writing to config.log, and then calls config.status. # config.status does its own redirection, appending to config.log. # Unfortunately, on DOS this fails, as config.log is still kept open # by configure, so config.status won't be able to write to it; its # output is simply discarded. So we exec the FD to /dev/null, # effectively closing config.log, so it can be properly (re)opened and # appended to by config.status. When coming back to configure, we # need to make the FD available again. if test "$no_create" != yes; then ac_cs_success=: ac_config_status_args= test "$silent" = yes && ac_config_status_args="$ac_config_status_args --quiet" exec 5>/dev/null $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false exec 5>>config.log # Use ||, not &&, to avoid exiting from the if with $? = 1, which # would make configure fail if this is the last instruction. $ac_cs_success || as_fn_exit 1 fi if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} fi mtr-0.85/select.h0000664000175000017500000000136012104140215012704 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ void select_loop(void); mtr-0.85/asn.c0000664000175000017500000001644312135723235012226 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #ifndef __APPLE__ #define BIND_8_COMPAT #endif #include #ifdef HAVE_ARPA_NAMESER_COMPAT_H #include #endif #include #include #include #include #include #include #include "config.h" #include "mtr.h" #include "asn.h" /* #ifndef IIDEBUG #define IIDEBUG #include #endif */ #define IIHASH_HI 128 #define ITEMSMAX 15 #define ITEMSEP '|' #define NAMELEN 127 #define UNKN "???" int ipinfo_no = -1; int ipinfo_max = -1; int iihash = 0; char fmtinfo[32]; extern int af; /* address family of remote target */ // items width: ASN, Route, Country, Registry, Allocated int iiwidth[] = { 6, 19, 4, 8, 11}; // item len + space int iiwidth_len = sizeof(iiwidth)/sizeof((iiwidth)[0]); typedef char* items_t[ITEMSMAX + 1]; items_t items_a; // without hash: items char txtrec[NAMELEN + 1]; // without hash: txtrec items_t* items = &items_a; char *ipinfo_lookup(const char *domain) { unsigned char answer[PACKETSZ], *pt; char host[128]; char *txt; int len, exp, size, txtlen, type; if(res_init() < 0) { fprintf(stderr,"@res_init failed\n"); return NULL; } memset(answer, 0, PACKETSZ); if((len = res_query(domain, C_IN, T_TXT, answer, PACKETSZ)) < 0) { #ifdef IIDEBUG if (iihash) syslog(LOG_INFO, "Malloc-txt: %s", UNKN); #endif return (iihash)?strdup(UNKN):UNKN; } pt = answer + sizeof(HEADER); if((exp = dn_expand(answer, answer + len, pt, host, sizeof(host))) < 0) { printf("@dn_expand failed\n"); return NULL; } pt += exp; GETSHORT(type, pt); if(type != T_TXT) { printf("@Broken DNS reply.\n"); return NULL; } pt += INT16SZ; /* class */ if((exp = dn_expand(answer, answer + len, pt, host, sizeof(host))) < 0) { printf("@second dn_expand failed\n"); return NULL; } pt += exp; GETSHORT(type, pt); if(type != T_TXT) { printf("@Not a TXT record\n"); return NULL; } pt += INT16SZ; /* class */ pt += INT32SZ; /* ttl */ GETSHORT(size, pt); txtlen = *pt; if(txtlen >= size || !txtlen) { printf("@Broken TXT record (txtlen = %d, size = %d)\n", txtlen, size); return NULL; } if (txtlen > NAMELEN) txtlen = NAMELEN; if (iihash) { if (!(txt = malloc(txtlen + 1))) return NULL; } else txt = (char*)txtrec; pt++; strncpy(txt, (char*) pt, txtlen); txt[txtlen] = 0; #ifdef IIDEBUG if (iihash) syslog(LOG_INFO, "Malloc-txt(%p): %s", txt, txt); #endif return txt; } char* trimsep(char *s) { int l; char *p = s; while (*p == ' ' || *p == ITEMSEP) *p++ = '\0'; for (l = strlen(p)-1; p[l] == ' ' || p[l] == ITEMSEP; l--) p[l] = '\0'; return p; } // originX.asn.cymru.com txtrec: ASN | Route | Country | Registry | Allocated char* split_txtrec(char *txtrec) { if (!txtrec) return NULL; if (iihash) { #ifdef IIDEBUG syslog(LOG_INFO, "Malloc-tbl: %s", txtrec); #endif if (!(items = malloc(sizeof(*items)))) { #ifdef IIDEBUG syslog(LOG_INFO, "Free-txt(%p)", txtrec); #endif free(txtrec); return NULL; } } char* prev = (*items)[0] = trimsep(txtrec); char* next; int i = 0, j; while ((next = strchr(prev, ITEMSEP)) && (i < ITEMSMAX)) { *next++ = '\0'; (*items)[i++] = trimsep(prev); (*items)[i] = prev = trimsep(next); } if (i < ITEMSMAX) i++; for (j = i; j <= ITEMSMAX; j++) (*items)[j] = NULL; if (i > ipinfo_max) ipinfo_max = i; if (ipinfo_no >= i) { if (ipinfo_no >= ipinfo_max) ipinfo_no = 0; return (*items)[0]; } else return (*items)[ipinfo_no]; } #ifdef ENABLE_IPV6 // from dns.c:addr2ip6arpa() void reverse_host6(struct in6_addr *addr, char *buff) { int i; char *b = buff; for (i=(sizeof(*addr)/2-1); i>=0; i--, b+=4) // 64b portion sprintf(b, "%x.%x.", addr->s6_addr[i] & 0xf, addr->s6_addr[i] >> 4); buff[strlen(buff) - 1] = '\0'; } #endif char *get_ipinfo(ip_t *addr) { if (!addr) return NULL; char key[NAMELEN]; char lookup_key[NAMELEN]; if (af == AF_INET6) { #ifdef ENABLE_IPV6 reverse_host6(addr, key); if (snprintf(lookup_key, NAMELEN, "%s.origin6.asn.cymru.com", key) >= NAMELEN) return NULL; #else return NULL; #endif } else { unsigned char buff[4]; memcpy(buff, addr, 4); if (snprintf(key, NAMELEN, "%d.%d.%d.%d", buff[3], buff[2], buff[1], buff[0]) >= NAMELEN) return NULL; if (snprintf(lookup_key, NAMELEN, "%s.origin.asn.cymru.com", key) >= NAMELEN) return NULL; } char *val = NULL; ENTRY item; if (iihash) { #ifdef IIDEBUG syslog(LOG_INFO, ">> Search: %s", key); #endif item.key = key;; ENTRY *found_item; if ((found_item = hsearch(item, FIND))) { if (!(val = (*((items_t*)found_item->data))[ipinfo_no])) val = (*((items_t*)found_item->data))[0]; #ifdef IIDEBUG syslog(LOG_INFO, "Found (hashed): %s", val); #endif } } if (!val) { #ifdef IIDEBUG syslog(LOG_INFO, "Lookup: %s", key); #endif if ((val = split_txtrec(ipinfo_lookup(lookup_key)))) { #ifdef IIDEBUG syslog(LOG_INFO, "Looked up: %s", key); #endif if (iihash) if ((item.key = strdup(key))) { item.data = items; hsearch(item, ENTER); #ifdef IIDEBUG syslog(LOG_INFO, "Insert into hash: %s", key); #endif } } } return val; } int get_iiwidth(void) { return (ipinfo_no < iiwidth_len) ? iiwidth[ipinfo_no] : iiwidth[ipinfo_no % iiwidth_len]; } char *fmt_ipinfo(ip_t *addr) { char *ipinfo = get_ipinfo(addr); char fmt[8]; snprintf(fmt, sizeof(fmt), "%s%%-%ds", ipinfo_no?"":"AS", get_iiwidth()); snprintf(fmtinfo, sizeof(fmtinfo), fmt, ipinfo?ipinfo:UNKN); return fmtinfo; } int is_printii(void) { return ((ipinfo_no >= 0) && (ipinfo_no != ipinfo_max)); } void asn_open(void) { if (ipinfo_no >= 0) { #ifdef IIDEBUG syslog(LOG_INFO, "hcreate(%d)", IIHASH_HI); #endif if (!(iihash = hcreate(IIHASH_HI))) perror("ipinfo hash"); } } void asn_close(void) { if (iihash) { #ifdef IIDEBUG syslog(LOG_INFO, "hdestroy()"); #endif hdestroy(); iihash = 0; } } mtr-0.85/mtr.o0000664000175000017500000021255012162522441012254 0ustar wolffwolffELF>hm@@ H‰\$èH‰l$ðH‰óL‰d$øH‰ýHƒì¾¿èH…ÀI‰Ät2H‰ßèI‰$H‹H‹$L‰%H‹l$I‰D$L‹d$HƒÄÃH‹=H‰éº¾1Àè¿èf„ATUSH‰ûèH‰ÅLcåèIÜ1ÒëfAÆM¾DÿH‹0‰Ñé@•ÇBöDF A•ÀHƒêA„øu×¶H‰Ø„Òt2H¾ÒöDV t,@„ÿuë%H¾ÒƒéöDV t…Ét HƒÀ¶„Òuã[]A\ÃH‰ØëöUSH‰ûH‰÷HìdH‹%(H‰„$1ÀH…öt€>-…ˆ€~…~H‹=èH‹-ëH‰çèH‰ßH‰Æè}þÿÿH‰ê¾H‰çèH…ÀuØH‰ïè…ÀuH9-tH‰ïèH‹„$dH3%(uVHÄ[]ÃfD¾èH…ÀH‰Åu™è‹8èH‰ÙI‰ÀºH‹=¾1Àè¿èèè‹8èH‰ÙI‰ÀºëÅ@¸ÇÿÿÿÿHƒÀH=uî¶1ö„Òt+¹1Àfˆ¶Òp‰•¶HƒÀHƒÁ0„ÒuÞHcöƆÃAWAVAUATA¼ÿÿÿÿU‰ýSH‰óHƒì€E1À¹ºH‰Þ‰ïèƒøÿ„€ƒè4ƒøFwØÿ$ÅÇÇëºf.„Çë¤@L‹-L‰ïèHƒø‡¹A¶uE1ÿA¾@„öu ë.fM‰÷I‰Æ@¾ö¿èH…À„_IFA¶tÿ@„öuÔº(L‰î¿èé-ÿÿÿDÇéÿÿÿf„H‹=º 1öè=ÿ‰Â‰ŽÚÇÿºÿ9ŽÏþÿÿ‰éÄþÿÿ@Çé±þÿÿH‹=1öèfÀWÉfZÀ.Èóƒè…À„yþÿÿó.†dþÿÿH‹ ¿º9¾è¿è€Çé)þÿÿf„ÇéþÿÿH‹=º 1öè‰Â‰‹9Ð}‰‰Â…ÒÛýÿÿÇéÌýÿÿ@Çé¹ýÿÿf„H‹=º 1öèljéˆýÿÿ„ÇéqýÿÿH‹H‰é]ýÿÿDH‹=º 1öèiÀ@B‰é4ýÿÿ@ƒ=…zÇéýÿÿ@H‹=º 1öè1Ò=ÿFЉéèüÿÿ„H‹=1öº 艃è=þÿ†¹üÿÿH‹ ¿º¾è¿è@H‹5H‹;èáúÿÿé|üÿÿ@Çéiüÿÿf„H‹=1öº è=ÿAOĉé9üÿÿf„Ç é!üÿÿÇéüÿÿÇéüÿÿH‹=º 1öè1Ò…ÀIЉéÛûÿÿÇéÉûÿÿf„Çé±ûÿÿƒ=…úÇé”ûÿÿ@ÇéûÿÿH‹=º 1öè‰ébûÿÿf‹ƒøt…ÀuÇHƒÄ[]A\A]A^A_Ãøtâƒøt݃øtØHƒÄ[]A\A]A^A_Ãf.„…À-üÿÿǺéüÿÿC¾L=H‹=º¾è¿èH‹=L‰éº¾1Àè¿èH‹ ¿º"¾è¿èH‹ ¿º ¾è¿èffffff.„ATUSHìH…ÿt}¾HÇ$èH…ÀtrLd$»ë DH…Àt1ÿƒÃ¾I‰$IƒÄèƒûvßH…ÀtH‹=H‰Áº¾1ÀèH‰æ‰ßèÇHÄ[]A\ûëÙ LDRSNBAWVGJMXILS NABWV€–˜P@€? vhrwxtglCpoicsBQenbafFmuTPZ46yz%s: memory allocation failure vhrwxtglCpo:B:i:c:s:Q:ena:f:m:uTP:Zby:z46mtr: wait time must be positive non-root users cannot request an interval < 1.0 seconds -u and -T are mutually exclusive. Warning: extra arguments ignored: %smtr: unable to get raw sockets. mtr: Unable to drop permissions. mtr: Couldn't determine raw socket type. usage: %s [-hvrwctglspniuT46] [--help] [--version] [--report] [--report-wide] [--report-cycles=COUNT] [--curses] [--gtk] [--csv|-C] [--raw] [--split] [--mpls] [--no-dns] [--show-ips] [--address interface] [--filename=FILE|-F] [--ipinfo=item_no|-y item_no] [--aslookup|-z] [--psize=bytes/-s bytes] [--report-wide|-w] [-u|-T] [--port=PORT] [--timeout=SECONDS] [--interval=SECONDS] HOSTNAME mtr: Unable to start net module. mtr: Couldn't set interface address. r%s: fopen: %s %s: ferror: %s Too many fields: %s Unknown field identifier: %c Illegal port number. mtr MTR_OPTIONSmtr 0.85localhostFailed to resolve hostFailed to resolve host: %s mtr unknown address type mtr.cf%s: fcntl: %s (ignored) : Space between fields L: Loss RatioLoss% %4.1f%%D: Dropped PacketsDrop %4dR: Received PacketsRcv %5dS: Sent PacketsSntN: Newest RTT(ms)Last %5.1fB: Min/Best RTT(ms)BestA: Average RTT(ms)AvgW: Max/Worst RTT(ms)WrstV: Standard DeviationStDevG: Geometric MeanGmeanJ: Current JitterJttr %4.1fM: Jitter Mean/Avg.JavgX: Worst JitterJmaxI: Interarrival JitterJintversionhelpreportreport-widexmlcursesgtkrawcsvsplitorderintervalreport-cyclespsizebitpatterntosmplsno-dnsshow-ipsaddressfirst-ttlfilenamemax-ttludptcpporttimeoutinetinet6ipinfoaslookuplockunlockAWAVAUATUSHì‰|$ H‰4$è…À…~è‰Çè…À…è‰Çè…À…è‰Ãè9Ã…îè‰Ãè9Ã…Úè‰ÇèH|$ H‰æèè¿èH‰ÇèH‹4$‹|$ è‹;T$ })H‹$HcʃÂH‹4ÈH‹8‰è‹;T$ |Øè…À…‹ …É…å‹…Ò…¸1ÿHœ$ L¤$ðèH‹-I‰ÅH‰èH…À„ÈfH‹¸¾€¿H…ÒHEÂH‰è…À…ë1À¹H‰ßóH«‹H‹=HŒ$1öH‰ÚÇ„$¨‰„$¤è…À„̓øõ„d‰ÇèH‹=H‰Áº¾1Àèƒ=…%H‹H‹@H…ÀH‰…:ÿÿÿèH…íu ë+fDH‰ÝH‹}èH‹]HÇEH‰ïèH…ÛuÛHÄ1À[]A\A]A^A_ÀH¸UNKNOWNHÇOSTH‰éõþÿÿ„H‹”$HÇ„$àHÇ„$èHÇ„$ØH‹B ‹JH‰„$ЋB‰Œ$äL‰¤$èƒø‰„$à‰„­ƒø tHH‹ º¾¿èƒ=„Ûþÿÿ¿èfD¿èé¯þÿÿH‹BHƒÀH‰„$ðH¼$ÐHÇ„$øè…ÀtKH‹ º!¾¿èƒ=„fþÿÿë‰f„H‹BHƒÀH‰„$ðëžfDH‹=è…Àt(H‹ º%¾¿èéþÿÿ„L‹=H‹$M…ÿL‹0„'fÇHÇfÇHÇèL‰ÿ‰èHT$‰Æ¿A‰Çè…Àu‹D$(%ð=€„²èèÇèèL‰ïèL‹=H‹$M…ÿL‹0„œfÇHÇfÇHÇèL‰ÿ‰èHT$‰Æ¿A‰Çè…Àu‹D$(%ð=€t^ƒ=„àüÿÿéöüÿÿ1Àº¾D‰ÿèƒÀ…1ÿÿÿè‹8èH‹=I‰ÀL‰ñº¾1Àèéÿÿÿ1Àº¾D‰ÿèƒÀu‰è‹8èH‹=I‰ÀL‰ñº¾1ÀèéZÿÿÿH‹ ¿º ¾è¿èH‹$¿¾H‹1Àè1ÿè¿è1ÿèH‹ ¿º)¾è¿蹺À¾¿è¹ºÜ¾¿èH‹ ¿º!¾è¿è€?‡int†F‡?ˆ?‰F‹?ŒFbŽb[•b¤b©bõÀ?LÌ ÔFxFzÌ#{b# 11 28 4? #ü  (Æ       €€ € 8 ²ú ´Æ# µú# õ  F  !Ï         ! ) + , . / 2 3 : ; < Ü â ç ì „ ˆ ÿ € a_ j Ž Ú# È* Ê* Ì: ÍJ T: F _J F jZ F Æu Ï# ẠãÆ# äÏ# åå# èº# 1Ê F ï ñÆ# òÏ# ój# ôZ# õj#ï evgï#h#i[#j[#k#09ü;[#<[#=[#>[# ?u#@ü#Aï# B#(Ñv1Øà[#ï#ï#ï#ï# ï#(ï#0ï#8ï#@ï#Hï#P ï#X"#`$$#h&[#p*[#t,«#x08#€1M#‚2*#ƒ6:#ˆ?¶#H×#˜I×# J×#¨K×#°L#¸N[#ÀP@#Ä´º»#¼$#À[#ç õ: Fà õP FVõ[ 1½ € € € € € €À €€ €€     §©T#ªT#¬«#­«#²Á#.ï0i#5Š#= #>•#@t#A# C[#$Ei#(J«#0NÙ#8Pä#@[#H\#X]#hjï#x bÿ F8Z iO kP#n[#o[#valp[# ˆ        bÅ      uÊ0m2 keyn2 #oP#pP#qP#r[# sB #(1[B 7 vq wï#xq #H yH `[­ `­ `P‰â ‰P‰P‹â w Õ[ Õ[Õ õïO __sõï__nõ[õ­ [o P  PgïÀ gïgPg[à gPY[ YïY`3 `×` ³ Ô !À !Ë "Ö #³ ‰$À V%&Ö 'Ë #‚ $  Ÿ'• (}ï! )s}ï*pï*l€[+–ˆ,–P,–P*in˜­ -™ˆ‘Ð{.Ü ›/›%/›™/›[./§ï0 ¦8!C !8 !- 1‚ ¡^!  '• 2‚ ¬$  Ÿ'• õ™3Fÿ2 4îwÍ*ið[5ý ,ý[,ý*optÿ[6i[7  8– ”n!´ !© 9O }Œ'b 8o f®'‚ 8O qÐ'b 9O Vî'b 8O ¼'b 8O œ2'b 8O µT'b 8O —v'b 8O ̘'b 8O Zº'b 8‚ å!  '• :‚ ‹!  '•  F;ä¥<äï=æ[7祑àw6pçï:‚ ó!  '• ïµ F»»Pf»­ >fd¼[>buf½¾½? õ F×j×Pf×­ >fdØ[>bufÙÚ½?z õz Fj@û[”<û[<û=ý”=þ[7v‘Ð~6res=[7#‘€7š‘ 6sa4Å 6sa6Ë 6nowG=Hâ .›=)ï9à MÆ! !ô 8‚ dñ!  '• .=¹â 9µ¦Ä!Í!ÂA"ÖBà‘À}Bë Bö 1è É ! !û 2‚ Ë!  '• 9¯q!2!'A";BE‘À}BP B[ 1è åM! !û 2‚ ç!  '• :À 9!Ó # ïª FC¥$C¦$C§$C:ïCH[C=[Ddns>[C?[C+[ Ñ / FCv [L FÿCz< 1i F'C{YC|@C[C>[C@[CA[CB[CC[CD[CEëCFïCGï õ FCH CL[CM[DtosN[CO[DafP[CQ[CT[CV[CX[CY[-zâ C¥$C¦$C§$C:ïCH[EK[ FdnsI[ EJ[ E?[ Eb E^< E]Y E_@ E~ÿ C[E>[ E@[ EA[ EB[ EC[ ED[ EEë EFï EGï EH  EL[ EM[ FtosN[ EO[ FafP[ EQ[ ET[ EV[ EX[ EY[ % RU$ > $ > : ; I  I : ;  : ; I8  : ;  ( I !I/  : ;  : ;  : ; I : ; : ;I8 : ; &I : ; I8 I.? : ; ' I 4 : ; I.: ; ' 4: ; I.? : ;' I : ;I: ; I.? : ;' I 4 .? : ; ' 4  .1@!1"41#1X Y $1 % &41'1(.? : ; ' I@): ; I*4: ; I+.: ; ' @,: ; I-4: ; I . /4: ; I01X Y 11RUX Y 21RUX Y 3!I/4.? : ; ' @ 5.? : ; ' @64: ;I74: ;I 81X Y91RUX Y:1X Y;.? : ;' @<: ;I=4: ;I>4: ; I?4I4 @.? : ;' I@A UB41 C4: ; I? < D4: ; I? < E4: ; I?  F4: ; I?  ww ww UVVTSSP\ P\wwww wwww USPSUSPS\qv"Ÿqv"ŸRrŸRrŸRwwww°wwww°USSTTUVPV1Ÿ1ŸTTUt”8$8%-Ÿ t”8$8%ŸPVV Ÿ ŸW‘Ð{ŸW Ÿ0Ÿ0ŸTwwww w(w0w8wÀw8w0w(w wwwwÀw8w0w(w wwwwÀUVVVTSSS0ŸPP0Ÿ] Ÿ Ÿ Ÿwwww w w wwww U1ŸSS1ŸPPRP Ÿwwww w(w0w8wÐw8w0w(w wwwwÐU‘¼}T‘°}0Ÿ‘€Ÿ‘€Ÿ0Ÿ‘€Ÿ0ŸPP‘¸‘¸PPPqqP]]] VSVvS0ŸVVr3$w"€Ÿ€Ÿ€Ÿ Ÿ Ÿ Ÿ Ÿ0ŸV0Ÿ__w^^^P__Q‘À}ŸQ‘À}Ÿ‘À}Ÿ Ÿ__w^^^P__Q‘À}Ÿ‘À}Ÿ Ÿ Ÿ< u{Ûû /usr/include/x86_64-linux-gnu/bits/usr/include/usr/include/x86_64-linux-gnu/sys/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/netinet/usr/include/arpa.mtr.cstdio2.hstring3.hstdlib.hunistd.hstat.htypes.htime.hstddef.hstdint.hsocket.hsockaddr.hin.hnetdb.hstdio.hlibio.hctype.hfcntl.hstat.hmtr.hgetopt.hdisplay.hnameser.hnet.hgetopt.hasn.h ˆ„å;=2»vIuVZOž,žo.J?©‡fX$Ö ¯Ufä3XŸ» žƒ׬§ò]¿ƒn#Ÿ;=/Aº?<A<Ët¢S¶ºÊ<¶<¬€…È‘gw< <rèŸN›‚å~f0 h“ òŸŸÂŸÀf†fghGÛ}¬ú¬ŸºÖà. Xß.ggé»GäŸLfÍÖK;K;ƒjÈ÷}J‹žKŸ ÖŸWfÓJgŸ„ƒj.Ÿ½Ö9.Gž:fÚÈŸªf×@žŸ.»mÌŸî~‚.þ~º—.g¬}ÖÖžBÖåTŸNÖû.+ºŸaŸfŸÌ~f°.„JŸbÖŸîfÌŸšŸZf=‚üté£wäYY_ ‚ƒ<Ò}f¯XÑ}žªžÖ}žËžµ}ž‡žü‚°\V„Yœ¼Z-=WKŽ\ð|X”žŸŸtº û‚Î<B<B¼ÌZ"ÊÉ×;gVÀÍÛÖ.‚S‚Ys==®=—~Xéž—~ÖêX•|‚ûÈh;«vYƒ“þ{t½žÈ—¬é<—tífZË;‘I„~ X¨{ž†(ó{‚$N8„>uƒ8uií{¬žžÈCòòòr‚ºÎ{´žbtó$‚Å{òÄ(š|¬æ<š|@ H` R8k=  „ ‰™ ®³¸¿ÍÓÜâéðö!@]2òÿ <ÀHòÿZ Ádp{òÿ‡Ž•À( ­±¸ð¿ôÆÍÖÝä,îù((è0ø8<ìG RU_0lüx „p –¤ u©µ¼ÃÊÒÚáçöýòÿ €! *6BOY^en‡Ž•ž«´òÿÁÎÞìòÿ$1:CLT^hr}†‘›òÿmtr.cappend_to_namesnamesread_from_filelong_options.6409lock.6383lock.6391__PRETTY_FUNCTION__.6384__PRETTY_FUNCTION__.6392.LC7calloc__strdupstderr__fprintf_chkexittrimstrlen__ctype_b_locstdinclearerrfgetsferrorfclosefopen__errno_locationstrerror__stack_chk_failinit_fld_optionsfld_indexdata_fieldsavailable_optionsparse_arggetopt_longreportwideDisplayModeoptargstrchrfld_active__strcpy_chkdnsstrtolmaxTTLfstTTLstrtodWaitTimegetuidfwritePrintHelpenablemplsForceMaxPingMaxPingshow_ipsInterfaceAddresstimeoutmtrtypetosremoteportbitpatternafipinfo_noPrintVersioncpacketsizeInteractiveparse_mtr_optionsstrtokoptindmainnet_preopengetgidsetgidsetuidgeteuidgetegidgetpidsranddisplay_detectgetenvnet_selectsockettimeLocalHostnameHostnamegethostnamegetaddrinfogai_strerrornet_closefreeperrornet_opennet_set_interfaceaddressstdoutfileno__fxstatdisplay_opendns_opendisplay_modedisplay_loopnet_end_transitdisplay_closefcntl__printf_chkputs__assert_failnet_dropnet_lossnet_returnednet_xmitnet_lastnet_bestnet_avgnet_worstnet_stdevnet_gmeannet_jitternet_javgnet_jworstnet_jintaunspec_addr$üÿÿÿÿÿÿÿ4üÿÿÿÿÿÿÿ?4J4eüÿÿÿÿÿÿÿm y üÿÿÿÿÿÿÿƒ!üÿÿÿÿÿÿÿ˜#üÿÿÿÿÿÿÿ£$üÿÿÿÿÿÿÿ]%üÿÿÿÿÿÿÿb&üÿÿÿÿÿÿÿi%üÿÿÿÿÿÿÿt"üÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿœ(üÿÿÿÿÿÿÿ§%üÿÿÿÿÿÿÿ±)üÿÿÿÿÿÿÿÙ Þ*üÿÿÿÿÿÿÿë+üÿÿÿÿÿÿÿò,üÿÿÿÿÿÿÿý üÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿ-üÿÿÿÿÿÿÿ$+üÿÿÿÿÿÿÿ+,üÿÿÿÿÿÿÿ6 A /T /]0üÿÿÿÿÿÿÿh 00r 1 /— 1Ä  É  Ó3üÿÿÿÿÿÿÿë ò4øÿÿÿÿÿÿÿü5øÿÿÿÿÿÿÿ5øÿÿÿÿÿÿÿ#6üÿÿÿÿÿÿÿ+#üÿÿÿÿÿÿÿ[ 1`7üÿÿÿÿÿÿÿ… 8Š9üÿÿÿÿÿÿÿš:øÿÿÿÿÿÿÿ³6üÿÿÿÿÿÿÿ¿;üÿÿÿÿÿÿÿÌ<üÿÿÿÿÿÿÿØ<øÿÿÿÿÿÿÿç=üÿÿÿÿÿÿÿó=üÿÿÿÿÿÿÿ5øÿÿÿÿÿÿÿ6üÿÿÿÿÿÿÿ>üÿÿÿÿÿÿÿ0?üÿÿÿÿÿÿÿ;@üÿÿÿÿÿÿÿKüÿÿÿÿÿÿÿR?üÿÿÿÿÿÿÿ_üÿÿÿÿÿÿÿd xsAüÿÿÿÿÿÿÿ}!üÿÿÿÿÿÿÿŠBøÿÿÿÿÿÿÿ¢5øÿÿÿÿÿÿÿ³6üÿÿÿÿÿÿÿ¿;üÿÿÿÿÿÿÿÇ=üÿÿÿÿÿÿÿÍ<üÿÿÿÿÿÿÿ×=üÿÿÿÿÿÿÿç=øÿÿÿÿÿÿÿúCøÿÿÿÿÿÿÿ6üÿÿÿÿÿÿÿ;üÿÿÿÿÿÿÿ%Døÿÿÿÿÿÿÿ/EüÿÿÿÿÿÿÿBFøÿÿÿÿÿÿÿS6üÿÿÿÿÿÿÿZGüÿÿÿÿÿÿÿk6üÿÿÿÿÿÿÿw;üÿÿÿÿÿÿÿƒHüÿÿÿÿÿÿÿ’IûÿÿÿÿÿÿÿŸIøÿÿÿÿÿÿÿ³6üÿÿÿÿÿÿÿ¿;üÿÿÿÿÿÿÿÏJüÿÿÿÿÿÿÿã6üÿÿÿÿÿÿÿï;üÿÿÿÿÿÿÿõKüÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ TAüÿÿÿÿÿÿÿ(!üÿÿÿÿÿÿÿ36üÿÿÿÿÿÿÿJ5øÿÿÿÿÿÿÿc6üÿÿÿÿÿÿÿo;üÿÿÿÿÿÿÿ~Lüÿÿÿÿÿÿÿ’Møÿÿÿÿÿÿÿ¢Møÿÿÿÿÿÿÿ²NøÿÿÿÿÿÿÿÃ6üÿÿÿÿÿÿÿÏ;üÿÿÿÿÿÿÿÜNüÿÿÿÿÿÿÿê5øÿÿÿÿÿÿÿOøÿÿÿÿÿÿÿIûÿÿÿÿÿÿÿIøÿÿÿÿÿÿÿ25øÿÿÿÿÿÿÿC6üÿÿÿÿÿÿÿO;üÿÿÿÿÿÿÿUPüÿÿÿÿÿÿÿb5üÿÿÿÿÿÿÿqQøÿÿÿÿÿÿÿº<øÿÿÿÿÿÿÿÕüÿÿÿÿÿÿÿÚ 6ä üÿÿÿÿÿÿÿî!üÿÿÿÿÿÿÿõüÿÿÿÿÿÿÿý !  üÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ ¸.Aüÿÿÿÿÿÿÿ8!üÿÿÿÿÿÿÿ?üÿÿÿÿÿÿÿD PSAüÿÿÿÿÿÿÿ]!üÿÿÿÿÿÿÿ n‰ jŽSüÿÿÿÿÿÿÿ³ nÀSüÿÿÿÿÿÿÿÑüÿÿÿÿÿÿÿÙ àå üÿÿÿÿÿÿÿï2üÿÿÿÿÿÿÿõTøÿÿÿÿÿÿÿþ(y8@)H/Xzh8pKxPˆy˜U i¨m¸{ÈrЂØmè|ø†˜}(¤0¸8H~X½`ÐhxˆÔ阨€¸îÀÈØè ðø‚" 4(98ƒH@PTX9h„xY€iˆ9˜…¨n°…¸9Ȇ Š@’`—€ž ªÀ®àµ¹ ½@Á`ǀ͠ÖÀäàêõ ù@þ`€ À à)1 5@9`>€F KÀQàX ÀÀ À(À0À8À@ÀHÀPÀXÀ`ÀhÀp`xH€ÀˆÀ0˜À À¨À°À¸ÀÀÀÈÀÐÀØÀààè°ðÀøÀÀÀÀ À(À0h8À@ÀHÀPÀXÀ`ÀhPp@x€Àˆø°˜  ˆ¨°À¸ÀÀÈ°Ð˜Ø àèÀðúø@0ð è(À0°Vüÿÿÿÿÿÿÿ'Wüÿÿÿÿÿÿÿ.Xüÿÿÿÿÿÿÿ;@üÿÿÿÿÿÿÿBYüÿÿÿÿÿÿÿOZüÿÿÿÿÿÿÿV@üÿÿÿÿÿÿÿc[üÿÿÿÿÿÿÿjWüÿÿÿÿÿÿÿw\üÿÿÿÿÿÿÿ~]üÿÿÿÿÿÿÿ‹^üÿÿÿÿÿÿÿ.üÿÿÿÿÿÿÿ• qš_üÿÿÿÿÿÿÿ¢Rüÿÿÿÿÿÿÿ¯2üÿÿÿÿÿÿÿµTüÿÿÿÿÿÿÿÓTüÿÿÿÿÿÿÿØüÿÿÿÿÿÿÿÞTüÿÿÿÿÿÿÿé`üÿÿÿÿÿÿÿ÷OüÿÿÿÿÿÿÿBüÿÿÿÿÿÿÿ$aüÿÿÿÿÿÿÿ+4D †N b\cüÿÿÿÿÿÿÿadüÿÿÿÿÿÿÿ|Müÿÿÿÿÿÿÿƒcüÿÿÿÿÿÿÿ§eüÿÿÿÿÿÿÿ¿füÿÿÿÿÿÿÿÆüÿÿÿÿÿÿÿÎ §Ú üÿÿÿÿÿÿÿà5ûÿÿÿÿÿÿÿî4ü4güÿÿÿÿÿÿÿ hüÿÿÿÿÿÿÿ4hüÿÿÿÿÿÿÿdbobüÿÿÿÿÿÿÿÙMüÿÿÿÿÿÿÿëüÿÿÿÿÿÿÿú ÃÿAüÿÿÿÿÿÿÿ5ûÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿ! &iüÿÿÿÿÿÿÿUjüÿÿÿÿÿÿÿ`üÿÿÿÿÿÿÿo  tAüÿÿÿÿÿÿÿz5ûÿÿÿÿÿÿÿ«Güÿÿÿÿÿÿÿ°küÿÿÿÿÿÿÿ»üÿÿÿÿÿÿÿÊ HÏAüÿÿÿÿÿÿÿãlüÿÿÿÿÿÿÿú:@<H \üÿÿÿÿÿÿÿ)T.müÿÿÿÿÿÿÿBnüÿÿÿÿÿÿÿ_oüÿÿÿÿÿÿÿdpüÿÿÿÿÿÿÿjqøÿÿÿÿÿÿÿsrüÿÿÿÿÿÿÿxsüÿÿÿÿÿÿÿ€tüÿÿÿÿÿÿÿ‡lüÿÿÿÿÿÿÿžZ§`²\»hÄ\üÿÿÿÿÿÿÿÍtÒmüÿÿÿÿÿÿÿænüÿÿÿÿÿÿÿ5ûÿÿÿÿÿÿÿ @ uüÿÿÿÿÿÿÿ.+üÿÿÿÿÿÿÿ5,üÿÿÿÿÿÿÿ<üÿÿÿÿÿÿÿG åS üÿÿÿÿÿÿÿ_ `luüÿÿÿÿÿÿÿv+üÿÿÿÿÿÿÿ},üÿÿÿÿÿÿÿ„üÿÿÿÿÿÿÿ å› üÿÿÿÿÿÿÿ§üÿÿÿÿÿÿÿ¬ »AüÿÿÿÿÿÿÿÅ!üÿÿÿÿÿÿÿÓ ˆÝvüÿÿÿÿÿÿÿä!üÿÿÿÿÿÿÿé }îwüÿÿÿÿÿÿÿõ!üÿÿÿÿÿÿÿüüÿÿÿÿÿÿÿ XAüÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿ 8) Ý. ã3xüÿÿÿÿÿÿÿ8 =B ÝG ãLxüÿÿÿÿÿÿÿSüÿÿÿÿÿÿÿX 0gAüÿÿÿÿÿÿÿq!üÿÿÿÿÿÿÿ  9  C  ¶) - 4 ; • B rI P W r e »j ˆu  € «‹ ³– Q¡ ï ¬ -· ΠsÍ |Ú +å —ø ý š Í ' Ž*  8 ˜ I áP ÆU 7` k d v  î  “ —™ ¼Ÿ Ä¥ y« ±± R ·  ¿ ÛÇ øÒ sÞ 8ì R ü  h% ?+ & 1 X 7 = ÐC ¥I FO ,U I[ Za g m ss Æy u S … ù‹ ‘ Q— Ÿž õ¥ (¬ ܳ ¹º Á È áÐ * Û æ ò E  » L  Ò [ g K v 4‚ ~ Hž ‰¬ ³Ë B× Vå ‹ó ù  Ô Ø$ ü0 a> «L ¨Z Ðh gw …„ ³“ =¢ G±  À sÏ NÞ Oí   n L! ò0 s?  N õ] æl ¯ { Š ^™ é¨ A· –Æ ’Õ Øä ió m  È g  p0   @ ¦P ` #p ¨€ ¯ ¶  ½° ÄÀ Ð 4á è êô ° Ë •j ðq I x ¢ † † X Z•  O¥ $« ± á· =¾ 4 Ê ÍØ õ æ Žô Æ  3  < {+ Þ 9 #G þ U ^c Cq ¡ µ Ù› X© c· 5Å ÅÓ á 7 ¼ - & % Ü3 ÑX õ^ È d šj p  v ¯| +‚  ‰ | • Æ› V¡ c§ ˆ­ Ô³ ¹ k¿ Ò «ì ›ú   º $ æI Ý U & c  x í„ 5 –  ¡ m´ Á 2Ì Ü× & ê ‘ü Ö å  Ì D  Q •c î q ƒ î ’ ˜ Áª Á µ =  õÔ mâ |õ ¢ ½ ä Á ( e 8 @ ‡H U `^ ©g òp bx ‡Š b’ ‡© b± } Ö Sá é ñ i  u Ñ" á)  1 <9 ‡B 2L 9Q U[ ‚i Ën (} G… P’ ¼ ú§ ¬ G´ P½ : Ç LÌ ½ Ö •Ý på ƒò & ü ⃓! * ;3 w=öE T Ãck 0x¡ | ¨@°È ïÏ + Ö Þaæ :ï bù - þ Œ ‰  å % / * 67 D|L˜` S i v s°{ p‘™³°»ÅÕÝ  óhû{°Ã7à?óY`as{ÀƒÓ@¥Y¿ÒÇèÛ ¢ êòò  Î  'p/ 7 ú @ kK Ô P b[ ÷ ` Œy U ‚ÎŠéš ± ¶ #à 2ì #÷ e # Ö ( 2Q #\ ee Ö  õ • u Ý ¦ b± /¶ ŒÁ gÆ  Ñ ŸÖ Åá -æ & c    ^ & ,A æQ  a .f q Šv À~ Ü‹ & – O  H¨ и yÁ ÈË ÃÓ Þç ,ò ú 8 Ü X ë$ 4 £= ÙB PK 7_@n 8{ 2ƒ  ’ €› 7¥ 9­ и øÉ Ñ á $ê Zï Pø ¸ ` =( Ö0  ? H ¸R Z Ðe Pv Í~ Ꭰ|« ¦¸ ¨ Å k Ò u ß Jì ã  é ¯ 0 €M Òj  w *„ .‘ bž ‚« Ô¸ ÆÅ @Ò \ß ùî Có !   @* ? 7 €Q j Þw ¬„ ²‘ êž ;« Ý ·8À ¦Í ¨ Ú k ç u ô J ã C$:- é:FC ¯ PqY €f0o Ò|/…  ’8› *¨1± ‘¾‡Ç .Ô bá5ê ‚÷Q Ô O Æ#B, @9EB \ODX ùe?n !{c„  ‘Gš @§b° ? ½PÆ €ÓLéJò ÿ4M Þ*I3 ¬@=I ²V<_ êlKu ;‚Ha(a0b<bD‡`h#s#{S†bއ©±¼ÄGÏbׇò.ú77 ]] b+83b;xFxN‡iq’}’…“‘“™”¥”­¹ÁÍÕáéõý!›,›4?GRZu}›ˆ›õ›õ£®¶ÑŸÙ¢äµìÔüÔÙÙõ'õ/ÿ<ÿD OWdl‡ !›!£"¯"·/Ã/ËÏØÏàÐìÐôÑÑØØ<9 A(L(TÐ_Òg<‚ Še•ÒݨݰáËoÓÑÞèæîñîù<GZ(Ò0LGTZ_ÒgÝrÝzá•GPµP½Zâxê‚o Ñ <;oCÒQY<woÏŠÏ’Ò ¨<ÃüËÖï@÷EZ n|’: B¢N¢V¤b¤j¦v¦~¨Š¨’¯ž¯¦²²²º¹Æ¹Î}Û}ã~ï~÷ ƒ+ƒ3…?…G‡S‡[ˆgˆo›|›„œœ˜¤¬Ÿ¸ŸÀ¡Ì¡Ô£à£è¥ô¥ü° ° a-  5 ¹@ ¹H S ˆ[ f ¦n a‰  ‘ ¹œ ¹¤ ~¯ ˆ· œ ¦Ê aå  í ¹ù × ã ^ f/ 97 NS |[ “v |~ “‰ 8¢ ̪ òµ 6Î òÖ á !ú p r r s" s* t6 t> {J {R  _  g  s  {  ‡   ›  £  ¯  ·  Ô pÜ ‘÷ ÿ £ £ ­ ²& é1  9  U ’] Ãh Äp ä{ äƒ èŽ  –  ± ι éÄ àÝ  å  ñ  ù        !  -  5  A  I  U  ]  i  q  D~  D†  G’  Gš  H¦  H®  Jº  J  LÎ  LÖ  Nâ  Nê  Pö  Pþ  X  X u/ 7 B J ug o z ‚ uŸ § >³ x» É /Ñ ¤ß ¤ç ó û P  P u- 5 *@ ¤H ¾c >k ¤x € P «¥ ° x¸ °Ã Ë )æ ‡î ¢  / @. 26 5A 5I LT Q\ ¤g o PŠ 2’ >8¥ >­ ¸ À Ë Ó (Þ (æ 7ò 7ú = =  Q Q! ¤, 4 PO ÎW Ûy ` Ž Q– ¤£ « PÈ `Ð Ûbä Qì ¤÷b  Pb, Ã4 Þ?§X ` l t 8 8‡ =£ #« A¶ ¾ 7Ù ñá #î #ö •   \  77 A? EJ ER ‹] e \€ Aˆ E“ E› Û© Û± é¼ éÄ ¤Ò 7Ú Pø C \ å$ Ç, å7 7? PZ •b Ço Çw ‚ \Š ¤• 7 P¸ åÀ éË éÓ Þ \æ ¤ å  é é * \2 ¤P ‹X ¤cå| É„ èˆ   öùü08@/H2P5X<p°xÀȈʠ¨#°-¸3Ð HØ Rà `è e ë î ñ ^  ( \0 8 7P ëX î` ñh ^p x \€ ˆ 7  2¨ >° A¸ FÐ 9Ø @à Cè \  ’ • þ  \( ¤0 78 PP X ’` •h þp \x ¤€ 7ˆ P  Ö¨ â° å¸ êÐ Ø ˆà ‹è ¤   uè Dt  @´ pL mtr-0.85/COPYING0000664000175000017500000004312712104136661012330 0ustar wolffwolff GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. GNU GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) 19yy This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19yy name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. , 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. mtr-0.85/install-sh0000755000175000017500000003253712104737110013276 0ustar wolffwolff#!/bin/sh # install - install a program, script, or datafile scriptversion=2009-04-28.21; # UTC # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit=${DOITPROG-} if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. chgrpprog=${CHGRPPROG-chgrp} chmodprog=${CHMODPROG-chmod} chownprog=${CHOWNPROG-chown} cmpprog=${CMPPROG-cmp} cpprog=${CPPROG-cp} mkdirprog=${MKDIRPROG-mkdir} mvprog=${MVPROG-mv} rmprog=${RMPROG-rm} stripprog=${STRIPPROG-strip} posix_glob='?' initialize_posix_glob=' test "$posix_glob" != "?" || { if (set -f) 2>/dev/null; then posix_glob= else posix_glob=: fi } ' posix_mkdir= # Desired mode of installed file. mode=0755 chgrpcmd= chmodcmd=$chmodprog chowncmd= mvcmd=$mvprog rmcmd="$rmprog -f" stripcmd= src= dst= dir_arg= dst_arg= copy_on_change=false no_target_directory= usage="\ Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: --help display this help and exit. --version display version info and exit. -c (ignored) -C install only if different (preserve the last data modification time) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) ;; -C) copy_on_change=true;; -d) dir_arg=true;; -g) chgrpcmd="$chgrpprog $2" shift;; --help) echo "$usage"; exit $?;; -m) mode=$2 case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac shift;; -o) chowncmd="$chownprog $2" shift;; -s) stripcmd=$stripprog;; -t) dst_arg=$2 shift;; -T) no_target_directory=true;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac shift done if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dst_arg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dst_arg" shift # fnord fi shift # arg dst_arg=$arg done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call `install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then trap '(exit $?); exit' 1 2 13 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names starting with `-'. case $src in -*) src=./$src;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dst_arg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dst_arg # Protect names starting with `-'. case $dst in -*) dst=./$dst;; esac # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dst_arg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writeable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix='/';; -*) prefix='./';; *) prefix='';; esac eval "$initialize_posix_glob" oIFS=$IFS IFS=/ $posix_glob set -f set fnord $dstdir shift $posix_glob set +f IFS=$oIFS prefixes= for d do test -z "$d" && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # If -C, don't bother to copy if it wouldn't change the file. if $copy_on_change && old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && eval "$initialize_posix_glob" && $posix_glob set -f && set X $old && old=:$2:$4:$5:$6 && set X $new && new=:$2:$4:$5:$6 && $posix_glob set +f && test "$old" = "$new" && $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 then rm -f "$dsttmp" else # Rename the file to the real destination. $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. { # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { test ! -f "$dst" || $doit $rmcmd -f "$dst" 2>/dev/null || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; } } || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } fi || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: mtr-0.85/config.h0000664000175000017500000001075512162522231012710 0ustar wolffwolff/* config.h. Generated from config.h.in by configure. */ /* config.h.in. Generated from configure.ac by autoheader. */ /* Define to enable IPv6 */ #define ENABLE_IPV6 /**/ /* Define to 1 if you have the header file. */ #define HAVE_ARPA_NAMESER_COMPAT_H 1 /* Define to 1 if you have the `attron' function. */ #define HAVE_ATTRON 1 /* Define to 1 if you have the header file. */ /* #undef HAVE_CURSESX_H */ /* Define to 1 if you have the header file. */ #define HAVE_CURSES_H 1 /* Define to 1 if you have the declaration of `errno', and to 0 if you don't. */ #define HAVE_DECL_ERRNO 1 /* Define to 1 if you have the `fcntl' function. */ #define HAVE_FCNTL 1 /* Define to 1 if you have the header file. */ #define HAVE_FCNTL_H 1 /* Define to 1 if you have the header file. */ #define HAVE_INTTYPES_H 1 /* Define to 1 if you have the `curses' library (-lcurses). */ /* #undef HAVE_LIBCURSES */ /* Define to 1 if you have the `cursesX' library (-lcursesX). */ /* #undef HAVE_LIBCURSESX */ /* Define to 1 if you have the `m' library (-lm). */ #define HAVE_LIBM 1 /* Define to 1 if you have the `ncurses' library (-lncurses). */ /* #undef HAVE_LIBNCURSES */ /* Define to 1 if you have the `nsl' library (-lnsl). */ /* #undef HAVE_LIBNSL */ /* Define to 1 if you have the `socket' library (-lsocket). */ /* #undef HAVE_LIBSOCKET */ /* Define to 1 if you have the `termcap' library (-ltermcap). */ #define HAVE_LIBTERMCAP 1 /* Define to 1 if you have the `tinfo' library (-ltinfo). */ #define HAVE_LIBTINFO 1 /* Define to 1 if you have the header file. */ #define HAVE_MEMORY_H 1 /* Define to 1 if you have the header file. */ /* #undef HAVE_NCURSES_CURSES_H */ /* Define to 1 if you have the header file. */ #define HAVE_NCURSES_H 1 /* Define to 1 if you have the `seteuid' function. */ #define HAVE_SETEUID 1 /* Define to 1 if you have the header file. */ /* #undef HAVE_SOCKET_H */ /* Define if your system has socklen_t */ #define HAVE_SOCKLEN_T /**/ /* Define to 1 if you have the header file. */ #define HAVE_STDINT_H 1 /* Define to 1 if you have the header file. */ #define HAVE_STDLIB_H 1 /* Define to 1 if you have the header file. */ #define HAVE_STRINGS_H 1 /* Define to 1 if you have the header file. */ #define HAVE_STRING_H 1 /* Define if you have struct in_addr */ #define HAVE_STRUCT_INADDR /**/ /* Define to 1 if you have the header file. */ #define HAVE_SYS_SOCKET_H 1 /* Define to 1 if you have the header file. */ #define HAVE_SYS_STAT_H 1 /* Define to 1 if you have the header file. */ #define HAVE_SYS_TYPES_H 1 /* Define to 1 if you have the header file. */ /* #undef HAVE_SYS_XTI_H */ /* Define to 1 if you have the header file. */ #define HAVE_UNISTD_H 1 /* Define if struct __res_state_ext needs to be defined. */ /* #undef NEED_RES_STATE_EXT */ /* Define if you don't have the curses libraries available. */ /* #undef NO_CURSES */ /* Define if you don't have the glib libraries available. */ /* #undef NO_GLIB */ /* Define if you don't have the GTK+ libraries available. */ /* #undef NO_GTK */ /* Define if you don't have the herror() function available. */ /* #undef NO_HERROR */ /* Define to disable ipinfo lookup */ /* #undef NO_IPINFO */ /* Define if you don't have the strerror() function available. */ /* #undef NO_STRERROR */ /* Name of package */ #define PACKAGE "mtr" /* Define to the address where bug reports for this package should be sent. */ #define PACKAGE_BUGREPORT "" /* Define to the full name of this package. */ #define PACKAGE_NAME "mtr" /* Define to the full name and version of this package. */ #define PACKAGE_STRING "mtr 0.85" /* Define to the one symbol short name of this package. */ #define PACKAGE_TARNAME "mtr" /* Define to the home page for this package. */ #define PACKAGE_URL "" /* Define to the version of this package. */ #define PACKAGE_VERSION "0.85" /* The size of `unsigned char', as computed by sizeof. */ #define SIZEOF_UNSIGNED_CHAR 1 /* The size of `unsigned int', as computed by sizeof. */ #define SIZEOF_UNSIGNED_INT 4 /* The size of `unsigned long', as computed by sizeof. */ #define SIZEOF_UNSIGNED_LONG 8 /* The size of `unsigned short', as computed by sizeof. */ #define SIZEOF_UNSIGNED_SHORT 2 /* Define to 1 if you have the ANSI C header files. */ #define STDC_HEADERS 1 /* Version number of package */ #define VERSION "0.85" mtr-0.85/dns.h0000664000175000017500000000305512117043154012224 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include /* Prototypes for dns.c */ void dns_open(void); int dns_waitfd(void); void dns_ack(void); #ifdef ENABLE_IPV6 int dns_waitfd6(void); void dns_ack6(void); #ifdef NEED_RES_STATE_EXT /* __res_state_ext is missing on many (most?) BSD systems */ struct __res_state_ext { union res_sockaddr_union nsaddrs[MAXNS]; struct sort_list { int af; union { struct in_addr ina; struct in6_addr in6a; } addr, mask; } sort_list[MAXRESOLVSORT]; char nsuffix[64]; char nsuffix2[64]; }; #endif #endif void dns_events(double *sinterval); char *dns_lookup(ip_t * address); char *dns_lookup2(ip_t * address); struct hostent * dns_forward(const char *name); char *strlongip(ip_t * ip); void addr2ip6arpa( ip_t * ip, char * buf ); struct hostent *addr2host( const char *addr, int type ); mtr-0.85/hello.c0000664000175000017500000000020312104136661012530 0ustar wolffwolff#include typedef int socklen_t; socklen_t main (int argc, char **argv) { printf ("hello world. \n"); return 2; } mtr-0.85/curses.o0000664000175000017500000015512012162522442012756 0ustar wolffwolffELF>p@@UH‰ýSHƒìH‹H…Àt[¿P¿XƒÂƒÃ‰H‰ïè)ÉØÁèÃÑû…Û~ƒëD1À¿ƒëèƒûÿuìHƒÄH‰ï1À[]é@Çÿÿÿÿ»ÿÿÿÿë¨ffffff.„H‰\$àH‰l$è»L‰d$ðL‰l$øHƒìXH‹=dH‹%(H‰D$(1Àèƒøq‰Åt0ƒøt+ƒø ³t$ƒø³tD¥€Aüv=ƒý uP»H‹T$(dH3%(‰Ø…µH‹\$8H‹l$@L‹d$HL‹l$PHƒÄXÃèH‹HcÕƒ¿1ÀèHƒÃL9ãt%‹|ƒÿþt=ƒÿÿtHƒ=tÇHƒÃèL9ãuÛ[]A\Ã@¿1Àèë»f.„¿1Àèë£fH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ èéjÿÿÿf„AWA‰ÿAVA‰öAUATUSHƒìè‹A‰Å9Ø›é!è…À…#L‰çèH…À„5H‰Æ¿1ÀèH‹=1Ò¾ èH‹=¾ÿÿÿÿ‰ðH…ÿt¿7¿GD‰ú‰è¿1ÀèD‰ö‰ßè1À¿èD9턉ëk¿1À‰îè‰ßèH…ÀI‰ÄtS‰ßè…Àt0‹¾L‰çè…À…%ÿÿÿ¿1ÀèéAÿÿÿ@H‹=1Ò¾ èë»1À¿èD9í…vÿÿÿHƒÄ[]A\A]A^A_ÃL‰çèH‰Ç1ÀèL‰çèH…À…ËþÿÿL‰çèé¾þÿÿAUATUSHìˆH‹=dH‹%(H‰„$x1ÀèH‹=H…ÿ„L¿G¿_ƒÀDkƒë‰1Ò1öèH‹=1Ò¾ è¿èH‹=1Ò¾ èè¹I‰À1öº¿1ÀèH|$èH|$è‰ÞH‰Â¿1Àè¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è1À¿èD‹E…Ò…L»E1ä@¶‹……ÀxcH˜H¼$`¹H,@º¾1ÀHÁåD‹…èHD$L‹…IcüHŒ$`HÇÂÿÿÿÿ¾HÇ1ÀèD¥HƒÃHûu‚H‹=1Ò¾ E)åAƒíèº1ö¿1ÀèHL$ºD‰î¿1ÀèºD‰î¿1ÀèH‹=1Ò¾ èH‹=1Ò¾èD‰ïèH‹=èH‹„$xdH3%(…_HĈ[]A\A]Ãf„è…À…%½ºæ¹D‰è»ÈH¼$)ÈA9Õ¹NغP¾A‰Ø1ÀèH”$‰î¿1ÀèH‹=1Ò¾ èH‹=1Ò¾èè‰Þ‰ï1Ûè¿1À½ÓMbèH‹=1Ò¾ è¿1ÀèH‹=1Ò¾ è@‹ ¾³¿HƒÃ‰ÈÁù÷í1ÀÁú)ÊèHƒûuÐé±þÿÿÇÿÿÿÿ»æÿÿÿA½ÿÿÿÿé²ûÿÿèHæhéÔþÿÿèHƒìèèèHƒÄé@Hƒì¿1ÀèHƒÄé€HƒìèHƒÄé Change Packet Size: %d %cPing Bit Pattern: %d Type of Service(tos): %d Interval : %0.0f First TTL: %d Max TTL: %d Fields: %s %s Command: ?|h help n toggle DNS on/off r reset all counters y switching IP info press any key to go back...%2d. %s (%s)%s ???.123abc>>?.??? My traceroute [v0.85]Keys: Help Display mode Restart statistics Order of fields quit %%%ds Host Last %3d pingsScale: %c:%d msSize Range: %d-%d, < 0:random. Pattern Range: 0(0x00)-255(0xff), <0 random. default 0x00, min cost 0x02, rel 0x04,, thr 0x08, low del 0x10... p pause (SPACE to resume) d switching display mode e toggle MPLS information on/off o str set the columns to display, default str='LRS N BAWV' j toggle latency(LS NABWV)/jitter(DR AGJMXI) stats c report cycle n, default n=infinite i set the ping interval to n seconds, default n=1 f set the initial time-to-live(ttl), default n=1 m set the max time-to-live, default n= # of hops s set the packet size to n or random(n<0) b set ping bit pattern to c(0..255) or random(c<0) Q set ping packet's TOS to t u switch between ICMP ECHO and UDP datagrams z toggle ASN info on/off [MPLS: Lbl %lu Exp %u S %u TTL %u] Packets Pings{®Gáz”?š™™™™™©?{®Gáz´?333333Ã?…ëQ¸Õ?à?š™™™™™é?ð?€?@@¥Ô8intSX{Ž{•{XFL˜XÚ 8 1_ 2? 4f  !À         ! ) + , . / 2 3 : ; < Ü â ç ì „ ˆ ÿ €  Èê Êê Ìú Í Úú 8å  8ð 8 Æ5 ÏÀ# 8Ø   F# ¥# ¥# ¥# ¥#  ¥#( ¥#0 ¥#8 ¥#@ ¥#H ¥#P ¥#X "K#` $Q#h &F#p *F#t ,‚#x 0?#€ 1m#‚ 2W#ƒ 6g#ˆ ?# H£#˜ I£#  J£#¨ K£#° L-#¸ NF#À Pm#Ä ´ ºK »K# ¼Q# ÀF#@Xg 8 X} 8 U‰` †, ˆt# ˆt# ‹t# ‹t# Œt# Œt#  Žt#  ‘,# ’5# • #  – #! — #" ˜ ## ™ #$ š #% › #& œ #'  #( žF#,  ­#0 £t#8 ¤t#: §F#< ¨F#@ ©³#H ±8#P ³t#\ W5 ¬  ®t# ®t# ¯t# ¯t# °t# °t# §} _ 8 &         0m‡keyn‡#oM#pM#qM#rF# s—#(_F—Œ`î‚î#expƒþ#@ttl„þ#Hs…Ê#P†X#X8þ 8¹ 8bK      ¿Fi__c¿FF‰M©©MgFÐgMg¥úg¥gM F% __s ¥ MVo strV¥!XF"cxYF#cF§ "ceF"ifF"fg§ $bufh® ‘°% &pF'Kp(]%6 &tF'Kt(])| &‡F*K‡(])¾ &²F*K²+],‰¼ß (œ,iÎ (|,i¬! (|,iÞB (|,ižc (|,i‘„ (|-.!FX¾ 8/C 0CF1maxEF1atFF.G .G .H .H 1yIF.J¥1iLF1jLF1kLF.MF2bufN ‘°w3úuÞ + ( 4úx+ ( ÄX 58ÿ/²¤ .´«1i´F1max´F1at´F6µF””Ÿ7Ówã 8msÓF1iÕF/áC8atáF0áF.ã«1iäF/ýÓ0ýF0ýF1maxÿF1atÿF1yÿF. .¥/%/.'F.(F.)F2t*¸‘Øv9i,F1j,F.-F2buf. ‘àv2fmt//‘°3ú[¦( ( 3ú\Ñ( ( :2msgi?‘à~.jF.oF4úr( ( X? 8XO 8O;‰;“;š<¥Q<¦Q= N³< =F< ?F<+F<,F& 8<vF-><z"_E><{:X]><|R<~Ä<JR<KF<LF<MF<NF?tosOF<P§ ?afQF<RF@TF © 86®& F; 86¯+ 6°F 6°F AщM<¥Q<¦Q= N³< =F< ?F<+F<,F<v<z"<{:<|RB~Ä <JR<KF<LF<MF<NF?tosOF<P§ ?afQF<RF% : ; I$ > $ >  I&I I !I/  : ;  (  : ;  : ; I : ;  : ; I8  : ; : ;I8 : ; : ;I<  : ; I8 I : ; .? : ; ' I : ; I.? : ;' I : ;I.? : ; ' I 4 : ; I.? : ; ' @ : ; I!4: ; I"4: ; I#.? : ; ' I@$4: ; I % U&4: ; I'1RUX Y (1) *1X Y +1,1RUX Y - .4: ;I/.? : ;' @0: ;I14: ;I24: ;I 31RUX Y41RUX Y5!I/64: ;I 7.? : ;' @ 8: ;I94: ;I: U;.? : ;' @<4: ; I? < =4: ;I? < >!?4: ; I? < @4: ; I A4: ;IB4: ; I?  ww w `w `fwfgwgpwpw ,U,gVgkUlU<CsŸCRSRWsŸW\S­w­.wà.0w0q wàÎóPóýV/4P4ÇVÇÌSÌõ|€ŸõPH\]aPaËVÕïPï3\3RVRWSW€|€Ÿ€œPœÓ\èïPïV S F|€ŸFbPb™\®ÔPÔô\ôV?|€ŸTvPv¯\¯ÎPÎï\ï P 1\1»V»ÕPÕ/V/Æ|€ŸÛýPý6\6LVLQSQ˜|€Ÿ˜´P´ë\ # P# D \D c Pc o \v ® V® q |€ŸÎý0Ÿ/õ0ŸõDVRaVaË0ŸÕ3V3€0Ÿ€ÏVÝïVïF0ŸF•V£ÕVô?0ŸI©V¯ V1T0Ÿª/S/Æ0ŸÐ0V6˜0Ÿ˜çVõo Vv S® q 0ŸÎýž/ËžÕôžô a3q ž58v $ &2$p"8C v $ &2$p"ãóPóýV/4P4ÇVÇÌSÌõ|€ŸaËV3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVLQSQ˜|€Ÿv q |€Ÿ{ËPMÇVÇÌSÌõ|€ŸaËV3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVLQSQ˜|€Ÿv q |€Ÿ}œPïPq…P6JPdÇVÇÌSÌõ|€Ÿ3RVRWSW€|€ŸïV S F|€ŸôV?|€Ÿ1ªVªÆ|€Ÿ6LVv q |€Ÿ£ÅP3PPôP1MP/FPÍ ý P  PG M PéëSëïUï3‘°ŸÎÐSÐÔUÔô‘°ŸÈÊSÊÎUÎï‘°Ÿ,S,1‘°Ÿ  S # U# D ‘°Ÿ] _ S_ c Uc o ‘°Ÿï Ü DŸÜ FŸ€ ‚ w‚ „ w„ † w† ˆ w ˆ ‰ w(‰ Š w0Š ‘ w8‘ wðŽw8Žw0‘w(‘“w “•w•—w—˜w˜wð€ ¬ U¬ ‘¬w± µ Pµ ‘¨wÀ L_Ld‘¤wd`‘¤w”1Ÿ  P û ]dv]è`]û ]8<P<<]vè]ö ú Pú `‘˜wû S"&P&ÕSvèS¤ ¨ T+ / P/ · SjnPnÚVvèVè`S¿ Á 0Ÿ^2<^Á V$ I p2$I ‰ V­ ± 0Ÿ± á Sê û SÁÜ0ŸÜòVV¿ Á 0Ÿ  \‰ û \Ì ý | $ &‘" PŸf ‰ | $ &‘" PŸ ¡w¡¢w¢¦w¦ªw ª«w«¬w¬­w'iPºÄ0ŸÄÎ1ŸÎØ2ŸØâ3Ÿâì4Ÿìö5Ÿö6Ÿ 7Ÿ 8Ÿ'50Ÿo0ŸP¬V«S°ÐU×èU°²0Ÿwww€w €wƒwƒˆwˆçw  U T !S 4P4Qðòwò÷w÷üwüþw þÿw(ÿw0w8DwÀDEw8EFw0FHw(HJw JLwLNwNPwP€wÀðUN_O€_ðTL^O€^PJ]O€]ªSªµVµ4S4=VO€SvzTµ\ÓÛPÛ=\O€\5>PjzP€‚w‚„w„…w…†w †w(àw° àáw(áâw âäwäæwæðwð=w° Ô?]ç]"8])•VÔ5Ÿ"=5ŸºÝP§¬0Ÿ!¶\ç80Ÿ¾! Ÿ¾!‘°Ÿí!‘°Ÿí!| $ &‘"  Ÿç NŸ &R"*NŸ*8R)„S„ˆT) Ÿ)<U<E‘à~ŸERQR‘à~Ÿ@DwDWwW\w`dwdtwtyw€„w„w’w,’ãó0;ãó0;MZhsx{MZhsx{Ûàëð»ÀÃÈÐÕµº½ÂÊÏõ÷ú      $ J M P W _ j Ð Ô Ü è ë ð ø ý _ c n z } ÀÍÑÝáíòùüð"8!&)=ïVû /usr/include/usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/netinet/usr/include/arpacurses.cctype.hstdlib.hstring3.hstdio2.hstddef.htypes.htime.hstdint.hin.hncurses.hlibio.hmtr.hdisplay.hnet.hstdio.hnameser.h Ö”º=/Jƒs=W[IY-Œ ä¥yX×só]730Z=-0=-Ñ.±òYÍ‚0¯¬ÊÏXCÈ=W».‚.Ff q¬‘…qYY».ŸA€v: X´¬ÌX³<’=-h=-h=-i=-h=-i=-¾òö~Xãf¡X”Û.£XL».„v‘?qYY».ŸA€v:Z @pY/Y».ŸA€v:" Õf¯XÑ<¯XiÎ.²X‚»hZ‘…+YY»v:ŸALž÷fXó<Xkî.XWgg+äÅf¿.Á<¿‚ÁfBXghw‘“»ð”x8YY½f‘K@ ò‘é~tœ.ä~.,º†*Y/Y»v:ŸAmž@pYÉY».ŸA€v: ä…fÿ~X<ÿ~Xiþ.XWgfmä’fò~<Ž<ò~thŒ.ô~¬‹XÌ~t‘ä…,î~¬<œä~.žº  Xa.’/»»»»»»»»»»»»»»» tv.Z»½»0»XX…¤)Z¡,mX…¤)8< f’×Yƒ;YZð>ÉŸ;=ËÙ‘ò±0.uIg[9ÖI­}JÓJ­}‚Óº­}<ÓX­}‚ÙXq<”Ÿ[$€jª}JÖJª}¬Öºª}<Ü.W=sg„¬½Mz"º ž×­e=YÕ=‘ ƒ;=ɼˑÖ•tœ>¬!s=W“jÖJjXÖªºÓ¬utp"”vºOäp>”w#Ðt/-jŸ¡PYe/‘v¾‹Ž>¸ JvÕi¤†‘HlF äJ2YzäȃqJY’]—qXyvtô/»òAZd> Ö˃ç0.u;gZ»Ÿeº/u;=3®¦wJoµºqò"ƒÈ Ètt .Yòx‘/Ÿ0䟠»>>>>>òOX3tŸLÇ{.¹ÈÇ{J¹ºÇ{JººÆ{XºtÆ{<º<Æ{<»tz¬˜ØrY/ƒ=0/‚»f.d]³{‚Í‚³{XÍX³{<Ñ<Z/0YO)ZzzXY/»i*³Ö:X†KYY[I•K¼I¿KZIprintf__off_tscale_IO_read_ptrActionClear_chain_idlokns_s_ns__in6_usize_tIPPROTO_MTPfactorsIPPROTO_PIM_shortbufIPPROTO_ICMPActionResetIPPROTO_DCCP_pad_bottomIPPROTO_TPpdat_immed_IO_read_base_IO_buf_baseIPPROTO_ENCAPIPPROTO_IGMPaddr__src_pad_x_pad_yhd_lenlong long intsigned charlong long unsigned intmtr_curses_open_filenocurses.c_use_keypad__u6_addr16chtypelong int_attrsIPPROTO_NONE_IO_buf_enduint8ActionASActionQuitshort intenablemplsuint16_tsprintf_old_offset_offsetattr_tActionIIdata_fieldsshow_ipsActionNonelow_msns_s_pr_win_st_sync_regtopns_s_anIPPROTO_COMPmtr_curses_redrawns_s_ar_IO_markerstdinnet_xxxunsigned int__unused_int_curx_curyIPPROTO_ESPfld_indexstdscr_IO_write_ptrnameunspec_addr_sbufIPPROTO_ICMPV6IPPROTO_SCTPIPPROTO_FRAGMENTshort unsigned intns_s_qdip_t_pos_IO_FILE_IO_save_basetolowerWINDOWActionScrollDownmaxTTLstrcpylabel_lock_flags2_modestdout_scrollmtr_curses_graphActionDNSmtr_curses_closeActionMPLSmplslenIPPROTO_UDPmtr_fill_graph_IO_read_endldat__ns_sectsavedWaitTime_regbottommtr_curses_keyactionmtr_gen_scaledisplay_mode_parx_pary_IO_write_endActionScrollUptitle__destblock_mapIPPROTO_MAXaddrs_IO_lock_t_pad_top/home/wolff/mtrIPPROTO_RSVP_leaveoktime_t__nptrbitpatternrangestartstatns_s_znIPPROTO_IPV6__resActionPause_markershigh_ms_parentIPPROTO_PUPatofatoi_Booldescrunsigned charIPPROTO_RAW_maxx_maxyIPPROTO_IDPmplspwcenter_vtable_offsetformatdisplay_offsetmtr_curses_hostsin6_addr_idcok_padfstTTLuint32_tIPPROTO_HOPOPTSGNU C 4.6.1_notimeoutIPPROTO_UDPLITElong unsigned int_pad_rightmax_colscharIPPROTO_EGP_bkgdmplss__u6_addr8uint8_tns_s_max_clear_nextmtr_print_scaled__off64_t_cur_columnActionResume_IO_save_end_yoffset__fmtIPPROTO_GRElength__pad1__pad2__pad3__pad4__pad5LocalHostname__time_tmtrtype_unused2rowstatlabels_flags_begx_begyIPPROTO_TCP_IO_backup_basepaddingavailable_optionsfloatns_s_udmtr_curses_clearIPPROTO_AHIPPROTO_ROUTINGfieldsIPPROTO_IPIP_pad_leftActionDisplaycols__u6_addr32_delay_linemaxxcpacketsizefld_active_IO_write_basedoublepressanykey_rowIPPROTO_DSTOPTSIPPROTO_IPGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx (A†DƒD W FAI Há O†ƒN`Œ B LlBBŽB B(ŒA0†A8ƒGðü 8A0A(B BBBA (¼ A†AƒD AAèF,üçBŒA†A ƒ| ABE H,BEŽE B(ŒA0†A8ƒD@@ 8A0A(B BBBB <x½BBŒA †A(ƒG° S (A ABBJ ¸DSÐDPèDI.symtab.strtab.shstrtab.rela.text.data.bss.rodata.str1.1.rodata.str1.8.rodata.rodata.cst4.rodata.cst8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @’ȃà.&Ô,à@ 12àê@2ÐÏO @ Wàdèvð©q¨²(& ‚™3••.7n!ÐØ0 ¥œX0 Ù0´ÌXÐÇœ\óÂ0ÙÓ0dËÞ0Zm+ç…müˆm÷HÙˆow  ¨€ñÿ & ,@    4: @IPW^á szŽ— ¦¯¸ÂÓÚáèìóú#*0;GOV^€ owŽ— £òÿ¯·ÂÉÔÝçõÿ )  7G°FXçgtð…€½—ž¬º¿ÅÑ@áéíô` €curses.c__unused_intlow_mshigh_msscalefactors.LC10.LC39pwcenterstdscrstrlenprintwmtr_curses_keyactionwgetch__ctype_tolower_locWaitTimemvprintwwmovewrefreshwattr_onwattr_off__stack_chk_failstrtodgetuidfstTTLtosstrtolmaxTTLfld_activedata_fieldsavailable_optionsstrchrindexbitpatterncpacketsizeputcharstrcpymtrtypemtr_curses_hostsnet_maxnet_mindisplay_offsetnet_addrnet_mplsafunspec_addraddrcmpdns_lookupnet_upis_printiishow_ipsstrlongip__sprintf_chkfld_indexenablemplsnet_addrsnet_mplssfmt_ipinfomtr_gen_scalenet_saved_pingsmtr_print_scaledmtr_fill_graphdisplay_modemtr_curses_graphmtr_curses_redrawwerasenet_localaddrLocalHostnametimectimeget_iiwidthmtr_curses_openinitscrrawnoechomtr_curses_closeendwinmtr_curses_clear üÿÿÿÿÿÿÿ%üÿÿÿÿÿÿÿ-üÿÿÿÿÿÿÿK Süÿÿÿÿÿÿÿrøÿÿÿÿÿÿÿ°üÿÿÿÿÿÿÿÅ üÿÿÿÿÿÿÿ1!üÿÿÿÿÿÿÿp!üÿÿÿÿÿÿÿ™!üÿÿÿÿÿÿÿ°"üÿÿÿÿÿÿÿµ MÍ#üÿÿÿÿÿÿÿÔüÿÿÿÿÿÿÿã$üÿÿÿÿÿÿÿêüÿÿÿÿÿÿÿï%üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ&üÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ$üÿÿÿÿÿÿÿ0'üÿÿÿÿÿÿÿ7üÿÿÿÿÿÿÿ<%üÿÿÿÿÿÿÿKüÿÿÿÿÿÿÿS üÿÿÿÿÿÿÿi!üÿÿÿÿÿÿÿÑ(üÿÿÿÿÿÿÿì)üÿÿÿÿÿÿÿ*üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ("üÿÿÿÿÿÿÿ>+üÿÿÿÿÿÿÿC `X#üÿÿÿÿÿÿÿ_üÿÿÿÿÿÿÿn$üÿÿÿÿÿÿÿuüÿÿÿÿÿÿÿz%üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ™&üÿÿÿÿÿÿÿ¡ ¨üÿÿÿÿÿÿÿ¯üÿÿÿÿÿÿÿ»'üÿÿÿÿÿÿÿÂüÿÿÿÿÿÿÿÇ%üÿÿÿÿÿÿÿÖüÿÿÿÿÿÿÿÞ üÿÿÿÿÿÿÿñ,üÿÿÿÿÿÿÿö 3 #üÿÿÿÿÿÿÿ P#üÿÿÿÿÿÿÿ%üÿÿÿÿÿÿÿ4$üÿÿÿÿÿÿÿ;üÿÿÿÿÿÿÿ@%üÿÿÿÿÿÿÿSüÿÿÿÿÿÿÿ_&üÿÿÿÿÿÿÿg nüÿÿÿÿÿÿÿuüÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿˆüÿÿÿÿÿÿÿ%üÿÿÿÿÿÿÿœüÿÿÿÿÿÿÿ¤ üÿÿÿÿÿÿÿÑ-üÿÿÿÿÿÿÿß.üÿÿÿÿÿÿÿë+üÿÿÿÿÿÿÿÿ.üÿÿÿÿÿÿÿ p#üÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ/$üÿÿÿÿÿÿÿ6üÿÿÿÿÿÿÿ;%üÿÿÿÿÿÿÿBüÿÿÿÿÿÿÿJ üÿÿÿÿÿÿÿgüÿÿÿÿÿÿÿs&üÿÿÿÿÿÿÿ{ ‚üÿÿÿÿÿÿÿ‰üÿÿÿÿÿÿÿ•'üÿÿÿÿÿÿÿœüÿÿÿÿÿÿÿ¡%üÿÿÿÿÿÿÿË-üÿÿÿÿÿÿÿÖ,üÿÿÿÿÿÿÿâ,øÿÿÿÿÿÿÿ -üÿÿÿÿÿÿÿ+üÿÿÿÿÿÿÿ&.üÿÿÿÿÿÿÿ; /@ ~P#üÿÿÿÿÿÿÿW 0a ‹hüÿÿÿÿÿÿÿz ‘„üÿÿÿÿÿÿÿ‹üÿÿÿÿÿÿÿš$üÿÿÿÿÿÿÿ¡üÿÿÿÿÿÿÿ¦%üÿÿÿÿÿÿÿ­üÿÿÿÿÿÿÿ² üÿÿÿÿÿÿÿÍ 1Ò2üÿÿÿÿÿÿÿâüÿÿÿÿÿÿÿî&üÿÿÿÿÿÿÿõ üüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ%üÿÿÿÿÿÿÿ> /C3üÿÿÿÿÿÿÿ]/h/üÿÿÿÿÿÿÿs4üÿÿÿÿÿÿÿx #üÿÿÿÿÿÿÿ’   #üÿÿÿÿÿÿÿ§üÿÿÿÿÿÿÿ¶$üÿÿÿÿÿÿÿ½üÿÿÿÿÿÿÿÂ%üÿÿÿÿÿÿÿÉüÿÿÿÿÿÿÿÑ üÿÿÿÿÿÿÿîüÿÿÿÿÿÿÿú&üÿÿÿÿÿÿÿ  üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿ#üÿÿÿÿÿÿÿ(%üÿÿÿÿÿÿÿ85üÿÿÿÿÿÿÿ= R#üÿÿÿÿÿÿÿb p#üÿÿÿÿÿÿÿwüÿÿÿÿÿÿÿ†$üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ’%üÿÿÿÿÿÿÿ¥üÿÿÿÿÿÿÿ±&üÿÿÿÿÿÿÿ¹ ÀüÿÿÿÿÿÿÿÇüÿÿÿÿÿÿÿÓ'üÿÿÿÿÿÿÿÚüÿÿÿÿÿÿÿß%üÿÿÿÿÿÿÿîüÿÿÿÿÿÿÿö üÿÿÿÿÿÿÿ -üÿÿÿÿÿÿÿ+ 4üÿÿÿÿÿÿÿ7 4øÿÿÿÿÿÿÿ` -üÿÿÿÿÿÿÿf 5üÿÿÿÿÿÿÿ| 6üÿÿÿÿÿÿÿ  /¥ 7üÿÿÿÿÿÿÿº /Ä /üÿÿÿÿÿÿÿò “þ #üÿÿÿÿÿÿÿ  üÿÿÿÿÿÿÿ ˜ üÿÿÿÿÿÿÿ À" üÿÿÿÿÿÿÿ' è. üÿÿÿÿÿÿÿ3 ­: üÿÿÿÿÿÿÿ? ÊF üÿÿÿÿÿÿÿK R üÿÿÿÿÿÿÿW X^ üÿÿÿÿÿÿÿc ˜j üÿÿÿÿÿÿÿo Èv üÿÿÿÿÿÿÿ{ ‚ üÿÿÿÿÿÿÿ‡ HŽ üÿÿÿÿÿÿÿ“ ˆš üÿÿÿÿÿÿÿŸ À¦ üÿÿÿÿÿÿÿ« ² üÿÿÿÿÿÿÿ¹ (À üÿÿÿÿÿÿÿÅ èÌ üÿÿÿÿÿÿÿÑ `Ø üÿÿÿÿÿÿÿÝ ‘ä üÿÿÿÿÿÿÿé ÷ #üÿÿÿÿÿÿÿþ üÿÿÿÿÿÿÿ  üÿÿÿÿÿÿÿ 8üÿÿÿÿÿÿÿ' 8øÿÿÿÿÿÿÿ8 8øÿÿÿÿÿÿÿI 8üÿÿÿÿÿÿÿb 8øÿÿÿÿÿÿÿ© :üÿÿÿÿÿÿÿ² ;üÿÿÿÿÿÿÿ¹ <üÿÿÿÿÿÿÿÕ "â üÿÿÿÿÿÿÿê =üÿÿÿÿÿÿÿ÷ >üÿÿÿÿÿÿÿý ?üÿÿÿÿÿÿÿ @ Aüÿÿÿÿÿÿÿ! Büÿÿÿÿÿÿÿ, Cüÿÿÿÿÿÿÿ9 DüÿÿÿÿÿÿÿR Eüÿÿÿÿÿÿÿe Füÿÿÿÿÿÿÿp (w üÿÿÿÿÿÿÿ~ üÿÿÿÿÿÿÿŠ 'üÿÿÿÿÿÿÿ‘ üÿÿÿÿÿÿÿ® üÿÿÿÿÿÿÿ³ /» $üÿÿÿÿÿÿÿô üÿÿÿÿÿÿÿù Güÿÿÿÿÿÿÿ 0  / H= 0F 3üÿÿÿÿÿÿÿ€ Güÿÿÿÿÿÿÿ™ 0© üÿÿÿÿÿÿÿ» IüÿÿÿÿÿÿÿÍ ˆæ üÿÿÿÿÿÿÿJüÿÿÿÿÿÿÿ#Küÿÿÿÿÿÿÿ)?üÿÿÿÿÿÿÿ9AüÿÿÿÿÿÿÿC?üÿÿÿÿÿÿÿH @PAüÿÿÿÿÿÿÿ`BüÿÿÿÿÿÿÿkCüÿÿÿÿÿÿÿx 3üÿÿÿÿÿÿÿ„Düÿÿÿÿÿÿÿ›Eüÿÿÿÿÿÿÿ«Füÿÿÿÿÿÿÿ¶ (½üÿÿÿÿÿÿÿÊIüÿÿÿÿÿÿÿâIüÿÿÿÿÿÿÿ ˆüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ.'üÿÿÿÿÿÿÿC ‘Hüÿÿÿÿÿÿÿi 9püÿÿÿÿÿÿÿ„ 0‹üÿÿÿÿÿÿÿœLüÿÿÿÿÿÿÿ¦üÿÿÿÿÿÿÿ·Füÿÿÿÿÿÿÿ¼ 0ÆüÿÿÿÿÿÿÿÓüÿÿÿÿÿÿÿß&üÿÿÿÿÿÿÿô 0ûüÿÿÿÿÿÿÿLüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ+Füÿÿÿÿÿÿÿ0 0:üÿÿÿÿÿÿÿKüÿÿÿÿÿÿÿW&üÿÿÿÿÿÿÿcüÿÿÿÿÿÿÿo$üÿÿÿÿÿÿÿ™(üÿÿÿÿÿÿÿ¨üÿÿÿÿÿÿÿ²¼ÆÐ Ú$ä(î,ø04 :üÿÿÿÿÿÿÿ<üÿÿÿÿÿÿÿ#Nüÿÿÿÿÿÿÿ)/[akq† ˜  »  Ì Fä í =Nüÿÿÿÿÿÿÿ:4F MüÿÿÿÿÿÿÿjQûÿÿÿÿÿÿÿvOüÿÿÿÿÿÿÿ‰ Jüÿÿÿÿÿÿÿ¡ ¨üÿÿÿÿÿÿÿ³üÿÿÿÿÿÿÿ¿&üÿÿÿÿÿÿÿÄ HËüÿÿÿÿÿÿÿÒüÿÿÿÿÿÿÿÞ'üÿÿÿÿÿÿÿ:üÿÿÿÿÿÿÿ <üÿÿÿÿÿÿÿ!Düÿÿÿÿÿÿÿ1BüÿÿÿÿÿÿÿB 0IüÿÿÿÿÿÿÿPüÿÿÿÿÿÿÿ\'üÿÿÿÿÿÿÿcüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ„$üÿÿÿÿÿÿÿ‰ üÿÿÿÿÿÿÿšPüÿÿÿÿÿÿÿ¡ ‘¦üÿÿÿÿÿÿÿ¹ "ÂüÿÿÿÿÿÿÿÉ=üÿÿÿÿÿÿÿØCüÿÿÿÿÿÿÿâ?üÿÿÿÿÿÿÿç @ïAüÿÿÿÿÿÿÿü 9üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ&üÿÿÿÿÿÿÿ+ L0üÿÿÿÿÿÿÿTLüÿÿÿÿÿÿÿ^üÿÿÿÿÿÿÿfBüÿÿÿÿÿÿÿwFüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ¨Tüÿÿÿÿÿÿÿ¯üÿÿÿÿÿÿÿÐüÿÿÿÿÿÿÿÙ$üÿÿÿÿÿÿÿàüÿÿÿÿÿÿÿì&üÿÿÿÿÿÿÿñ Qöüÿÿÿÿÿÿÿýüÿÿÿÿÿÿÿ 'üÿÿÿÿÿÿÿUüÿÿÿÿÿÿÿ V ()#üÿÿÿÿÿÿÿ3Wüÿÿÿÿÿÿÿ=XüÿÿÿÿÿÿÿN#üÿÿÿÿÿÿÿS hZüÿÿÿÿÿÿÿaüÿÿÿÿÿÿÿm&üÿÿÿÿÿÿÿr pyüÿÿÿÿÿÿÿ€üÿÿÿÿÿÿÿŒ'üÿÿÿÿÿÿÿ‘ r˜üÿÿÿÿÿÿÿŸüÿÿÿÿÿÿÿ«&üÿÿÿÿÿÿÿ° y·üÿÿÿÿÿÿÿ¾üÿÿÿÿÿÿÿÊ'üÿÿÿÿÿÿÿÏ {ÖüÿÿÿÿÿÿÿÝüÿÿÿÿÿÿÿé&üÿÿÿÿÿÿÿî Šõüÿÿÿÿÿÿÿüüÿÿÿÿÿÿÿ'üÿÿÿÿÿÿÿ  Œüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ'&üÿÿÿÿÿÿÿ, ¡3üÿÿÿÿÿÿÿ:üÿÿÿÿÿÿÿF'üÿÿÿÿÿÿÿK £RüÿÿÿÿÿÿÿYüÿÿÿÿÿÿÿe&üÿÿÿÿÿÿÿj µqüÿÿÿÿÿÿÿxüÿÿÿÿÿÿÿ„'üÿÿÿÿÿÿÿ‹ ·üÿÿÿÿÿÿÿ—Qüÿÿÿÿÿÿÿ¥ /¶ HÉ ¼ä 0 éGüÿÿÿÿÿÿÿõ 0Güÿÿÿÿÿÿÿ 0 ( /1üÿÿÿÿÿÿÿD&üÿÿÿÿÿÿÿI ÂW#üÿÿÿÿÿÿÿa 0p#üÿÿÿÿÿÿÿu °„#üÿÿÿÿÿÿÿ‹üÿÿÿÿÿÿÿ—'üÿÿÿÿÿÿÿžüÿÿÿÿÿÿÿª$üÿÿÿÿÿÿÿ²9üÿÿÿÿÿÿÿ¹üÿÿÿÿÿÿÿ¾%üÿÿÿÿÿÿÿñDüÿÿÿÿÿÿÿ" È9GüÿÿÿÿÿÿÿO#üÿÿÿÿÿÿÿVüÿÿÿÿÿÿÿb'üÿÿÿÿÿÿÿiüÿÿÿÿÿÿÿu$üÿÿÿÿÿÿÿzMüÿÿÿÿÿÿÿ…RüÿÿÿÿÿÿÿŠ ‘–üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ©&üÿÿÿÿÿÿÿ® صüÿÿÿÿÿÿÿ¼üÿÿÿÿÿÿÿÈ'üÿÿÿÿÿÿÿÓ  Ú =ß ßöüÿÿÿÿÿÿÿ øÿÿÿÿÿÿÿ#Yüÿÿÿÿÿÿÿ9(üÿÿÿÿÿÿÿE[üÿÿÿÿÿÿÿJ\üÿÿÿÿÿÿÿO]üÿÿÿÿÿÿÿe ‘lüÿÿÿÿÿÿÿ…^üÿÿÿÿÿÿÿhüÿÿÿÿÿÿÿÓüÿÿÿÿÿÿÿòüÿÿÿÿÿÿÿXSüÿÿÿÿÿÿÿu_üÿÿÿÿÿÿÿŽZüÿÿÿÿÿÿÿ  Q e õ!’) . L; xB <[ žb ¦i §p *w Ð~ ƒ Ž õ™ x´ ¹ Æ 6Û Ææ åñ 8 À  A } ï +" ´( £. „4 : Ì@ ¯F –L LR X +^ d 4j Íp  v | ‚ °ˆ S á– g g¤ « h² ´¹ ÏÉ »Ô zß U ' D6 †A aN ¡] l ){ ÆŠ Š™ ê¨ ›· ÔÆ ªÕ jä Àó  k .  ]/ ²> öM ÿ] æm s} ¬  G­ N½ UÍ \Ý cí ºý ‰ á Ž! Þ/  = \~ €Š I— Ǧ Áµ ÆÄ ÀÓ ®â ¨ñ ¡ – ¯ ]- ×< K ÇZ 5i %x ¿‡ Q– n¥ a´ hà WÒ Tá ð •ÿ | , %-  9 ºF U d ìs 8‚ £‘ Š£ š¨ 6º ¶Å WØ /Þ Åä Šê Bð "ö _ü   û à  ¼ ‡  ©' $A  O ¸] õk @y Ÿž ª ¦à š ; O! D' _- A3 <9 ð? †E ÎM xk •} "‹  "¬ ™² Ä .Ò Ÿä ¾ï ü î .' Ý. 6 > Q °V nj  q _| „ q Œ l Ϊ ©· ‹Ë Ô YÞ ç ãï 0ú ] ` Y   M%  0 4 7 d? }L YV ¯ _ dg }v  } ˜… £’ Yœ J ¥ ˜­ £à ÛË àÚ ò ä »ì û > µ P Š& õ. = ÖG  O Ð^ h J p  [… ï  –  ¡ §ª êÀ  È € Ð Ø ßá :ì 1ü i ¡ Ø ó µ+ O0 ü; «@ ÛK ãY ?^ øi bw ä… .“ z˜ £ þ¼ Ð Ä PÙ Hã _ ë  ü z! t)  1 ­9 ¬B EM H[ kk Wz  4Œ — ¦ ä® °¶ öÐ °Þ æå í õ çý   º P  Ý% E0 > 6E ÏMðU€] Yf :q «v P ô‘ =  †® õ³ ü¾ à øÎ tÕ tÝ€å=í ªö n ¬ : õ ’! G PL W s€Àˆ à˜ ¾¡ ê«ò³  Ã Ì 6Ò `ç Ðò h÷ • Æ   ü( ( Q MY@a\i Š o êw`y‡ Ö  ø•€’¥ "!ª ™· ÀÄ ãÒ Úß &ì ‚ù ü . ÙF ^ Øk ýx j… 1’ ˜Ÿ s¬ )Æ Kß ì ´ø _ < I R :_h tu~ Å ™œ À© ã· ÚÄ &Ñ ‚Þ üë ø Ù  Ø ý,@5 jB 1O ˜\ si )ƒ Kœ Ѽ È c Lp€ À ì°0ð|€¼@Ô`ì€mtr-0.85/missing0000755000175000017500000002623312104737110012665 0ustar wolffwolff#! /bin/sh # Common stub for a few missing GNU programs while installing. scriptversion=2009-04-28.21; # UTC # Copyright (C) 1996, 1997, 1999, 2000, 2002, 2003, 2004, 2005, 2006, # 2008, 2009 Free Software Foundation, Inc. # Originally by Fran,cois Pinard , 1996. # This program is free software; you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation; either version 2, or (at your option) # any later version. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # You should have received a copy of the GNU General Public License # along with this program. If not, see . # As a special exception to the GNU General Public License, if you # distribute this file as part of a program that contains a # configuration script generated by Autoconf, you may include it under # the same distribution terms that you use for the rest of that program. if test $# -eq 0; then echo 1>&2 "Try \`$0 --help' for more information" exit 1 fi run=: sed_output='s/.* --output[ =]\([^ ]*\).*/\1/p' sed_minuso='s/.* -o \([^ ]*\).*/\1/p' # In the cases where this matters, `missing' is being run in the # srcdir already. if test -f configure.ac; then configure_ac=configure.ac else configure_ac=configure.in fi msg="missing on your system" case $1 in --run) # Try to run requested program, and just exit if it succeeds. run= shift "$@" && exit 0 # Exit code 63 means version mismatch. This often happens # when the user try to use an ancient version of a tool on # a file that requires a minimum version. In this case we # we should proceed has if the program had been absent, or # if --run hadn't been passed. if test $? = 63; then run=: msg="probably too old" fi ;; -h|--h|--he|--hel|--help) echo "\ $0 [OPTION]... PROGRAM [ARGUMENT]... Handle \`PROGRAM [ARGUMENT]...' for when PROGRAM is missing, or return an error status if there is no known handling for PROGRAM. Options: -h, --help display this help and exit -v, --version output version information and exit --run try to run the given command, and emulate it if it fails Supported PROGRAM values: aclocal touch file \`aclocal.m4' autoconf touch file \`configure' autoheader touch file \`config.h.in' autom4te touch the output file, or create a stub one automake touch all \`Makefile.in' files bison create \`y.tab.[ch]', if possible, from existing .[ch] flex create \`lex.yy.c', if possible, from existing .c help2man touch the output file lex create \`lex.yy.c', if possible, from existing .c makeinfo touch the output file tar try tar, gnutar, gtar, then tar without non-portable flags yacc create \`y.tab.[ch]', if possible, from existing .[ch] Version suffixes to PROGRAM as well as the prefixes \`gnu-', \`gnu', and \`g' are ignored when checking the name. Send bug reports to ." exit $? ;; -v|--v|--ve|--ver|--vers|--versi|--versio|--version) echo "missing $scriptversion (GNU Automake)" exit $? ;; -*) echo 1>&2 "$0: Unknown \`$1' option" echo 1>&2 "Try \`$0 --help' for more information" exit 1 ;; esac # normalize program name to check for. program=`echo "$1" | sed ' s/^gnu-//; t s/^gnu//; t s/^g//; t'` # Now exit if we have it, but it failed. Also exit now if we # don't have it and --version was passed (most likely to detect # the program). This is about non-GNU programs, so use $1 not # $program. case $1 in lex*|yacc*) # Not GNU programs, they don't have --version. ;; tar*) if test -n "$run"; then echo 1>&2 "ERROR: \`tar' requires --run" exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then exit 1 fi ;; *) if test -z "$run" && ($1 --version) > /dev/null 2>&1; then # We have it, but it failed. exit 1 elif test "x$2" = "x--version" || test "x$2" = "x--help"; then # Could not run --version or --help. This is probably someone # running `$TOOL --version' or `$TOOL --help' to check whether # $TOOL exists and not knowing $TOOL uses missing. exit 1 fi ;; esac # If it does not exist, or fails to run (possibly an outdated version), # try to emulate it. case $program in aclocal*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." touch aclocal.m4 ;; autoconf*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." touch configure ;; autoheader*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`acconfig.h' or \`${configure_ac}'. You might want to install the \`Autoconf' and \`GNU m4' packages. Grab them from any GNU archive site." files=`sed -n 's/^[ ]*A[CM]_CONFIG_HEADER(\([^)]*\)).*/\1/p' ${configure_ac}` test -z "$files" && files="config.h" touch_files= for f in $files; do case $f in *:*) touch_files="$touch_files "`echo "$f" | sed -e 's/^[^:]*://' -e 's/:.*//'`;; *) touch_files="$touch_files $f.in";; esac done touch $touch_files ;; automake*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified \`Makefile.am', \`acinclude.m4' or \`${configure_ac}'. You might want to install the \`Automake' and \`Perl' packages. Grab them from any GNU archive site." find . -type f -name Makefile.am -print | sed 's/\.am$/.in/' | while read f; do touch "$f"; done ;; autom4te*) echo 1>&2 "\ WARNING: \`$1' is needed, but is $msg. You might have modified some files without having the proper tools for further handling them. You can get \`$1' as part of \`Autoconf' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo "#! /bin/sh" echo "# Created by GNU Automake missing as a replacement of" echo "# $ $@" echo "exit 0" chmod +x $file exit 1 fi ;; bison*|yacc*) echo 1>&2 "\ WARNING: \`$1' $msg. You should only need it if you modified a \`.y' file. You may need the \`Bison' package in order for those modifications to take effect. You can get \`Bison' from any GNU archive site." rm -f y.tab.c y.tab.h if test $# -ne 1; then eval LASTARG="\${$#}" case $LASTARG in *.y) SRCFILE=`echo "$LASTARG" | sed 's/y$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.c fi SRCFILE=`echo "$LASTARG" | sed 's/y$/h/'` if test -f "$SRCFILE"; then cp "$SRCFILE" y.tab.h fi ;; esac fi if test ! -f y.tab.h; then echo >y.tab.h fi if test ! -f y.tab.c; then echo 'main() { return 0; }' >y.tab.c fi ;; lex*|flex*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.l' file. You may need the \`Flex' package in order for those modifications to take effect. You can get \`Flex' from any GNU archive site." rm -f lex.yy.c if test $# -ne 1; then eval LASTARG="\${$#}" case $LASTARG in *.l) SRCFILE=`echo "$LASTARG" | sed 's/l$/c/'` if test -f "$SRCFILE"; then cp "$SRCFILE" lex.yy.c fi ;; esac fi if test ! -f lex.yy.c; then echo 'main() { return 0; }' >lex.yy.c fi ;; help2man*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a dependency of a manual page. You may need the \`Help2man' package in order for those modifications to take effect. You can get \`Help2man' from any GNU archive site." file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -f "$file"; then touch $file else test -z "$file" || exec >$file echo ".ab help2man is required to generate this page" exit $? fi ;; makeinfo*) echo 1>&2 "\ WARNING: \`$1' is $msg. You should only need it if you modified a \`.texi' or \`.texinfo' file, or any other file indirectly affecting the aspect of the manual. The spurious call might also be the consequence of using a buggy \`make' (AIX, DU, IRIX). You might want to install the \`Texinfo' package or the \`GNU make' package. Grab either from any GNU archive site." # The file to touch is that specified with -o ... file=`echo "$*" | sed -n "$sed_output"` test -z "$file" && file=`echo "$*" | sed -n "$sed_minuso"` if test -z "$file"; then # ... or it is the one specified with @setfilename ... infile=`echo "$*" | sed 's/.* \([^ ]*\) *$/\1/'` file=`sed -n ' /^@setfilename/{ s/.* \([^ ]*\) *$/\1/ p q }' $infile` # ... or it is derived from the source name (dir/f.texi becomes f.info) test -z "$file" && file=`echo "$infile" | sed 's,.*/,,;s,.[^.]*$,,'`.info fi # If the file does not exist, the user really needs makeinfo; # let's fail without touching anything. test -f $file || exit 1 touch $file ;; tar*) shift # We have already tried tar in the generic part. # Look for gnutar/gtar before invocation to avoid ugly error # messages. if (gnutar --version > /dev/null 2>&1); then gnutar "$@" && exit 0 fi if (gtar --version > /dev/null 2>&1); then gtar "$@" && exit 0 fi firstarg="$1" if shift; then case $firstarg in *o*) firstarg=`echo "$firstarg" | sed s/o//` tar "$firstarg" "$@" && exit 0 ;; esac case $firstarg in *h*) firstarg=`echo "$firstarg" | sed s/h//` tar "$firstarg" "$@" && exit 0 ;; esac fi echo 1>&2 "\ WARNING: I can't seem to be able to run \`tar' with the given arguments. You may want to install GNU tar or Free paxutils, or check the command line arguments." exit 1 ;; *) echo 1>&2 "\ WARNING: \`$1' is needed, and is $msg. You might have modified some files without having the proper tools for further handling them. Check the \`README' file, it often tells you about the needed prerequisites for installing this package. You may also peek at any GNU archive site, in case some other package would contain this missing \`$1' program." exit 1 ;; esac exit 0 # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: mtr-0.85/config.log0000664000175000017500000013212412162522231013235 0ustar wolffwolffThis file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. It was created by mtr configure 0.85, which was generated by GNU Autoconf 2.68. Invocation command line was $ ./configure ## --------- ## ## Platform. ## ## --------- ## hostname = getafix uname -m = x86_64 uname -r = 3.0.0-28-generic uname -s = Linux uname -v = #45-Ubuntu SMP Wed Nov 14 21:57:26 UTC 2012 /usr/bin/uname -p = unknown /bin/uname -X = unknown /bin/arch = unknown /usr/bin/arch -k = unknown /usr/convex/getsysinfo = unknown /usr/bin/hostinfo = unknown /bin/machine = unknown /usr/bin/oslevel = unknown /bin/universe = unknown PATH: /home/hdr/bin PATH: /home/hdr/cross/bin PATH: /home/wolff/bin PATH: /home/wolff/sat PATH: /home/wolff/bb PATH: /opt/msp430-gcc-4.4.3/bin PATH: /usr/quartus/bin PATH: /home/wolff/sat/bin PATH: /usr/local/sbin PATH: /usr/local/bin PATH: /usr/sbin PATH: /usr/bin PATH: /sbin PATH: /bin PATH: /usr/games ## ----------- ## ## Core tests. ## ## ----------- ## configure:2470: checking for a BSD-compatible install configure:2538: result: /usr/bin/install -c configure:2549: checking whether build environment is sane configure:2599: result: yes configure:2740: checking for a thread-safe mkdir -p configure:2779: result: /bin/mkdir -p configure:2792: checking for gawk configure:2808: found /usr/bin/gawk configure:2819: result: gawk configure:2830: checking whether make sets $(MAKE) configure:2852: result: yes configure:2990: checking for gcc configure:3006: found /usr/bin/gcc configure:3017: result: gcc configure:3246: checking for C compiler version configure:3255: gcc --version >&5 gcc (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1 Copyright (C) 2011 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. configure:3266: $? = 0 configure:3255: gcc -v >&5 Using built-in specs. COLLECT_GCC=gcc COLLECT_LTO_WRAPPER=/usr/lib/gcc/x86_64-linux-gnu/4.6.1/lto-wrapper Target: x86_64-linux-gnu Configured with: ../src/configure -v --with-pkgversion='Ubuntu/Linaro 4.6.1-9ubuntu3' --with-bugurl=file:///usr/share/doc/gcc-4.6/README.Bugs --enable-languages=c,c++,fortran,objc,obj-c++,go --prefix=/usr --program-suffix=-4.6 --enable-shared --enable-linker-build-id --with-system-zlib --libexecdir=/usr/lib --without-included-gettext --enable-threads=posix --with-gxx-include-dir=/usr/include/c++/4.6 --libdir=/usr/lib --enable-nls --with-sysroot=/ --enable-clocale=gnu --enable-libstdcxx-debug --enable-libstdcxx-time=yes --enable-plugin --enable-objc-gc --disable-werror --with-arch-32=i686 --with-tune=generic --enable-checking=release --build=x86_64-linux-gnu --host=x86_64-linux-gnu --target=x86_64-linux-gnu Thread model: posix gcc version 4.6.1 (Ubuntu/Linaro 4.6.1-9ubuntu3) configure:3266: $? = 0 configure:3255: gcc -V >&5 gcc: error: unrecognized option '-V' gcc: fatal error: no input files compilation terminated. configure:3266: $? = 4 configure:3255: gcc -qversion >&5 gcc: error: unrecognized option '-qversion' gcc: fatal error: no input files compilation terminated. configure:3266: $? = 4 configure:3286: checking whether the C compiler works configure:3308: gcc conftest.c >&5 configure:3312: $? = 0 configure:3360: result: yes configure:3363: checking for C compiler default output file name configure:3365: result: a.out configure:3371: checking for suffix of executables configure:3378: gcc -o conftest conftest.c >&5 configure:3382: $? = 0 configure:3404: result: configure:3426: checking whether we are cross compiling configure:3434: gcc -o conftest conftest.c >&5 configure:3438: $? = 0 configure:3445: ./conftest configure:3449: $? = 0 configure:3464: result: no configure:3469: checking for suffix of object files configure:3491: gcc -c conftest.c >&5 configure:3495: $? = 0 configure:3516: result: o configure:3520: checking whether we are using the GNU C compiler configure:3539: gcc -c conftest.c >&5 configure:3539: $? = 0 configure:3548: result: yes configure:3557: checking whether gcc accepts -g configure:3577: gcc -c -g conftest.c >&5 configure:3577: $? = 0 configure:3618: result: yes configure:3635: checking for gcc option to accept ISO C89 configure:3699: gcc -c -g -O2 conftest.c >&5 configure:3699: $? = 0 configure:3712: result: none needed configure:3743: checking for style of include used by make configure:3771: result: GNU configure:3796: checking dependency style of gcc configure:3906: result: gcc3 configure:3928: checking how to run the C preprocessor configure:3959: gcc -E conftest.c configure:3959: $? = 0 configure:3973: gcc -E conftest.c conftest.c:11:28: fatal error: ac_nonexistent.h: No such file or directory compilation terminated. configure:3973: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | /* end confdefs.h. */ | #include configure:3998: result: gcc -E configure:4018: gcc -E conftest.c configure:4018: $? = 0 configure:4032: gcc -E conftest.c conftest.c:11:28: fatal error: ac_nonexistent.h: No such file or directory compilation terminated. configure:4032: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | /* end confdefs.h. */ | #include configure:4061: checking for grep that handles long lines and -e configure:4119: result: /bin/grep configure:4124: checking for egrep configure:4186: result: /bin/grep -E configure:4191: checking for ANSI C header files configure:4211: gcc -c -g -O2 conftest.c >&5 configure:4211: $? = 0 configure:4284: gcc -o conftest -g -O2 conftest.c >&5 configure:4284: $? = 0 configure:4284: ./conftest configure:4284: $? = 0 configure:4295: result: yes configure:4308: checking for sys/types.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for sys/stat.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for stdlib.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for string.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for memory.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for strings.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for inttypes.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for stdint.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4308: checking for unistd.h configure:4308: gcc -c -g -O2 conftest.c >&5 configure:4308: $? = 0 configure:4308: result: yes configure:4324: checking size of unsigned char configure:4329: gcc -o conftest -g -O2 conftest.c >&5 configure:4329: $? = 0 configure:4329: ./conftest configure:4329: $? = 0 configure:4343: result: 1 configure:4357: checking size of unsigned short configure:4362: gcc -o conftest -g -O2 conftest.c >&5 configure:4362: $? = 0 configure:4362: ./conftest configure:4362: $? = 0 configure:4376: result: 2 configure:4390: checking size of unsigned int configure:4395: gcc -o conftest -g -O2 conftest.c >&5 configure:4395: $? = 0 configure:4395: ./conftest configure:4395: $? = 0 configure:4409: result: 4 configure:4423: checking size of unsigned long configure:4428: gcc -o conftest -g -O2 conftest.c >&5 configure:4428: $? = 0 configure:4428: ./conftest configure:4428: $? = 0 configure:4442: result: 8 configure:4456: checking ncurses.h usability configure:4456: gcc -c -g -O2 conftest.c >&5 configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking ncurses.h presence configure:4456: gcc -E conftest.c configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking for ncurses.h configure:4456: result: yes configure:4456: checking ncurses/curses.h usability configure:4456: gcc -c -g -O2 conftest.c >&5 conftest.c:59:28: fatal error: ncurses/curses.h: No such file or directory compilation terminated. configure:4456: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | /* end confdefs.h. */ | #include | #ifdef HAVE_SYS_TYPES_H | # include | #endif | #ifdef HAVE_SYS_STAT_H | # include | #endif | #ifdef STDC_HEADERS | # include | # include | #else | # ifdef HAVE_STDLIB_H | # include | # endif | #endif | #ifdef HAVE_STRING_H | # if !defined STDC_HEADERS && defined HAVE_MEMORY_H | # include | # endif | # include | #endif | #ifdef HAVE_STRINGS_H | # include | #endif | #ifdef HAVE_INTTYPES_H | # include | #endif | #ifdef HAVE_STDINT_H | # include | #endif | #ifdef HAVE_UNISTD_H | # include | #endif | #include configure:4456: result: no configure:4456: checking ncurses/curses.h presence configure:4456: gcc -E conftest.c conftest.c:26:28: fatal error: ncurses/curses.h: No such file or directory compilation terminated. configure:4456: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | /* end confdefs.h. */ | #include configure:4456: result: no configure:4456: checking for ncurses/curses.h configure:4456: result: no configure:4456: checking curses.h usability configure:4456: gcc -c -g -O2 conftest.c >&5 configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking curses.h presence configure:4456: gcc -E conftest.c configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking for curses.h configure:4456: result: yes configure:4456: checking cursesX.h usability configure:4456: gcc -c -g -O2 conftest.c >&5 conftest.c:60:21: fatal error: cursesX.h: No such file or directory compilation terminated. configure:4456: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | /* end confdefs.h. */ | #include | #ifdef HAVE_SYS_TYPES_H | # include | #endif | #ifdef HAVE_SYS_STAT_H | # include | #endif | #ifdef STDC_HEADERS | # include | # include | #else | # ifdef HAVE_STDLIB_H | # include | # endif | #endif | #ifdef HAVE_STRING_H | # if !defined STDC_HEADERS && defined HAVE_MEMORY_H | # include | # endif | # include | #endif | #ifdef HAVE_STRINGS_H | # include | #endif | #ifdef HAVE_INTTYPES_H | # include | #endif | #ifdef HAVE_STDINT_H | # include | #endif | #ifdef HAVE_UNISTD_H | # include | #endif | #include configure:4456: result: no configure:4456: checking cursesX.h presence configure:4456: gcc -E conftest.c conftest.c:27:21: fatal error: cursesX.h: No such file or directory compilation terminated. configure:4456: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | /* end confdefs.h. */ | #include configure:4456: result: no configure:4456: checking for cursesX.h configure:4456: result: no configure:4456: checking for sys/types.h configure:4456: result: yes configure:4456: checking fcntl.h usability configure:4456: gcc -c -g -O2 conftest.c >&5 configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking fcntl.h presence configure:4456: gcc -E conftest.c configure:4456: $? = 0 configure:4456: result: yes configure:4456: checking for fcntl.h configure:4456: result: yes configure:4469: checking socket.h usability configure:4469: gcc -c -g -O2 conftest.c >&5 conftest.c:62:20: fatal error: socket.h: No such file or directory compilation terminated. configure:4469: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | /* end confdefs.h. */ | #include | #ifdef HAVE_SYS_TYPES_H | # include | #endif | #ifdef HAVE_SYS_STAT_H | # include | #endif | #ifdef STDC_HEADERS | # include | # include | #else | # ifdef HAVE_STDLIB_H | # include | # endif | #endif | #ifdef HAVE_STRING_H | # if !defined STDC_HEADERS && defined HAVE_MEMORY_H | # include | # endif | # include | #endif | #ifdef HAVE_STRINGS_H | # include | #endif | #ifdef HAVE_INTTYPES_H | # include | #endif | #ifdef HAVE_STDINT_H | # include | #endif | #ifdef HAVE_UNISTD_H | # include | #endif | #include configure:4469: result: no configure:4469: checking socket.h presence configure:4469: gcc -E conftest.c conftest.c:29:20: fatal error: socket.h: No such file or directory compilation terminated. configure:4469: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | /* end confdefs.h. */ | #include configure:4469: result: no configure:4469: checking for socket.h configure:4469: result: no configure:4469: checking sys/socket.h usability configure:4469: gcc -c -g -O2 conftest.c >&5 configure:4469: $? = 0 configure:4469: result: yes configure:4469: checking sys/socket.h presence configure:4469: gcc -E conftest.c configure:4469: $? = 0 configure:4469: result: yes configure:4469: checking for sys/socket.h configure:4469: result: yes configure:4469: checking sys/xti.h usability configure:4469: gcc -c -g -O2 conftest.c >&5 conftest.c:63:21: fatal error: sys/xti.h: No such file or directory compilation terminated. configure:4469: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | /* end confdefs.h. */ | #include | #ifdef HAVE_SYS_TYPES_H | # include | #endif | #ifdef HAVE_SYS_STAT_H | # include | #endif | #ifdef STDC_HEADERS | # include | # include | #else | # ifdef HAVE_STDLIB_H | # include | # endif | #endif | #ifdef HAVE_STRING_H | # if !defined STDC_HEADERS && defined HAVE_MEMORY_H | # include | # endif | # include | #endif | #ifdef HAVE_STRINGS_H | # include | #endif | #ifdef HAVE_INTTYPES_H | # include | #endif | #ifdef HAVE_STDINT_H | # include | #endif | #ifdef HAVE_UNISTD_H | # include | #endif | #include configure:4469: result: no configure:4469: checking sys/xti.h presence configure:4469: gcc -E conftest.c conftest.c:30:21: fatal error: sys/xti.h: No such file or directory compilation terminated. configure:4469: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | /* end confdefs.h. */ | #include configure:4469: result: no configure:4469: checking for sys/xti.h configure:4469: result: no configure:4469: checking arpa/nameser_compat.h usability configure:4469: gcc -c -g -O2 conftest.c >&5 configure:4469: $? = 0 configure:4469: result: yes configure:4469: checking arpa/nameser_compat.h presence configure:4469: gcc -E conftest.c configure:4469: $? = 0 configure:4469: result: yes configure:4469: checking for arpa/nameser_compat.h configure:4469: result: yes configure:4483: checking for tgetent in -ltermcap configure:4508: gcc -o conftest -g -O2 conftest.c -ltermcap >&5 configure:4508: $? = 0 configure:4517: result: yes configure:4528: checking for tgetent in -ltinfo configure:4553: gcc -o conftest -g -O2 conftest.c -ltinfo -ltermcap >&5 configure:4553: $? = 0 configure:4562: result: yes configure:4574: checking for initscr configure:4574: gcc -o conftest -g -O2 conftest.c -ltinfo -ltermcap >&5 configure:4574: $? = 0 configure:4574: result: yes configure:4728: checking for attron configure:4728: gcc -o conftest -g -O2 conftest.c -ltinfo -ltermcap >&5 configure:4728: $? = 0 configure:4728: result: yes configure:4728: checking for fcntl configure:4728: gcc -o conftest -g -O2 conftest.c -ltinfo -ltermcap >&5 configure:4728: $? = 0 configure:4728: result: yes configure:4738: checking for floor in -lm configure:4763: gcc -o conftest -g -O2 conftest.c -lm -ltinfo -ltermcap >&5 conftest.c:42:6: warning: conflicting types for built-in function 'floor' [enabled by default] configure:4763: $? = 0 configure:4772: result: yes configure:4861: checking for pkg-config configure:4879: found /usr/bin/pkg-config configure:4892: result: /usr/bin/pkg-config configure:4914: checking for GTK+ - version >= 2.6.0 configure:5024: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm -ltinfo -ltermcap >&5 configure:5024: $? = 0 configure:5024: ./conftest configure:5024: $? = 0 configure:5038: result: yes (version 2.24.6) configure:5327: checking for socket configure:5327: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5327: $? = 0 configure:5327: result: yes configure:5381: checking for gethostbyname configure:5381: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5381: $? = 0 configure:5381: result: yes configure:5441: checking for seteuid configure:5441: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5441: $? = 0 configure:5441: result: yes configure:5461: checking whether library required for res_mkquery configure:5482: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 /tmp/ccMn2aaQ.o: In function `main': /home/wolff/mtr/conftest.c:47: undefined reference to `__res_mkquery' collect2: ld returned 1 exit status configure:5482: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | #define HAVE_ARPA_NAMESER_COMPAT_H 1 | #define HAVE_LIBTERMCAP 1 | #define HAVE_LIBTINFO 1 | #define HAVE_ATTRON 1 | #define HAVE_FCNTL 1 | #define HAVE_LIBM 1 | #define HAVE_SETEUID 1 | /* end confdefs.h. */ | | | #include | #include | | int | main () | { | | int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; | (void)(*res_mkquery_func)(0); | | ; | return 0; | } configure:5487: result: yes configure:5493: checking for res_mkquery in -lbind configure:5515: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm -lbind >&5 /usr/bin/ld: cannot find -lbind collect2: ld returned 1 exit status configure:5515: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | #define HAVE_ARPA_NAMESER_COMPAT_H 1 | #define HAVE_LIBTERMCAP 1 | #define HAVE_LIBTINFO 1 | #define HAVE_ATTRON 1 | #define HAVE_FCNTL 1 | #define HAVE_LIBM 1 | #define HAVE_SETEUID 1 | /* end confdefs.h. */ | | | #include | #include | | int | main () | { | | int (*res_mkquery_func)(int,...) = (int (*)(int,...))res_mkquery; | (void)(*res_mkquery_func)(0); | | ; | return 0; | } configure:5520: result: no configure:5526: checking for res_mkquery in -lresolv configure:5547: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm -lresolv >&5 configure:5547: $? = 0 configure:5548: result: yes configure:5562: checking for herror configure:5562: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5562: $? = 0 configure:5562: result: yes configure:5571: checking for strerror configure:5571: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5571: $? = 0 configure:5571: result: yes configure:5582: checking for getaddrinfo configure:5582: gcc -o conftest -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm >&5 configure:5582: $? = 0 configure:5582: result: yes configure:5596: checking whether __res_state_ext needs to be defined configure:5621: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 configure:5621: $? = 0 configure:5622: result: no configure:5680: checking whether errno is declared configure:5680: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 configure:5680: $? = 0 configure:5680: result: yes configure:5696: checking for socklen_t configure:5696: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 configure:5696: $? = 0 configure:5696: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 conftest.c: In function 'main': conftest.c:52:24: error: expected expression before ')' token configure:5696: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | #define HAVE_ARPA_NAMESER_COMPAT_H 1 | #define HAVE_LIBTERMCAP 1 | #define HAVE_LIBTINFO 1 | #define HAVE_ATTRON 1 | #define HAVE_FCNTL 1 | #define HAVE_LIBM 1 | #define HAVE_SETEUID 1 | #define ENABLE_IPV6 /**/ | #define HAVE_DECL_ERRNO 1 | /* end confdefs.h. */ | | #include | #ifdef HAVE_SOCKET_H | #include | #endif | #ifdef HAVE_SYS_SOCKET_H | #include | #endif | | | int | main () | { | if (sizeof ((socklen_t))) | return 0; | ; | return 0; | } configure:5696: result: yes configure:5713: checking for struct in_addr configure:5713: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 configure:5713: $? = 0 configure:5713: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 conftest.c >&5 conftest.c: In function 'main': conftest.c:47:29: error: expected expression before ')' token configure:5713: $? = 1 configure: failed program was: | /* confdefs.h */ | #define PACKAGE_NAME "mtr" | #define PACKAGE_TARNAME "mtr" | #define PACKAGE_VERSION "0.85" | #define PACKAGE_STRING "mtr 0.85" | #define PACKAGE_BUGREPORT "" | #define PACKAGE_URL "" | #define PACKAGE "mtr" | #define VERSION "0.85" | #define STDC_HEADERS 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_SYS_STAT_H 1 | #define HAVE_STDLIB_H 1 | #define HAVE_STRING_H 1 | #define HAVE_MEMORY_H 1 | #define HAVE_STRINGS_H 1 | #define HAVE_INTTYPES_H 1 | #define HAVE_STDINT_H 1 | #define HAVE_UNISTD_H 1 | #define SIZEOF_UNSIGNED_CHAR 1 | #define SIZEOF_UNSIGNED_SHORT 2 | #define SIZEOF_UNSIGNED_INT 4 | #define SIZEOF_UNSIGNED_LONG 8 | #define HAVE_NCURSES_H 1 | #define HAVE_CURSES_H 1 | #define HAVE_SYS_TYPES_H 1 | #define HAVE_FCNTL_H 1 | #define HAVE_SYS_SOCKET_H 1 | #define HAVE_ARPA_NAMESER_COMPAT_H 1 | #define HAVE_LIBTERMCAP 1 | #define HAVE_LIBTINFO 1 | #define HAVE_ATTRON 1 | #define HAVE_FCNTL 1 | #define HAVE_LIBM 1 | #define HAVE_SETEUID 1 | #define ENABLE_IPV6 /**/ | #define HAVE_DECL_ERRNO 1 | #define HAVE_SOCKLEN_T /**/ | /* end confdefs.h. */ | | #include | | | int | main () | { | if (sizeof ((struct in_addr))) | return 0; | ; | return 0; | } configure:5713: result: yes configure:5724: checking for C flags to get more warnings configure:5736: gcc -c -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 -Wno-pointer-sign conftest.c >&5 configure:5736: $? = 0 configure:5794: result: -Wall -Wno-pointer-sign configure:5939: creating ./config.status ## ---------------------- ## ## Running config.status. ## ## ---------------------- ## This file was extended by mtr config.status 0.85, which was generated by GNU Autoconf 2.68. Invocation command line was CONFIG_FILES = CONFIG_HEADERS = CONFIG_LINKS = CONFIG_COMMANDS = $ ./config.status on getafix config.status:899: creating version.h.tmp config.status:899: creating Makefile config.status:899: creating img/Makefile config.status:899: creating config.h config.status:1128: executing depfiles commands ## ---------------- ## ## Cache variables. ## ## ---------------- ## ac_cv_c_compiler_gnu=yes ac_cv_env_CC_set= ac_cv_env_CC_value= ac_cv_env_CFLAGS_set= ac_cv_env_CFLAGS_value= ac_cv_env_CPPFLAGS_set= ac_cv_env_CPPFLAGS_value= ac_cv_env_CPP_set= ac_cv_env_CPP_value= ac_cv_env_GLIB_CFLAGS_set= ac_cv_env_GLIB_CFLAGS_value= ac_cv_env_GLIB_LIBS_set= ac_cv_env_GLIB_LIBS_value= ac_cv_env_LDFLAGS_set= ac_cv_env_LDFLAGS_value= ac_cv_env_LIBS_set= ac_cv_env_LIBS_value= ac_cv_env_PKG_CONFIG_LIBDIR_set= ac_cv_env_PKG_CONFIG_LIBDIR_value= ac_cv_env_PKG_CONFIG_PATH_set= ac_cv_env_PKG_CONFIG_PATH_value= ac_cv_env_PKG_CONFIG_set= ac_cv_env_PKG_CONFIG_value= ac_cv_env_build_alias_set= ac_cv_env_build_alias_value= ac_cv_env_host_alias_set= ac_cv_env_host_alias_value= ac_cv_env_target_alias_set= ac_cv_env_target_alias_value= ac_cv_func_attron=yes ac_cv_func_fcntl=yes ac_cv_func_getaddrinfo=yes ac_cv_func_gethostbyname=yes ac_cv_func_herror=yes ac_cv_func_initscr=yes ac_cv_func_seteuid=yes ac_cv_func_socket=yes ac_cv_func_strerror=yes ac_cv_have_decl_errno=yes ac_cv_header_arpa_nameser_compat_h=yes ac_cv_header_cursesX_h=no ac_cv_header_curses_h=yes ac_cv_header_fcntl_h=yes ac_cv_header_inttypes_h=yes ac_cv_header_memory_h=yes ac_cv_header_ncurses_curses_h=no ac_cv_header_ncurses_h=yes ac_cv_header_socket_h=no ac_cv_header_stdc=yes ac_cv_header_stdint_h=yes ac_cv_header_stdlib_h=yes ac_cv_header_string_h=yes ac_cv_header_strings_h=yes ac_cv_header_sys_socket_h=yes ac_cv_header_sys_stat_h=yes ac_cv_header_sys_types_h=yes ac_cv_header_sys_xti_h=no ac_cv_header_unistd_h=yes ac_cv_lib_m_floor=yes ac_cv_lib_termcap_tgetent=yes ac_cv_lib_tinfo_tgetent=yes ac_cv_objext=o ac_cv_path_EGREP='/bin/grep -E' ac_cv_path_GREP=/bin/grep ac_cv_path_PKG_CONFIG=/usr/bin/pkg-config ac_cv_path_install='/usr/bin/install -c' ac_cv_path_mkdir=/bin/mkdir ac_cv_prog_AWK=gawk ac_cv_prog_CPP='gcc -E' ac_cv_prog_ac_ct_CC=gcc ac_cv_prog_cc_c89= ac_cv_prog_cc_g=yes ac_cv_prog_make_make_set=yes ac_cv_sizeof_unsigned_char=1 ac_cv_sizeof_unsigned_int=4 ac_cv_sizeof_unsigned_long=8 ac_cv_sizeof_unsigned_short=2 ac_cv_type_socklen_t=yes ac_cv_type_struct_in_addr=yes am_cv_CC_dependencies_compiler_type=gcc3 ## ----------------- ## ## Output variables. ## ## ----------------- ## ACLOCAL='${SHELL} /home/wolff/mtr/missing --run aclocal-1.11' AMDEPBACKSLASH='\' AMDEP_FALSE='#' AMDEP_TRUE='' AMTAR='${SHELL} /home/wolff/mtr/missing --run tar' AUTOCONF='${SHELL} /home/wolff/mtr/missing --run autoconf' AUTOHEADER='${SHELL} /home/wolff/mtr/missing --run autoheader' AUTOMAKE='${SHELL} /home/wolff/mtr/missing --run automake-1.11' AWK='gawk' CC='gcc' CCDEPMODE='depmode=gcc3' CFLAGS='-g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 -Wall -Wno-pointer-sign' CPP='gcc -E' CPPFLAGS='' CURSES_OBJ='curses.o' CYGPATH_W='echo' DEFS='-DHAVE_CONFIG_H' DEPDIR='.deps' ECHO_C='' ECHO_N='-n' ECHO_T='' EGREP='/bin/grep -E' EXEEXT='' GLIB_CFLAGS='' GLIB_LIBS='' GREP='/bin/grep' GTK_CFLAGS='-pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 ' GTK_LIBS='-pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 ' GTK_OBJ='gtk.o' INSTALL_DATA='${INSTALL} -m 644' INSTALL_PROGRAM='${INSTALL}' INSTALL_SCRIPT='${INSTALL}' INSTALL_STRIP_PROGRAM='$(install_sh) -c -s' IPINFO_FALSE='#' IPINFO_TRUE='' LDFLAGS='' LIBOBJS='' LIBS='-lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm' LTLIBOBJS='' MAKEINFO='${SHELL} /home/wolff/mtr/missing --run makeinfo' MKDIR_P='/bin/mkdir -p' OBJEXT='o' PACKAGE='mtr' PACKAGE_BUGREPORT='' PACKAGE_NAME='mtr' PACKAGE_STRING='mtr 0.85' PACKAGE_TARNAME='mtr' PACKAGE_URL='' PACKAGE_VERSION='0.85' PATH_SEPARATOR=':' PKG_CONFIG='/usr/bin/pkg-config' PKG_CONFIG_LIBDIR='' PKG_CONFIG_PATH='' RESOLV_LIBS='-lresolv' SET_MAKE='' SHELL='/bin/bash' STRIP='' VERSION='0.85' ac_ct_CC='gcc' am__EXEEXT_FALSE='' am__EXEEXT_TRUE='#' am__fastdepCC_FALSE='#' am__fastdepCC_TRUE='' am__include='include' am__isrc='' am__leading_dot='.' am__quote='' am__tar='${AMTAR} chof - "$$tardir"' am__untar='${AMTAR} xf -' bindir='${exec_prefix}/bin' build_alias='' datadir='${datarootdir}' datarootdir='${prefix}/share' docdir='${datarootdir}/doc/${PACKAGE_TARNAME}' dvidir='${docdir}' exec_prefix='${prefix}' host_alias='' htmldir='${docdir}' includedir='${prefix}/include' infodir='${datarootdir}/info' install_sh='${SHELL} /home/wolff/mtr/install-sh' libdir='${exec_prefix}/lib' libexecdir='${exec_prefix}/libexec' localedir='${datarootdir}/locale' localstatedir='${prefix}/var' mandir='${datarootdir}/man' mkdir_p='/bin/mkdir -p' oldincludedir='/usr/include' pdfdir='${docdir}' prefix='/usr/local' program_transform_name='s,x,x,' psdir='${docdir}' sbindir='${exec_prefix}/sbin' sharedstatedir='${prefix}/com' sysconfdir='${prefix}/etc' target_alias='' ## ----------- ## ## confdefs.h. ## ## ----------- ## /* confdefs.h */ #define PACKAGE_NAME "mtr" #define PACKAGE_TARNAME "mtr" #define PACKAGE_VERSION "0.85" #define PACKAGE_STRING "mtr 0.85" #define PACKAGE_BUGREPORT "" #define PACKAGE_URL "" #define PACKAGE "mtr" #define VERSION "0.85" #define STDC_HEADERS 1 #define HAVE_SYS_TYPES_H 1 #define HAVE_SYS_STAT_H 1 #define HAVE_STDLIB_H 1 #define HAVE_STRING_H 1 #define HAVE_MEMORY_H 1 #define HAVE_STRINGS_H 1 #define HAVE_INTTYPES_H 1 #define HAVE_STDINT_H 1 #define HAVE_UNISTD_H 1 #define SIZEOF_UNSIGNED_CHAR 1 #define SIZEOF_UNSIGNED_SHORT 2 #define SIZEOF_UNSIGNED_INT 4 #define SIZEOF_UNSIGNED_LONG 8 #define HAVE_NCURSES_H 1 #define HAVE_CURSES_H 1 #define HAVE_SYS_TYPES_H 1 #define HAVE_FCNTL_H 1 #define HAVE_SYS_SOCKET_H 1 #define HAVE_ARPA_NAMESER_COMPAT_H 1 #define HAVE_LIBTERMCAP 1 #define HAVE_LIBTINFO 1 #define HAVE_ATTRON 1 #define HAVE_FCNTL 1 #define HAVE_LIBM 1 #define HAVE_SETEUID 1 #define ENABLE_IPV6 /**/ #define HAVE_DECL_ERRNO 1 #define HAVE_SOCKLEN_T /**/ #define HAVE_STRUCT_INADDR /**/ configure: exit 0 mtr-0.85/getopt.h0000664000175000017500000001364612104140215012741 0ustar wolffwolff/* Declarations for getopt. Copyright (C) 1989-1994,1996-1999,2001,2003,2004 Free Software Foundation, Inc. This file is part of the GNU C Library. The GNU C Library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation version 2. The GNU C Library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with the GNU C Library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA. */ #ifndef _GETOPT_H #ifndef __need_getopt #define _GETOPT_H 1 #endif /* If __GNU_LIBRARY__ is not already defined, either we are being used standalone, or this is the first header included in the source file. If we are being used with glibc, we need to include , but that does not exist if we are standalone. So: if __GNU_LIBRARY__ is not defined, include , which will pull in for us if it's from glibc. (Why ctype.h? It's guaranteed to exist and it doesn't flood the namespace with stuff the way some other headers do.) */ #if !defined __GNU_LIBRARY__ # include #endif #ifndef __THROW # ifndef __GNUC_PREREQ # define __GNUC_PREREQ(maj, min) (0) # endif # if defined __cplusplus && __GNUC_PREREQ (2,8) # define __THROW throw () # else # define __THROW # endif #endif #ifdef __cplusplus extern "C" { #endif /* For communication from `getopt' to the caller. When `getopt' finds an option that takes an argument, the argument value is returned here. Also, when `ordering' is RETURN_IN_ORDER, each non-option ARGV-element is returned here. */ extern char *optarg; /* Index in ARGV of the next element to be scanned. This is used for communication to and from the caller and for communication between successive calls to `getopt'. On entry to `getopt', zero means this is the first call; initialize. When `getopt' returns -1, this is the index of the first of the non-option elements that the caller should itself scan. Otherwise, `optind' communicates from one call to the next how much of ARGV has been scanned so far. */ extern int optind; /* Callers store zero here to inhibit the error message `getopt' prints for unrecognized options. */ extern int opterr; /* Set to an option character which was unrecognized. */ extern int optopt; #ifndef __need_getopt /* Describe the long-named options requested by the application. The LONG_OPTIONS argument to getopt_long or getopt_long_only is a vector of `struct option' terminated by an element containing a name which is zero. The field `has_arg' is: no_argument (or 0) if the option does not take an argument, required_argument (or 1) if the option requires an argument, optional_argument (or 2) if the option takes an optional argument. If the field `flag' is not NULL, it points to a variable that is set to the value given in the field `val' when the option is found, but left unchanged if the option is not found. To have a long-named option do something other than set an `int' to a compiled-in constant, such as set a value from `optarg', set the option's `flag' field to zero and its `val' field to a nonzero value (the equivalent single-letter option character, if there is one). For long options that have a zero `flag' field, `getopt' returns the contents of the `val' field. */ struct option { const char *name; /* has_arg can't be an enum because some compilers complain about type mismatches in all the code that assumes it is an int. */ int has_arg; int *flag; int val; }; /* Names for the values of the `has_arg' field of `struct option'. */ #define no_argument 0 #define required_argument 1 #define optional_argument 2 #endif /* need getopt */ /* Get definitions and prototypes for functions to process the arguments in ARGV (ARGC of them, minus the program name) for options given in OPTS. Return the option character from OPTS just read. Return -1 when there are no more options. For unrecognized options, or options missing arguments, `optopt' is set to the option letter, and '?' is returned. The OPTS string is a list of characters which are recognized option letters, optionally followed by colons, specifying that that letter takes an argument, to be placed in `optarg'. If a letter in OPTS is followed by two colons, its argument is optional. This behavior is specific to the GNU `getopt'. The argument `--' causes premature termination of argument scanning, explicitly telling `getopt' that there are no more options. If OPTS begins with `--', then non-option arguments are treated as arguments to the option '\0'. This behavior is specific to the GNU `getopt'. */ #ifdef __GNU_LIBRARY__ /* Many other libraries have conflicting prototypes for getopt, with differences in the consts, in stdlib.h. To avoid compilation errors, only prototype getopt for the GNU C library. */ extern int getopt (int ___argc, char *const *___argv, const char *__shortopts) __THROW; #else /* not __GNU_LIBRARY__ */ extern int getopt (); #endif /* __GNU_LIBRARY__ */ #ifndef __need_getopt extern int getopt_long (int ___argc, char *const *___argv, const char *__shortopts, const struct option *__longopts, int *__longind) __THROW; extern int getopt_long_only (int ___argc, char *const *___argv, const char *__shortopts, const struct option *__longopts, int *__longind) __THROW; #endif #ifdef __cplusplus } #endif /* Make sure we later can get all the definitions and declarations. */ #undef __need_getopt #endif /* getopt.h */ mtr-0.85/split.c0000664000175000017500000000747612104204375012601 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997 Matt Kimball split.c -- raw output (for inclusion in KDE Network Utilities or others GUI based tools) Copyright (C) 1998 Bertrand Leconte This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #include "mtr.h" #include "display.h" #include "dns.h" #include "net.h" #include "split.h" #ifdef NO_CURSES #include #include #include #else /* Use the curses variant */ #if defined(HAVE_NCURSES_H) # include #elif defined(HAVE_NCURSES_CURSES_H) # include #elif defined(HAVE_CURSES_H) # include #else # error No curses header file available #endif #endif extern char *Hostname; extern int WaitTime; extern int af; /* There is 256 hops max in the IP header (coded with a byte) */ #define MAX_LINE_COUNT 256 #define MAX_LINE_SIZE 256 char Lines[MAX_LINE_COUNT][MAX_LINE_SIZE]; int LineCount; #define DEBUG 0 void split_redraw(void) { int max; int at; ip_t *addr; char newLine[MAX_LINE_SIZE]; int i; #if DEBUG fprintf(stderr, "split_redraw()\n"); #endif /* * If there is less lines than last time, we delete them * TEST THIS PLEASE */ max = net_max(); for (i=LineCount; i>max; i--) { printf("-%d\n", i); LineCount--; } /* * For each line, we compute the new one and we compare it to the old one */ for(at = 0; at < max; at++) { addr = net_addr(at); if(addrcmp((void*)addr, (void*)&unspec_addr, af)) { char str[256], *name; if (!(name = dns_lookup(addr))) name = strlongip(addr); if (show_ips) { snprintf(str, sizeof(str), "%s %s", name, strlongip(addr)); name = str; } /* May be we should test name's length */ snprintf(newLine, sizeof(newLine), "%s %d %d %d %d %d %d", name, net_loss(at), net_returned(at), net_xmit(at), net_best(at) /1000, net_avg(at)/1000, net_worst(at)/1000); } else { sprintf(newLine, "???"); } if (strcmp(newLine, Lines[at]) == 0) { /* The same, so do nothing */ #if DEBUG printf("SAME LINE\n"); #endif } else { printf("%d %s\n", at+1, newLine); fflush(stdout); strcpy(Lines[at], newLine); if (LineCount < (at+1)) { LineCount = at+1; } } } } void split_open(void) { int i; #if DEBUG printf("split_open()\n"); #endif LineCount = -1; for (i=0; i 0) { read (0, &c, 1); } else return 0; #else char c = getch(); #endif #if DEBUG printf("split_keyaction()\n"); #endif if(tolower(c) == 'q') return ActionQuit; if(c==3) return ActionQuit; if(tolower(c) == 'r') return ActionReset; return 0; } mtr-0.85/asn.o0000664000175000017500000007340012162522233012231 0ustar wolffwolffELF>ˆ?@@ATUH‰ýSHìdH‹%(H‰„$ˆ1Àè…Àˆº1À¹@H‰çóH«A¸H‰áº¾H‰ïè…Àˆ LcàHl$ HŒ$IäA¸€H‰çH‰êL‰æè…Àˆ1H˜HŶE¶UÁà Ѓø…HƒÅHŒ$A¸€H‰êL‰æH‰çè…ÀˆXH˜HŶE¶UÁà Ѓø…å¶M¶E ¶U Áá Á9Ê …Ò„‹ƒúA¼DNâ»…ÀuhMcäHu H‰ßL‰âèBÆ#H‰ØH‹”$ˆdH3%(…àHÄ[]A\˸…ÒtË¿èH…Àt¼Ç???ë´fA|$HcÿèH…ÀH‰Ãuƒ1À뙀¿è1Àë„¿è1Àésÿÿÿ¿è1Àéaÿÿÿ€H‹ º¾¿è1Àé8ÿÿÿfD¾¿1Àè1Àéÿÿÿ¿è1Àé ÿÿÿèfS¶<|uTH‰ûDÆHƒÃ¶<|tò< tîH‰ßèƒèH˜H¶ €ù|u-HDÿƶH‰ÂHƒè€ù|tî€ù téH‰Ø[Ã< H‰ût¥ë½€ù tÎëåfffff.„AUATUH‰ýSHƒìH…ÿ„;‹ H‹…É…ÍH‰ïèH‰H‰Å1Ûë>AÆ$L‹-H‰ïèHcÓI|$ƒÃI‰DÕL‹-èH‰ÅHcÃI‰lž|H‰ïèH…ÀI‰Ä„¬ƒûu§H‹ ‰ØfDHcЃÀƒøHÇÑuí;~‰‹9ÃU;| ÇH‹HƒÄ[]A\A]ÃD¿€èH…ÀH‰ÃH‰…ÿÿÿH‰ïè1Àë €H˜H‹ÁHƒÄ[]A\A]Àƒû„PÿÿÿƒÃéHÿÿÿ1ÀëÙff.„AUI‰õATI‰üUH‰õS1ÛHƒìE¶DH‰ï¹HÇÂÿÿÿÿ¾HƒëHƒÅD‰ÀAƒàÀèA‰Á1ÀAƒáèHƒûøuÀL‰ïèAÆDÿHƒÄ[]A\A]Ãffffff.„ATUSHì@dH‹%(H‰„$81ÀH…ÿ„Áƒ= „‹H\$0A¸¾1íH‰ß‰Â¶ÈA‰ÁÁê‰L$¶Ì¶Ò‰„$0‰L$‰$AÁé1À¹ºèƒø~”L¤$°1ÀI‰ÙA¸¹º¾L‰çèƒø~e‹=…ÿ…ÓL‰çèH‰ÇèH…ÀH‰Åt?‹5…öt5H‰ßèH…Àt(H‹5ºH‰ÇH‰D$ H‰t$(èf.„H‹”$8dH3%(H‰è…µHÄ@[]A\Ãf.„H\$0L¤$°1íH‰Þè1ÀI‰ÙA¸¹º¾L‰çèƒø~’‹=…ÿ„-ÿÿÿH‹t$(1ÒH‰ßH‰\$ èH…À„ÿÿÿHcH‹@H‹,ÐH…í…OÿÿÿH‹(H…í…CÿÿÿéçþÿÿfD1íé1ÿÿÿèff.„‹‹ 9È|‰ÂÁú÷ùHcÒ‹•ÃfDH˜‹…Ãfffff.„SHƒì dH‹%(H‰D$1Àè‹ ‹5H‰Ã9ñHcÁ‹……ɺH|$A¹‰$A¸LDʹº¾1ÀèH…ÛA¹LD$LE˺1À¹ ¾ ¿èH‹T$dH3%(¸u&HƒÄ [ĉʉÈÁú÷þHcÒ‹•écÿÿÿè‹1À…Òx 1À;•ÀóÀHƒìD‹E…Àx¿€è…À‰t HƒÄÀ¿HƒÄéfHƒìD‹ E…ÉtèÇHƒÄà ÿÿÿÿÿÿÿÿ???@res_init failed @dn_expand failed@Broken DNS reply.@second dn_expand failed@Not a TXT record%x.%x.%s.origin6.asn.cymru.com%d.%d.%d.%d%s.origin.asn.cymru.comAS%s%%-%dsipinfo hash@Broken TXT record (txtlen = %d, size = %d) »8intiŽiŽÔM1«Øxb#ˆ#ˆ#ˆ#ˆ# ˆ#(ˆ#0ˆ#8ˆ#@ˆ#Hˆ#P ˆ#X"¶#`$¼#h&b#p*b#t,p#x0?#€1T#‚2Â#ƒ6Ò#ˆ?{#H†#˜I†# J†#¨K†#°L•#¸Nb#ÀPØ#Ä ´ º¶ »¶# ¼¼# Àb#« ŽÒ Mx Žè MîŽ"-Ê? Ž' M Ž7 M= b{ú8 8Mÿ üì      !"#$%&'()*ùúûüýþÿ€€€ A.þÿ€€ 18 2? 4F Èy Êy ̉ Í™ .‰ M 9™ M D© M  ÆÄ ÏO# @Ù  Fkey Hˆ# I†# KÙ 8©A# ˆ3 M`b^`^`è M†™M†MbM•1†Î1†171•gbîgèvˆ#vˆvèv• bN__s ˆ è>b„__s>ˆ__n>•>èbGˆ GèHŒ‘Ðz ptH†I ‘Ð~ txtJˆ lenKb expKb!Kb!Kb!Kb"r!d{"—!p{#°!w{"ä!Y•!Yˆ$Î|%á Ž M”ˆc &s”ˆ l•b p–ˆŸˆÐ Ÿˆ!¯ˆ!°ˆ i±b j±b'ÉW ÉW Ɉ iÊb bˈ(#Í)A Ÿ%6©Òˆ” Ò” *keyÖš ‘Ð}ך ‘Ð~ valêˆ!ë#K ⪠‘P+Nä %w%l%a$Næ%w%l%a+NÜ~ %w%l%a,!òº   Žª M~ 8º M-„w.ˆª /” 0ˆ1fmt‘`2„3Nu %w%l%a4N%w%l%a5bw6"6,7¥¼7¦¼7§¼7b7b7b7b7:'8af;b b‹ M7>{ 7B7C 7D¿ 7¥¼7¦¼7§¼97b 98b 9?b 99b 9:' 8af;b9>{  9B 9C  9D¿  % : ; I$ > $ >   I : ; : ;I8 : ;  : ;  : ; I8 I !I/ &I& : ; ( !I/ : ; : ;  : ; I : ;  : ; I8 .? : ; ' I 4 : ; I: ; I.? : ;' I .? : ; ' I@: ; I4: ; I 4: ; I!4: ; I" # U$1X Y %1&: ; I'.? : ; ' @(1RUX Y )1 *4: ; I +1RUX Y , U-.1@ ..? : ;' I@/: ;I04: ;I14: ;I 21RUX Y31RUX Y41X Y5.? : ;' I@ 6.? : ;' @74: ; I? < 84: ; I? < 94: ; I?  wwww `w°`aw abwbdwdhwh>w°%U%fVeŽVá V^’‘ÜzŸ’¬vŸ¬ÕVÕëvŸëüvŸü(v Ÿ(Bv ŸŽ©v Ÿ©¾vŸ¾Ï‘ÜzŸÏávŸ (v Ÿ(9V(BS£§P§©SV„PesP…–PÈÙP¾ÇP(1Pü(RŽœR  RüQB\Ž©\  Q’¬v”8$8%8$v”8$8%!Ÿ¬Çv|”8$8%8$v}”8$8%!ŸÕ(v”8$8%8$v”8$8%!ŸŽœv”8$8%8$v”8$8%!Ÿ©¹PÏÙP  v”8$8%8$v”8$8%!Ÿ’¬V¬Õv|Ÿ©¾V(9v|ŸÕBVŽ©VÏáV (VëBvŸŽ©vŸ (vŸwŽ4ŸŒP ( Ÿ@AwA›w›œwœ²w@eUœ¥UjmpŸ@KUK›S›œPœ¥U¥²SÀÂwÂÄwÄÅwÅÉw ÉÍw(ͬw0¬­w(­®w ®°w°²w²¸w¸òw0òów(óôw ôöwöøwøww0ÀëUëùV³½U½áVUùýPý3V36P6®VáîVùVýPpŸ;|ŸNbPb°\áî\ùPùý0Ÿý­SáîSùSYbSbP "w"'w'+w+/w /5w(5Šw0Š‹w(‹Œw ŒŽwŽw‘w 5U5Ž\ 5T5] 57Ÿ 5T5ZVrŒV>ZVZqUqŒv|Ÿ ¢w¢£w£¤w¤«w «áwàáâw âãwãåwåðwð•wà ëUæU‚U[i0Ÿ’P’¶V.h0Ÿhtq3$p"t‚p“µP““µ¶‘À}““<‚S““i ŸiŸiS,i Ÿ,iŸ,i‘Ð~Ÿ< Ÿ<Ÿ<\PdPàáwáåwå–w0–—w— w ½w0àùU P—S˜¤P¤½S:˜ Ÿ¸½ Ÿ:˜8Ÿ¸½8Ÿ:OUO^‘`Ÿ^|X|˜‘`Ÿ¸½‘`ŸP^‘`Ÿ^|X|˜‘`Ÿ¸½‘`ŸP˜ Ÿ¸½ ŸP˜ Ÿ¸½ Ÿàäwäwwww $w$CwCDw,Dëó÷ü>R]agrÖëíóö[Öæèëðó#õý)<FKtú  ¸"'-6:PÄQû /usr/include/x86_64-linux-gnu/bits/usr/lib/gcc/x86_64-linux-gnu/4.6.1/include/usr/include/usr/include/x86_64-linux-gnu/sys/usr/include/arpa/usr/include/netinetasn.cstring3.hstdio2.htypes.hstddef.hstdio.hlibio.htypes.hnameser.hstdint.hin.hsearch.hmtr.hasn.h ÆÖ5ÏÇ #:Z'ZÉ”L$YÉ–ƒI\ùzf ÈTQ;qJ¬_=G&ä[äÏžKe¬›Mvž ‚ žpÖnžÈmt¡&tv#ås®}^;?S¼zÉ’ fwt ‚Ø0YYYƒc‚^xt ‚;g1ƒgŸƒŸ?aò¾ƒ¬gs ‘h‚(ä®:",xÕ~fª<ƒÕ~<«JÕ~fª¬hד¬/–Û~Ȱ.Ý~X¤¬Ü~.s<°.Ý~<s<°<Ð~ž°tÝ~t£J’Û~‚¥"_ÖxŸÉuÇY äK0Yƒ,æ~‚›"XÜ»uCX<<‚ôòswXóT¾8&¨~tØX¨~fب~JÙX§~<Û*w# t„º­’K¾?¸ZHxK¾Y printf__off_t_IO_read_ptr_chainns_s_nsns_c_invalidsize_tns_t_optENTRY_shortbufprevtypestrncpyt_cpns_t_a6ns_t_atmalong long unsigned intasn_openaddrfmtinfo__srciiwidth_lenasn.cns_t_naptrns_c_inns_t_minfonextns_t_nsap_ptrtrimsepns_t_soalong long intsigned char__ns_classns_t_dnamehostns_t_x25ipinfo_nons_t_txtns_t_px__u6_addr16long int_fileno_flagsns_t_mgiihashshort intns_t_isdnuint16_tget_iiwidthsprintfsplit_txtrec_old_offset_offsetns_t_sinkns_t_nxtENTERns_s_prns_t_nsapns_c_noneipinfo_lookupns_s_anns_t_anyns_s_arns_t_keystdinunsigned intfprintf__streamlong unsigned int__ns_sectns_t_sig_IO_write_ptrns_t_nullns_t_ptr_sbufiiwidthitems_adatasizeshort unsigned intns_s_qdip_tis_printiireverse_host6ns_t_loc_IO_save_baseentryitems_tns_t_maxns_c_chaosns_t_rp_lockns_t_rt_flags2_modens_t_gposstdoutget_ipinfoipinfoanswerns_t_axfrtxtlen_IO_read_endipinfo_max__retval__u_charns_t_kxns_t_cnameu_charitem__destns_t_aplns_t_nimloc_IO_lock_tns_t_mailb_IO_FILE/home/wolff/mtrns_t_invalid__in6_uns_t_srvu_int16_tns_s_znns_t_ixfr_posns_t_cert__ns_typens_c_2_markersns_t_tkeyns_c_anyns_t_aunsigned charfmt_ipinfotxtrec_IO_buf_endns_t_tsigns_t_mailabuff_unused2__len_vtable_offsetFILEns_t_afsdbin6_addrns_t_zxfruint32_tns_c_max__chGNU C 4.6.1ns_t_mbns_t_mdns_t_mfcharns_t_mr__u6_addr8ns_t_mxns_s_maxasn_close_next__off64_t_cur_column_IO_read_basememcpy_IO_save_end__fmt__pad1__pad2__pad3__pad4__pad5snprintf_IO_write_endlookup_keystderrmemset_IO_markerns_t_eiduint8_t_IO_backup_basens_t_nsns_s_uddomainns_t_wks_IO_buf_basefound_itemns_t_aaaa__u6_addr32FIND_IO_write_basens_t_hinfoitemsns_c_hsGCC: (Ubuntu/Linaro 4.6.1-9ubuntu3) 4.6.1zRx 4>BŒA†D ƒG°R  AABD TrAƒZ A LtUBBŒA †D(ƒD0ß (A ABBF z (A ABBH 4ÄqBEŒD †D(ƒF0U(A ABB4üõBŒA†A ƒGà6  AABK 42 HÝAƒD0± AI l€>Dd H I $D_.symtab.strtab.shstrtab.rela.text.rela.data.bss.rodata.str1.1.rodata.str1.8.rela.debug_info.debug_abbrev.rela.debug_loc.rela.debug_aranges.debug_ranges.rela.debug_line.debug_str.comment.note.GNU-stack.rela.eh_frame @DèL¸+,& U1¼62¼ÃE2€ -Y­ ¿T¸UPel"xŽQsuÀ ˆß/0ƒÈu0 —0ðªÿ1È¥øu¶0Ç5êÁ0±<+ÊÜ<ßà<¸Úvð˜>éFX `K„ñÿ   > ,8?òÿ €FNUZahu†@rŽ•ÀU¢¨¯$º(ÄÉ q×å õðó  2+3àÝ>òÿ FÀQà>Zbi $s|òÿ €asn.cipinfo_lookup__res_init__res_query__dn_expandiihashtxtrecstrncpymallocputsstderrfwrite__printf_chk__stack_chk_failtrimsepstrlensplit_txtrecitemsstrchripinfo_maxipinfo_nofreereverse_host6__sprintf_chkget_ipinfoaf__snprintf_chk__strduphsearchget_iiwidthiiwidth_leniiwidthfmt_ipinfofmtinfois_printiiasn_openhcreateperrorasn_closehdestroyitems_a"üÿÿÿÿÿÿÿRüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿÄüÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ  6üÿÿÿÿÿÿÿjüÿÿÿÿÿÿÿo }üÿÿÿÿÿÿÿ™üÿÿÿÿÿÿÿ± (¶üÿÿÿÿÿÿÿ¿ ÄüÿÿÿÿÿÿÿÑ TÖüÿÿÿÿÿÿÿëüÿÿÿÿÿÿÿú ÿüÿÿÿÿÿÿÿ üÿÿÿÿÿÿÿ) ;.üÿÿÿÿÿÿÿ:üÿÿÿÿÿÿÿfüÿÿÿÿÿÿÿØüÿÿÿÿÿÿÿß!üÿÿÿÿÿÿÿïüÿÿÿÿÿÿÿ!üÿÿÿÿÿÿÿüÿÿÿÿÿÿÿ'!üÿÿÿÿÿÿÿ,üÿÿÿÿÿÿÿD"üÿÿÿÿÿÿÿ\!üÿÿÿÿÿÿÿ}#üÿÿÿÿÿÿÿ…#üÿÿÿÿÿÿÿ‹$üÿÿÿÿÿÿÿ•#üÿÿÿÿÿÿÿ$øÿÿÿÿÿÿÿ¾üÿÿÿÿÿÿÿË!üÿÿÿÿÿÿÿÙ%üÿÿÿÿÿÿÿB fn'üÿÿÿÿÿÿÿ|üÿÿÿÿÿÿÿÉ)ûÿÿÿÿÿÿÿÝ †*üÿÿÿÿÿÿÿ; ’R*üÿÿÿÿÿÿÿ]üÿÿÿÿÿÿÿmüÿÿÿÿÿÿÿu üÿÿÿÿÿÿÿƒüÿÿÿÿÿÿÿ+üÿÿÿÿÿÿÿ›!üÿÿÿÿÿÿÿ²,üÿÿÿÿÿÿÿ&üÿÿÿÿÿÿÿ m%*üÿÿÿÿÿÿÿ0üÿÿÿÿÿÿÿL,üÿÿÿÿÿÿÿ\$üÿÿÿÿÿÿÿ‘üÿÿÿÿÿÿÿ¢$üÿÿÿÿÿÿÿ¨.üÿÿÿÿÿÿÿ½ /Í /ö(üÿÿÿÿÿÿÿü$üÿÿÿÿÿÿÿ.üÿÿÿÿÿÿÿ / «) ª2 ®L*üÿÿÿÿÿÿÿU t 1y*üÿÿÿÿÿÿÿŒ 1¯ /¹üÿÿÿÿÿÿÿÂ$üÿÿÿÿÿÿÿÐ#üÿÿÿÿÿÿÿç$üÿÿÿÿÿÿÿö4üÿÿÿÿÿÿÿþüÿÿÿÿÿÿÿ ·'üÿÿÿÿÿÿÿ17üÿÿÿÿÿÿÿ7øÿÿÿÿÿÿÿ5üÿÿÿÿÿÿÿ8  U À *!D) . Ç; ·B ÕI QP oW ^ ”l mq | ²‘ y– 8¡ ¬ !¹ ~È × ¦æ Èõ  ” " 1 ×@ O _^ Ým ”| ‹ vš ]© Ò¸ ¼È Ø Nè Oø Þ ð ÷( þ8 H X eh ýy € CŒ ¬š µ¨ tö û ã X ? K èQ bW )] ÿc #i wo :u ™ž ƒª :° °¶ o¼ i qÈ ØÎ ÿÔ aÚ …à ~æ ¢ì †ò ¬ø Ñþ Ù ‘  P G  =" ž( U. 4 é: ‹@ BF YL kR §X ^ ðd Nj ÿp Ov w| Æ‚ Ј yŽ o” -š æ  ?¦ ö¬ ³ 㺠jÁ •È Ï íÖ 1Ý 4ä 3í "ú + Ñ   < â  §& G/ W: ¨E >X †c an ±ª +¶ GÍ ½Ó ùÚ %ô Ë H ð +5 ^G fR êf <x ïƒ PŽ › Ö­ ï¸ ®Ã Ð â êð b ï  ® % ½B êP x ê† ±•  ¨>° ¹ à ÚÈ Žà 6å 8þ U  ž Ô! Ð+ 00 Ÿ: y? ]I ÕN’VŸc jm ÝsÕ{∠j’ =˜ ¡ j« ™±w¹Æ Ð èÕ ¾ß éñ! / ÷# @+ ²3 [D »Q ñ^ e Åp Àx € …‰ Г ý˜ X¢ l § ä± î ¾ ‡ Ë ä Ò Ù  á ‘é  ò ¡ü   ø <  r % – . >6 0C fQ ß _ |j  r •z * ƒ ¡ ¡ *º M¿ êÉ ØÎ p× øé Öñ À / [ € ,$ V3 £< ÏE ôP õX g p Fy k @„ œŽ ŽÅ  Í ÒÚ Åæ àî ½ö ±ÿ ¡ 9 ‡ \2 ú: pF "N °^ ¸g p 8z S‚ }’ ­› ¤ I¬ õ¸ ÀÀ ÙÍ ˜Õ àÝ å ‘ë ¢ó  û D  K u" 5/ F< ³I ´V c ¦Œ »™ æ г ÜÆ KÓ uà 5í Fú $ ³# ´&./ <E ¦R1g »t/} Ê8“ Р© ܶ!BB†¶’-mË®ç®\1x1 ^ X@xÀÈ  8 LàpÀ„ठmtr-0.85/Makefile.in0000664000175000017500000007570412162521740013350 0ustar wolffwolff# Makefile.in generated by automake 1.11.1 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009 Free Software Foundation, # Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : sbin_PROGRAMS = mtr$(EXEEXT) @IPINFO_TRUE@am__append_1 = asn.c asn.h subdir = . DIST_COMMON = README $(am__configure_deps) $(srcdir)/Makefile.am \ $(srcdir)/Makefile.in $(srcdir)/config.h.in \ $(srcdir)/version.h.in $(top_srcdir)/configure AUTHORS COPYING \ NEWS TODO depcomp install-sh missing ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) am__CONFIG_DISTCLEAN_FILES = config.status config.cache config.log \ configure.lineno config.status.lineno mkinstalldirs = $(install_sh) -d CONFIG_HEADER = config.h CONFIG_CLEAN_FILES = version.h.tmp CONFIG_CLEAN_VPATH_FILES = am__installdirs = "$(DESTDIR)$(sbindir)" "$(DESTDIR)$(man8dir)" PROGRAMS = $(sbin_PROGRAMS) am__mtr_SOURCES_DIST = mtr.c net.c net.h dns.c dns.h raw.c raw.h \ split.c split.h display.c display.h report.c report.h getopt.c \ getopt1.c getopt.h select.c select.h mtr-curses.h mtr-gtk.h \ asn.c asn.h @IPINFO_TRUE@am__objects_1 = asn.$(OBJEXT) am_mtr_OBJECTS = mtr.$(OBJEXT) net.$(OBJEXT) dns.$(OBJEXT) \ raw.$(OBJEXT) split.$(OBJEXT) display.$(OBJEXT) \ report.$(OBJEXT) getopt.$(OBJEXT) getopt1.$(OBJEXT) \ select.$(OBJEXT) $(am__objects_1) nodist_mtr_OBJECTS = mtr_OBJECTS = $(am_mtr_OBJECTS) $(nodist_mtr_OBJECTS) am__DEPENDENCIES_1 = mtr_LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(mtr_LDFLAGS) $(LDFLAGS) -o \ $@ depcomp = $(SHELL) $(top_srcdir)/depcomp am__depfiles_maybe = depfiles am__mv = mv -f COMPILE = $(CC) $(DEFS) $(DEFAULT_INCLUDES) $(INCLUDES) $(AM_CPPFLAGS) \ $(CPPFLAGS) $(AM_CFLAGS) $(CFLAGS) CCLD = $(CC) LINK = $(CCLD) $(AM_CFLAGS) $(CFLAGS) $(AM_LDFLAGS) $(LDFLAGS) -o $@ SOURCES = $(mtr_SOURCES) $(EXTRA_mtr_SOURCES) $(nodist_mtr_SOURCES) DIST_SOURCES = $(am__mtr_SOURCES_DIST) $(EXTRA_mtr_SOURCES) RECURSIVE_TARGETS = all-recursive check-recursive dvi-recursive \ html-recursive info-recursive install-data-recursive \ install-dvi-recursive install-exec-recursive \ install-html-recursive install-info-recursive \ install-pdf-recursive install-ps-recursive install-recursive \ installcheck-recursive installdirs-recursive pdf-recursive \ ps-recursive uninstall-recursive am__vpath_adj_setup = srcdirstrip=`echo "$(srcdir)" | sed 's|.|.|g'`; am__vpath_adj = case $$p in \ $(srcdir)/*) f=`echo "$$p" | sed "s|^$$srcdirstrip/||"`;; \ *) f=$$p;; \ esac; am__strip_dir = f=`echo $$p | sed -e 's|^.*/||'`; am__install_max = 40 am__nobase_strip_setup = \ srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*|]/\\\\&/g'` am__nobase_strip = \ for p in $$list; do echo "$$p"; done | sed -e "s|$$srcdirstrip/||" am__nobase_list = $(am__nobase_strip_setup); \ for p in $$list; do echo "$$p $$p"; done | \ sed "s| $$srcdirstrip/| |;"' / .*\//!s/ .*/ ./; s,\( .*\)/[^/]*$$,\1,' | \ $(AWK) 'BEGIN { files["."] = "" } { files[$$2] = files[$$2] " " $$1; \ if (++n[$$2] == $(am__install_max)) \ { print $$2, files[$$2]; n[$$2] = 0; files[$$2] = "" } } \ END { for (dir in files) print dir, files[dir] }' am__base_list = \ sed '$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;$$!N;s/\n/ /g' | \ sed '$$!N;$$!N;$$!N;$$!N;s/\n/ /g' man8dir = $(mandir)/man8 NROFF = nroff MANS = $(man_MANS) RECURSIVE_CLEAN_TARGETS = mostlyclean-recursive clean-recursive \ distclean-recursive maintainer-clean-recursive AM_RECURSIVE_TARGETS = $(RECURSIVE_TARGETS:-recursive=) \ $(RECURSIVE_CLEAN_TARGETS:-recursive=) tags TAGS ctags CTAGS \ distdir dist dist-all distcheck ETAGS = etags CTAGS = ctags DIST_SUBDIRS = $(SUBDIRS) DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) distdir = $(PACKAGE)-$(VERSION) top_distdir = $(distdir) am__remove_distdir = \ { test ! -d "$(distdir)" \ || { find "$(distdir)" -type d ! -perm -200 -exec chmod u+w {} ';' \ && rm -fr "$(distdir)"; }; } am__relativize = \ dir0=`pwd`; \ sed_first='s,^\([^/]*\)/.*$$,\1,'; \ sed_rest='s,^[^/]*/*,,'; \ sed_last='s,^.*/\([^/]*\)$$,\1,'; \ sed_butlast='s,/*[^/]*$$,,'; \ while test -n "$$dir1"; do \ first=`echo "$$dir1" | sed -e "$$sed_first"`; \ if test "$$first" != "."; then \ if test "$$first" = ".."; then \ dir2=`echo "$$dir0" | sed -e "$$sed_last"`/"$$dir2"; \ dir0=`echo "$$dir0" | sed -e "$$sed_butlast"`; \ else \ first2=`echo "$$dir2" | sed -e "$$sed_first"`; \ if test "$$first2" = "$$first"; then \ dir2=`echo "$$dir2" | sed -e "$$sed_rest"`; \ else \ dir2="../$$dir2"; \ fi; \ dir0="$$dir0"/"$$first"; \ fi; \ fi; \ dir1=`echo "$$dir1" | sed -e "$$sed_rest"`; \ done; \ reldir="$$dir2" DIST_ARCHIVES = $(distdir).tar.gz GZIP_ENV = --best distuninstallcheck_listfiles = find . -type f -print distcleancheck_listfiles = find . -type f -print ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CURSES_OBJ = @CURSES_OBJ@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ EXEEXT = @EXEEXT@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GREP = @GREP@ GTK_CFLAGS = @GTK_CFLAGS@ GTK_LIBS = @GTK_LIBS@ GTK_OBJ = @GTK_OBJ@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ PKG_CONFIG_LIBDIR = @PKG_CONFIG_LIBDIR@ PKG_CONFIG_PATH = @PKG_CONFIG_PATH@ RESOLV_LIBS = @RESOLV_LIBS@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ ac_ct_CC = @ac_ct_CC@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ SUBDIRS = img man_MANS = mtr.8 mtr_SOURCES = mtr.c net.c net.h dns.c dns.h raw.c raw.h split.c \ split.h display.c display.h report.c report.h getopt.c \ getopt1.c getopt.h select.c select.h mtr-curses.h mtr-gtk.h \ $(am__append_1) nodist_mtr_SOURCES = version.h EXTRA_mtr_SOURCES = curses.c \ gtk.c DEFAULT_INCLUDES = $(GLIB_CFLAGS) -I. mtr_DEPENDENCIES = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDFLAGS = $(GTK_OBJ) $(CURSES_OBJ) mtr_LDADD = $(GLIB_LIBS) $(RESOLV_LIBS) CLEANFILES = version.h BUILT_SOURCES = version.h EXTRA_DIST = SECURITY mtr.8 Makefile Makefile.dist DISTCLEANFILES = *~ all: $(BUILT_SOURCES) config.h $(MAKE) $(AM_MAKEFLAGS) all-recursive .SUFFIXES: .SUFFIXES: .c .o .obj am--refresh: @: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ echo ' cd $(srcdir) && $(AUTOMAKE) --foreign'; \ $(am__cd) $(srcdir) && $(AUTOMAKE) --foreign \ && exit 0; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --foreign Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ echo ' $(SHELL) ./config.status'; \ $(SHELL) ./config.status;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) $(SHELL) ./config.status --recheck $(top_srcdir)/configure: $(am__configure_deps) $(am__cd) $(srcdir) && $(AUTOCONF) $(ACLOCAL_M4): $(am__aclocal_m4_deps) $(am__cd) $(srcdir) && $(ACLOCAL) $(ACLOCAL_AMFLAGS) $(am__aclocal_m4_deps): config.h: stamp-h1 @if test ! -f $@; then \ rm -f stamp-h1; \ $(MAKE) $(AM_MAKEFLAGS) stamp-h1; \ else :; fi stamp-h1: $(srcdir)/config.h.in $(top_builddir)/config.status @rm -f stamp-h1 cd $(top_builddir) && $(SHELL) ./config.status config.h $(srcdir)/config.h.in: $(am__configure_deps) ($(am__cd) $(top_srcdir) && $(AUTOHEADER)) rm -f stamp-h1 touch $@ distclean-hdr: -rm -f config.h stamp-h1 version.h.tmp: $(top_builddir)/config.status $(srcdir)/version.h.in cd $(top_builddir) && $(SHELL) ./config.status $@ install-sbinPROGRAMS: $(sbin_PROGRAMS) @$(NORMAL_INSTALL) test -z "$(sbindir)" || $(MKDIR_P) "$(DESTDIR)$(sbindir)" @list='$(sbin_PROGRAMS)'; test -n "$(sbindir)" || list=; \ for p in $$list; do echo "$$p $$p"; done | \ sed 's/$(EXEEXT)$$//' | \ while read p p1; do if test -f $$p; \ then echo "$$p"; echo "$$p"; else :; fi; \ done | \ sed -e 'p;s,.*/,,;n;h' -e 's|.*|.|' \ -e 'p;x;s,.*/,,;s/$(EXEEXT)$$//;$(transform);s/$$/$(EXEEXT)/' | \ sed 'N;N;N;s,\n, ,g' | \ $(AWK) 'BEGIN { files["."] = ""; dirs["."] = 1 } \ { d=$$3; if (dirs[d] != 1) { print "d", d; dirs[d] = 1 } \ if ($$2 == $$4) files[d] = files[d] " " $$1; \ else { print "f", $$3 "/" $$4, $$1; } } \ END { for (d in files) print "f", d, files[d] }' | \ while read type dir files; do \ if test "$$dir" = .; then dir=; else dir=/$$dir; fi; \ test -z "$$files" || { \ echo " $(INSTALL_PROGRAM_ENV) $(INSTALL_PROGRAM) $$files '$(DESTDIR)$(sbindir)$$dir'"; \ $(INSTALL_PROGRAM_ENV) $(INSTALL_PROGRAM) $$files "$(DESTDIR)$(sbindir)$$dir" || exit $$?; \ } \ ; done uninstall-sbinPROGRAMS: @$(NORMAL_UNINSTALL) @list='$(sbin_PROGRAMS)'; test -n "$(sbindir)" || list=; \ files=`for p in $$list; do echo "$$p"; done | \ sed -e 'h;s,^.*/,,;s/$(EXEEXT)$$//;$(transform)' \ -e 's/$$/$(EXEEXT)/' `; \ test -n "$$list" || exit 0; \ echo " ( cd '$(DESTDIR)$(sbindir)' && rm -f" $$files ")"; \ cd "$(DESTDIR)$(sbindir)" && rm -f $$files clean-sbinPROGRAMS: -test -z "$(sbin_PROGRAMS)" || rm -f $(sbin_PROGRAMS) mtr$(EXEEXT): $(mtr_OBJECTS) $(mtr_DEPENDENCIES) @rm -f mtr$(EXEEXT) $(mtr_LINK) $(mtr_OBJECTS) $(mtr_LDADD) $(LIBS) mostlyclean-compile: -rm -f *.$(OBJEXT) distclean-compile: -rm -f *.tab.c @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/asn.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/curses.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/display.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/dns.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/getopt.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/getopt1.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/gtk.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/mtr.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/net.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/raw.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/report.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/select.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/split.Po@am__quote@ .c.o: @am__fastdepCC_TRUE@ $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ $< @am__fastdepCC_TRUE@ $(am__mv) $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c $< .c.obj: @am__fastdepCC_TRUE@ $(COMPILE) -MT $@ -MD -MP -MF $(DEPDIR)/$*.Tpo -c -o $@ `$(CYGPATH_W) '$<'` @am__fastdepCC_TRUE@ $(am__mv) $(DEPDIR)/$*.Tpo $(DEPDIR)/$*.Po @AMDEP_TRUE@@am__fastdepCC_FALSE@ source='$<' object='$@' libtool=no @AMDEPBACKSLASH@ @AMDEP_TRUE@@am__fastdepCC_FALSE@ DEPDIR=$(DEPDIR) $(CCDEPMODE) $(depcomp) @AMDEPBACKSLASH@ @am__fastdepCC_FALSE@ $(COMPILE) -c `$(CYGPATH_W) '$<'` install-man8: $(man_MANS) @$(NORMAL_INSTALL) test -z "$(man8dir)" || $(MKDIR_P) "$(DESTDIR)$(man8dir)" @list=''; test -n "$(man8dir)" || exit 0; \ { for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.8[a-z]*$$/p'; \ } | while read p; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ echo "$$d$$p"; echo "$$p"; \ done | \ sed -e 'n;s,.*/,,;p;h;s,.*\.,,;s,^[^8][0-9a-z]*$$,8,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,' | \ sed 'N;N;s,\n, ,g' | { \ list=; while read file base inst; do \ if test "$$base" = "$$inst"; then list="$$list $$file"; else \ echo " $(INSTALL_DATA) '$$file' '$(DESTDIR)$(man8dir)/$$inst'"; \ $(INSTALL_DATA) "$$file" "$(DESTDIR)$(man8dir)/$$inst" || exit $$?; \ fi; \ done; \ for i in $$list; do echo "$$i"; done | $(am__base_list) | \ while read files; do \ test -z "$$files" || { \ echo " $(INSTALL_DATA) $$files '$(DESTDIR)$(man8dir)'"; \ $(INSTALL_DATA) $$files "$(DESTDIR)$(man8dir)" || exit $$?; }; \ done; } uninstall-man8: @$(NORMAL_UNINSTALL) @list=''; test -n "$(man8dir)" || exit 0; \ files=`{ for i in $$list; do echo "$$i"; done; \ l2='$(man_MANS)'; for i in $$l2; do echo "$$i"; done | \ sed -n '/\.8[a-z]*$$/p'; \ } | sed -e 's,.*/,,;h;s,.*\.,,;s,^[^8][0-9a-z]*$$,8,;x' \ -e 's,\.[0-9a-z]*$$,,;$(transform);G;s,\n,.,'`; \ test -z "$$files" || { \ echo " ( cd '$(DESTDIR)$(man8dir)' && rm -f" $$files ")"; \ cd "$(DESTDIR)$(man8dir)" && rm -f $$files; } # This directory's subdirectories are mostly independent; you can cd # into them and run `make' without going through this Makefile. # To change the values of `make' variables: instead of editing Makefiles, # (1) if the variable is set in `config.status', edit `config.status' # (which will cause the Makefiles to be regenerated when you run `make'); # (2) otherwise, pass the desired values on the `make' command line. $(RECURSIVE_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ target=`echo $@ | sed s/-recursive//`; \ list='$(SUBDIRS)'; for subdir in $$list; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ dot_seen=yes; \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done; \ if test "$$dot_seen" = "no"; then \ $(MAKE) $(AM_MAKEFLAGS) "$$target-am" || exit 1; \ fi; test -z "$$fail" $(RECURSIVE_CLEAN_TARGETS): @fail= failcom='exit 1'; \ for f in x $$MAKEFLAGS; do \ case $$f in \ *=* | --[!k]*);; \ *k*) failcom='fail=yes';; \ esac; \ done; \ dot_seen=no; \ case "$@" in \ distclean-* | maintainer-clean-*) list='$(DIST_SUBDIRS)' ;; \ *) list='$(SUBDIRS)' ;; \ esac; \ rev=''; for subdir in $$list; do \ if test "$$subdir" = "."; then :; else \ rev="$$subdir $$rev"; \ fi; \ done; \ rev="$$rev ."; \ target=`echo $@ | sed s/-recursive//`; \ for subdir in $$rev; do \ echo "Making $$target in $$subdir"; \ if test "$$subdir" = "."; then \ local_target="$$target-am"; \ else \ local_target="$$target"; \ fi; \ ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) $$local_target) \ || eval $$failcom; \ done && test -z "$$fail" tags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) tags); \ done ctags-recursive: list='$(SUBDIRS)'; for subdir in $$list; do \ test "$$subdir" = . || ($(am__cd) $$subdir && $(MAKE) $(AM_MAKEFLAGS) ctags); \ done ID: $(HEADERS) $(SOURCES) $(LISP) $(TAGS_FILES) list='$(SOURCES) $(HEADERS) $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ mkid -fID $$unique tags: TAGS TAGS: tags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) set x; \ here=`pwd`; \ if ($(ETAGS) --etags-include --version) >/dev/null 2>&1; then \ include_option=--etags-include; \ empty_fix=.; \ else \ include_option=--include; \ empty_fix=; \ fi; \ list='$(SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test ! -f $$subdir/TAGS || \ set "$$@" "$$include_option=$$here/$$subdir/TAGS"; \ fi; \ done; \ list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ shift; \ if test -z "$(ETAGS_ARGS)$$*$$unique"; then :; else \ test -n "$$unique" || unique=$$empty_fix; \ if test $$# -gt 0; then \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ "$$@" $$unique; \ else \ $(ETAGS) $(ETAGSFLAGS) $(AM_ETAGSFLAGS) $(ETAGS_ARGS) \ $$unique; \ fi; \ fi ctags: CTAGS CTAGS: ctags-recursive $(HEADERS) $(SOURCES) config.h.in $(TAGS_DEPENDENCIES) \ $(TAGS_FILES) $(LISP) list='$(SOURCES) $(HEADERS) config.h.in $(LISP) $(TAGS_FILES)'; \ unique=`for i in $$list; do \ if test -f "$$i"; then echo $$i; else echo $(srcdir)/$$i; fi; \ done | \ $(AWK) '{ files[$$0] = 1; nonempty = 1; } \ END { if (nonempty) { for (i in files) print i; }; }'`; \ test -z "$(CTAGS_ARGS)$$unique" \ || $(CTAGS) $(CTAGSFLAGS) $(AM_CTAGSFLAGS) $(CTAGS_ARGS) \ $$unique GTAGS: here=`$(am__cd) $(top_builddir) && pwd` \ && $(am__cd) $(top_srcdir) \ && gtags -i $(GTAGS_ARGS) "$$here" distclean-tags: -rm -f TAGS ID GTAGS GRTAGS GSYMS GPATH tags distdir: $(DISTFILES) @list='$(MANS)'; if test -n "$$list"; then \ list=`for p in $$list; do \ if test -f $$p; then d=; else d="$(srcdir)/"; fi; \ if test -f "$$d$$p"; then echo "$$d$$p"; else :; fi; done`; \ if test -n "$$list" && \ grep 'ab help2man is required to generate this page' $$list >/dev/null; then \ echo "error: found man pages containing the \`missing help2man' replacement text:" >&2; \ grep -l 'ab help2man is required to generate this page' $$list | sed 's/^/ /' >&2; \ echo " to fix them, install help2man, remove and regenerate the man pages;" >&2; \ echo " typically \`make maintainer-clean' will remove them" >&2; \ exit 1; \ else :; fi; \ else :; fi $(am__remove_distdir) test -d "$(distdir)" || mkdir "$(distdir)" @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ test -d "$(distdir)/$$subdir" \ || $(MKDIR_P) "$(distdir)/$$subdir" \ || exit 1; \ fi; \ done @list='$(DIST_SUBDIRS)'; for subdir in $$list; do \ if test "$$subdir" = .; then :; else \ dir1=$$subdir; dir2="$(distdir)/$$subdir"; \ $(am__relativize); \ new_distdir=$$reldir; \ dir1=$$subdir; dir2="$(top_distdir)"; \ $(am__relativize); \ new_top_distdir=$$reldir; \ echo " (cd $$subdir && $(MAKE) $(AM_MAKEFLAGS) top_distdir="$$new_top_distdir" distdir="$$new_distdir" \\"; \ echo " am__remove_distdir=: am__skip_length_check=: am__skip_mode_fix=: distdir)"; \ ($(am__cd) $$subdir && \ $(MAKE) $(AM_MAKEFLAGS) \ top_distdir="$$new_top_distdir" \ distdir="$$new_distdir" \ am__remove_distdir=: \ am__skip_length_check=: \ am__skip_mode_fix=: \ distdir) \ || exit 1; \ fi; \ done -test -n "$(am__skip_mode_fix)" \ || find "$(distdir)" -type d ! -perm -755 \ -exec chmod u+rwx,go+rx {} \; -o \ ! -type d ! -perm -444 -links 1 -exec chmod a+r {} \; -o \ ! -type d ! -perm -400 -exec chmod a+r {} \; -o \ ! -type d ! -perm -444 -exec $(install_sh) -c -m a+r {} {} \; \ || chmod -R a+r "$(distdir)" dist-gzip: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) dist-bzip2: distdir tardir=$(distdir) && $(am__tar) | bzip2 -9 -c >$(distdir).tar.bz2 $(am__remove_distdir) dist-lzma: distdir tardir=$(distdir) && $(am__tar) | lzma -9 -c >$(distdir).tar.lzma $(am__remove_distdir) dist-xz: distdir tardir=$(distdir) && $(am__tar) | xz -c >$(distdir).tar.xz $(am__remove_distdir) dist-tarZ: distdir tardir=$(distdir) && $(am__tar) | compress -c >$(distdir).tar.Z $(am__remove_distdir) dist-shar: distdir shar $(distdir) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).shar.gz $(am__remove_distdir) dist-zip: distdir -rm -f $(distdir).zip zip -rq $(distdir).zip $(distdir) $(am__remove_distdir) dist dist-all: distdir tardir=$(distdir) && $(am__tar) | GZIP=$(GZIP_ENV) gzip -c >$(distdir).tar.gz $(am__remove_distdir) # This target untars the dist file and tries a VPATH configuration. Then # it guarantees that the distribution is self-contained by making another # tarfile. distcheck: dist case '$(DIST_ARCHIVES)' in \ *.tar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).tar.gz | $(am__untar) ;;\ *.tar.bz2*) \ bzip2 -dc $(distdir).tar.bz2 | $(am__untar) ;;\ *.tar.lzma*) \ lzma -dc $(distdir).tar.lzma | $(am__untar) ;;\ *.tar.xz*) \ xz -dc $(distdir).tar.xz | $(am__untar) ;;\ *.tar.Z*) \ uncompress -c $(distdir).tar.Z | $(am__untar) ;;\ *.shar.gz*) \ GZIP=$(GZIP_ENV) gzip -dc $(distdir).shar.gz | unshar ;;\ *.zip*) \ unzip $(distdir).zip ;;\ esac chmod -R a-w $(distdir); chmod a+w $(distdir) mkdir $(distdir)/_build mkdir $(distdir)/_inst chmod a-w $(distdir) test -d $(distdir)/_build || exit 0; \ dc_install_base=`$(am__cd) $(distdir)/_inst && pwd | sed -e 's,^[^:\\/]:[\\/],/,'` \ && dc_destdir="$${TMPDIR-/tmp}/am-dc-$$$$/" \ && am__cwd=`pwd` \ && $(am__cd) $(distdir)/_build \ && ../configure --srcdir=.. --prefix="$$dc_install_base" \ $(DISTCHECK_CONFIGURE_FLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) \ && $(MAKE) $(AM_MAKEFLAGS) dvi \ && $(MAKE) $(AM_MAKEFLAGS) check \ && $(MAKE) $(AM_MAKEFLAGS) install \ && $(MAKE) $(AM_MAKEFLAGS) installcheck \ && $(MAKE) $(AM_MAKEFLAGS) uninstall \ && $(MAKE) $(AM_MAKEFLAGS) distuninstallcheck_dir="$$dc_install_base" \ distuninstallcheck \ && chmod -R a-w "$$dc_install_base" \ && ({ \ (cd ../.. && umask 077 && mkdir "$$dc_destdir") \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" install \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" uninstall \ && $(MAKE) $(AM_MAKEFLAGS) DESTDIR="$$dc_destdir" \ distuninstallcheck_dir="$$dc_destdir" distuninstallcheck; \ } || { rm -rf "$$dc_destdir"; exit 1; }) \ && rm -rf "$$dc_destdir" \ && $(MAKE) $(AM_MAKEFLAGS) dist \ && rm -rf $(DIST_ARCHIVES) \ && $(MAKE) $(AM_MAKEFLAGS) distcleancheck \ && cd "$$am__cwd" \ || exit 1 $(am__remove_distdir) @(echo "$(distdir) archives ready for distribution: "; \ list='$(DIST_ARCHIVES)'; for i in $$list; do echo $$i; done) | \ sed -e 1h -e 1s/./=/g -e 1p -e 1x -e '$$p' -e '$$x' distuninstallcheck: @$(am__cd) '$(distuninstallcheck_dir)' \ && test `$(distuninstallcheck_listfiles) | wc -l` -le 1 \ || { echo "ERROR: files left after uninstall:" ; \ if test -n "$(DESTDIR)"; then \ echo " (check DESTDIR support)"; \ fi ; \ $(distuninstallcheck_listfiles) ; \ exit 1; } >&2 distcleancheck: distclean @if test '$(srcdir)' = . ; then \ echo "ERROR: distcleancheck can only run from a VPATH build" ; \ exit 1 ; \ fi @test `$(distcleancheck_listfiles) | wc -l` -eq 0 \ || { echo "ERROR: files left in build directory after distclean:" ; \ $(distcleancheck_listfiles) ; \ exit 1; } >&2 check-am: all-am check: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) check-recursive all-am: Makefile $(PROGRAMS) $(MANS) config.h installdirs: installdirs-recursive installdirs-am: for dir in "$(DESTDIR)$(sbindir)" "$(DESTDIR)$(man8dir)"; do \ test -z "$$dir" || $(MKDIR_P) "$$dir"; \ done install: $(BUILT_SOURCES) $(MAKE) $(AM_MAKEFLAGS) install-recursive install-exec: install-exec-recursive install-data: install-data-recursive uninstall: uninstall-recursive install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-recursive install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: -test -z "$(CLEANFILES)" || rm -f $(CLEANFILES) distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) -test -z "$(DISTCLEANFILES)" || rm -f $(DISTCLEANFILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." -test -z "$(BUILT_SOURCES)" || rm -f $(BUILT_SOURCES) clean: clean-recursive clean-am: clean-generic clean-sbinPROGRAMS mostlyclean-am distclean: distclean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf ./$(DEPDIR) -rm -f Makefile distclean-am: clean-am distclean-compile distclean-generic \ distclean-hdr distclean-local distclean-tags dvi: dvi-recursive dvi-am: html: html-recursive html-am: info: info-recursive info-am: install-data-am: install-man install-dvi: install-dvi-recursive install-dvi-am: install-exec-am: install-sbinPROGRAMS @$(NORMAL_INSTALL) $(MAKE) $(AM_MAKEFLAGS) install-exec-hook install-html: install-html-recursive install-html-am: install-info: install-info-recursive install-info-am: install-man: install-man8 install-pdf: install-pdf-recursive install-pdf-am: install-ps: install-ps-recursive install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-recursive -rm -f $(am__CONFIG_DISTCLEAN_FILES) -rm -rf $(top_srcdir)/autom4te.cache -rm -rf ./$(DEPDIR) -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-recursive mostlyclean-am: mostlyclean-compile mostlyclean-generic pdf: pdf-recursive pdf-am: ps: ps-recursive ps-am: uninstall-am: uninstall-man uninstall-sbinPROGRAMS uninstall-man: uninstall-man8 .MAKE: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) all check \ ctags-recursive install install-am install-exec-am \ install-strip tags-recursive .PHONY: $(RECURSIVE_CLEAN_TARGETS) $(RECURSIVE_TARGETS) CTAGS GTAGS \ all all-am am--refresh check check-am clean clean-generic \ clean-sbinPROGRAMS ctags ctags-recursive dist dist-all \ dist-bzip2 dist-gzip dist-lzma dist-shar dist-tarZ dist-xz \ dist-zip distcheck distclean distclean-compile \ distclean-generic distclean-hdr distclean-local distclean-tags \ distcleancheck distdir distuninstallcheck dvi dvi-am html \ html-am info info-am install install-am install-data \ install-data-am install-dvi install-dvi-am install-exec \ install-exec-am install-exec-hook install-html install-html-am \ install-info install-info-am install-man install-man8 \ install-pdf install-pdf-am install-ps install-ps-am \ install-sbinPROGRAMS install-strip installcheck \ installcheck-am installdirs installdirs-am maintainer-clean \ maintainer-clean-generic mostlyclean mostlyclean-compile \ mostlyclean-generic pdf pdf-am ps ps-am tags tags-recursive \ uninstall uninstall-am uninstall-man uninstall-man8 \ uninstall-sbinPROGRAMS install-exec-hook: chmod u+s $(DESTDIR)$(sbindir)/mtr version.h: version.h.tmp Makefile $(mtr_SOURCES) @cat version.h.tmp > $@; \ if [ -d .git ] && [ -n "$$(which git)" ]; then \ xver="+git:$$(git rev-list -n1 --abbrev=8 --abbrev-commit HEAD)"; \ sed \ -e "/#define *MTR_VERSION */{s/\"\([^\"]*\)\"/\"\1$$xver\"/;}" \ version.h.tmp > $@; \ fi; distclean-local: (sleep 3; cp Makefile.dist Makefile) & rm -f *.orig # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: mtr-0.85/mtr.80000664000175000017500000001424112137535115012166 0ustar wolffwolff.TH MTR 8 "March 4, 1999" "mtr" "mtr" .SH NAME mtr \- a network diagnostic tool .SH SYNOPSIS .B mtr [\c .B \-hvrctglspeniuTP46\c ] [\c .B \-\-help\c ] [\c .B \-\-version\c ] [\c .B \-\-report\c ] [\c .B \-\-report-wide\c ] [\c .B \-\-report\-cycles\ COUNT\c ] [\c .B \-\-curses\c ] [\c .B \-\-split\c ] [\c .B \-\-raw\c ] [\c .B \-\-mpls\c ] [\c .B \-\-no-dns\c ] [\c .B \-\-show-ips\c ] [\c .B \-\-gtk\c ] [\c .B \-\-address\ IP.ADD.RE.SS\c ] [\c .B \-\-interval\ SECONDS\c ] [\c .B \-\-psize\ BYTES | -s BYTES\c ] [\c .B \-\-tcp\c ] [\c .B \-\-port\ PORT\c ] [\c .B \-\-timeout\ SECONDS\c ] .B HOSTNAME [PACKETSIZE] .SH DESCRIPTION .B mtr combines the functionality of the .B traceroute and .B ping programs in a single network diagnostic tool. .PP As .B mtr starts, it investigates the network connection between the host .B mtr runs on and .BR HOSTNAME . by sending packets with purposely low TTLs. It continues to send packets with low TTL, noting the response time of the intervening routers. This allows .B mtr to print the response percentage and response times of the internet route to .BR HOSTNAME . A sudden increase in packet loss or response time is often an indication of a bad (or simply overloaded) link. .PP The results are usually reported as round-trip-response times in miliseconds and the percentage of packetloss. .SH OPTIONS .TP .B \-h .TP .B \-\-help .br Print the summary of command line argument options. .TP .B \-v .TP .B \-\-version .br Print the installed version of mtr. .TP .B \-r .TP .B \-\-report .br This option puts .B mtr into .B report mode. When in this mode, .B mtr will run for the number of cycles specified by the .B \-c option, and then print statistics and exit. .TP \c This mode is useful for generating statistics about network quality. Note that each running instance of .B mtr generates a significant amount of network traffic. Using .B mtr to measure the quality of your network may result in decreased network performance. .TP .B \-w .TP .B \-\-report-wide .br This option puts .B mtr into .B wide report mode. When in this mode, .B mtr will not cut hostnames in the report. .TP .B \-c\ COUNT .TP .B \-\-report\-cycles\ COUNT Use this option to set the number of pings sent to determine both the machines on the network and the reliability of those machines. Each cycle lasts one second. .TP .B \-s\ BYTES .TP .B \-\-psize\ BYTES .TP .B PACKETSIZE These options or a trailing PACKETSIZE on the command line sets the packet size used for probing. It is in bytes inclusive IP and ICMP headers If set to a negative number, every iteration will use a different, random packet size upto that number. .TP .B \-t .TP .B \-\-curses .br Use this option to force .B mtr to use the curses based terminal interface (if available). .TP .B \-e .TP .B \-\-mpls .br Use this option to tell .B mtr to display information from ICMP extensions for MPLS (RFC 4950) that are encoded in the response packets. .TP .B \-n .TP .B \-\-no-dns .br Use this option to force .B mtr to display numeric IP numbers and not try to resolve the host names. .TP .B \-b .TP .B \-\-show-ips .br Use this option to tell .B mtr to display both the host names and numeric IP numbers. In split mode this adds an extra field to the output. In report mode, there is usually too little space to add the IPs, and they will be truncated. Use the wide report (-w) mode to see the IPs in report mode. .TP .B \-o\ fields\ order .TP .B \-\-order\ fields\ order .br Use this option to specify the fields and their order when loading mtr. .br Available fields: .TS center allbox tab(%); ll. L%Loss ratio D%Dropped packets R%Received packets S%Sent Packets N%Newest RTT(ms) B%Min/Best RTT(ms) A%Average RTT(ms) W%Max/Worst RTT(ms) V%Standard Deviation G%Geometric Mean J%Current Jitter M%Jitter Mean/Avg. X%Worst Jitter I%Interarrival Jitter .TE .br Example: -o "LSD NBAW" .TP .B \-g .TP .B \-\-gtk .br Use this option to force .B mtr to use the GTK+ based X11 window interface (if available). GTK+ must have been available on the system when .B mtr was built for this to work. See the GTK+ web page at .B http://www.gtk.org/ for more information about GTK+. .TP .B \-p .TP .B \-\-split .br Use this option to set .B mtr to spit out a format that is suitable for a split-user interface. .TP .B \-l .TP .B \-\-raw .br Use this option to tell .B mtr to use the raw output format. This format is better suited for archival of the measurement results. It could be parsed to be presented into any of the other display methods. .TP .B \-a\ IP.ADD.RE.SS .TP .B \-\-address\ IP.ADD.RE.SS .br Use this option to bind outgoing packets' socket to specific interface, so that any packet will be sent through this interface. NOTE that this option doesn't apply to DNS requests (which could be and could not be what you want). .TP .B \-i\ SECONDS .TP .B \-\-interval\ SECONDS .br Use this option to specify the positive number of seconds between ICMP ECHO requests. The default value for this parameter is one second. .TP .B \-u .br Use UDP datagrams instead of ICMP ECHO. .TP .B \-T .TP .B \-\-tcp .br Use TCP SYN packets instead of ICMP ECHO. PACKETSIZE is ignored, since SYN packets can not contain data. .TP .B \-P\ PORT .TP .B \-\-port\ PORT .br The target port number for TCP traces. .TP .B \-\-timeout\ SECONDS .br The number of seconds to keep the TCP socket open before giving up on the connection. This will only affect the final hop. Using large values for this, especially combined with a short interval, will use up a lot of file descriptors. .TP .B \-4 .br Use IPv4 only. .TP .B \-6 .br Use IPv6 only. .SH BUGS Some modern routers give a lower priority to ICMP ECHO packets than to other network traffic. Consequently, the reliability of these routers reported by .B mtr will be significantly lower than the actual reliability of these routers. .SH CONTACT INFORMATION .PP For the latest version, see the mtr web page at .BR http://www.bitwizard.nl/mtr/ . .PP The mtr mailinglist was little used and is no longer active. .PP Bug reports and feature requests should be submitted to the launchpad mtr bugtracker. .SH "SEE ALSO" traceroute(8), ping(8) TCP/IP Illustrated (Stevens, ISBN 0201633469). mtr-0.85/getopt.c0000664000175000017500000005325112104136661012742 0ustar wolffwolff/* Getopt for GNU. NOTE: getopt is now part of the C library, so if you don't know what "Keep this file name-space clean" means, talk to roland@gnu.ai.mit.edu before changing it! Copyright (C) 1987, 88, 89, 90, 91, 92, 93, 94, 95 Free Software Foundation, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, 675 Mass Ave, Cambridge, MA 02139, USA. */ /* This tells Alpha OSF/1 not to define a getopt prototype in . Ditto for AIX 3.2 and . */ #ifndef _NO_PROTO #define _NO_PROTO #endif #ifdef HAVE_CONFIG_H #include #endif #if !defined (__STDC__) || !__STDC__ /* This is a separate conditional since some stdc systems reject `defined (const)'. */ #ifndef const #define const #endif #endif #include #include /* Comment out all this code if we are using the GNU C Library, and are not actually compiling the library itself. This code is part of the GNU C Library, but also included in many other GNU distributions. Compiling and linking in this code is a waste when using the GNU C library (especially if it is a shared library). Rather than having every GNU program understand `configure --with-gnu-libc' and omit the object files, it is simpler to just do this in the source for each such file. */ #if defined (_LIBC) || !defined (__GNU_LIBRARY__) /* This needs to come after some library #include to get __GNU_LIBRARY__ defined. */ #ifdef __GNU_LIBRARY__ /* Don't include stdlib.h for non-GNU C libraries because some of them contain conflicting prototypes for getopt. */ #include #endif /* GNU C library. */ #ifndef _ /* This is for other GNU distributions with internationalized messages. When compiling libc, the _ macro is predefined. */ #ifdef HAVE_LIBINTL_H # include # define _(msgid) gettext (msgid) #else # define _(msgid) (msgid) #endif #endif /* This version of `getopt' appears to the caller like standard Unix `getopt' but it behaves differently for the user, since it allows the user to intersperse the options with the other arguments. As `getopt' works, it permutes the elements of ARGV so that, when it is done, all the options precede everything else. Thus all application programs are extended to handle flexible argument order. Setting the environment variable POSIXLY_CORRECT disables permutation. Then the behavior is completely standard. GNU application programs can use a third alternative mode in which they can distinguish the relative order of options and other arguments. */ #include "getopt.h" /* For communication from `getopt' to the caller. When `getopt' finds an option that takes an argument, the argument value is returned here. Also, when `ordering' is RETURN_IN_ORDER, each non-option ARGV-element is returned here. */ char *optarg = NULL; /* Index in ARGV of the next element to be scanned. This is used for communication to and from the caller and for communication between successive calls to `getopt'. On entry to `getopt', zero means this is the first call; initialize. When `getopt' returns EOF, this is the index of the first of the non-option elements that the caller should itself scan. Otherwise, `optind' communicates from one call to the next how much of ARGV has been scanned so far. */ /* XXX 1003.2 says this must be 1 before any call. */ int optind = 0; /* The next char to be scanned in the option-element in which the last option character we returned was found. This allows us to pick up the scan where we left off. If this is zero, or a null string, it means resume the scan by advancing to the next ARGV-element. */ static char *nextchar; /* Callers store zero here to inhibit the error message for unrecognized options. */ int opterr = 1; /* Set to an option character which was unrecognized. This must be initialized on some systems to avoid linking in the system's own getopt implementation. */ int optopt = '?'; /* Describe how to deal with options that follow non-option ARGV-elements. If the caller did not specify anything, the default is REQUIRE_ORDER if the environment variable POSIXLY_CORRECT is defined, PERMUTE otherwise. REQUIRE_ORDER means don't recognize them as options; stop option processing when the first non-option is seen. This is what Unix does. This mode of operation is selected by either setting the environment variable POSIXLY_CORRECT, or using `+' as the first character of the list of option characters. PERMUTE is the default. We permute the contents of ARGV as we scan, so that eventually all the non-options are at the end. This allows options to be given in any order, even with programs that were not written to expect this. RETURN_IN_ORDER is an option available to programs that were written to expect options and other ARGV-elements in any order and that care about the ordering of the two. We describe each non-option ARGV-element as if it were the argument of an option with character code 1. Using `-' as the first character of the list of option characters selects this mode of operation. The special argument `--' forces an end of option-scanning regardless of the value of `ordering'. In the case of RETURN_IN_ORDER, only `--' can cause `getopt' to return EOF with `optind' != ARGC. */ static enum { REQUIRE_ORDER, PERMUTE, RETURN_IN_ORDER } ordering; /* Value of POSIXLY_CORRECT environment variable. */ static char *posixly_correct; #ifdef __GNU_LIBRARY__ /* We want to avoid inclusion of string.h with non-GNU libraries because there are many ways it can cause trouble. On some systems, it contains special magic macros that don't work in GCC. */ #include #define my_index strchr #else /* Avoid depending on library functions or files whose names are inconsistent. */ char *getenv (); static char * my_index (str, chr) const char *str; int chr; { while (*str) { if (*str == chr) return (char *) str; str++; } return 0; } /* If using GCC, we can safely declare strlen this way. If not using GCC, it is ok not to declare it. */ #ifdef __GNUC__ /* Note that Motorola Delta 68k R3V7 comes with GCC but not stddef.h. That was relevant to code that was here before. */ #if !defined (__STDC__) || !__STDC__ /* gcc with -traditional declares the built-in strlen to return int, and has done so at least since version 2.4.5. -- rms. */ extern int strlen (const char *); #endif /* not __STDC__ */ #endif /* __GNUC__ */ #endif /* not __GNU_LIBRARY__ */ /* Handle permutation of arguments. */ /* Describe the part of ARGV that contains non-options that have been skipped. `first_nonopt' is the index in ARGV of the first of them; `last_nonopt' is the index after the last of them. */ static int first_nonopt; static int last_nonopt; /* Exchange two adjacent subsequences of ARGV. One subsequence is elements [first_nonopt,last_nonopt) which contains all the non-options that have been skipped so far. The other is elements [last_nonopt,optind), which contains all the options processed since those non-options were skipped. `first_nonopt' and `last_nonopt' are relocated so that they describe the new indices of the non-options in ARGV after they are moved. */ static void exchange (argv) char **argv; { int bottom = first_nonopt; int middle = last_nonopt; int top = optind; char *tem; /* Exchange the shorter segment with the far end of the longer segment. That puts the shorter segment into the right place. It leaves the longer segment in the right place overall, but it consists of two parts that need to be swapped next. */ while (top > middle && middle > bottom) { if (top - middle > middle - bottom) { /* Bottom segment is the short one. */ int len = middle - bottom; register int i; /* Swap it with the top part of the top segment. */ for (i = 0; i < len; i++) { tem = argv[bottom + i]; argv[bottom + i] = argv[top - (middle - bottom) + i]; argv[top - (middle - bottom) + i] = tem; } /* Exclude the moved bottom segment from further swapping. */ top -= len; } else { /* Top segment is the short one. */ int len = top - middle; register int i; /* Swap it with the bottom part of the bottom segment. */ for (i = 0; i < len; i++) { tem = argv[bottom + i]; argv[bottom + i] = argv[middle + i]; argv[middle + i] = tem; } /* Exclude the moved top segment from further swapping. */ bottom += len; } } /* Update records for the slots the non-options now occupy. */ first_nonopt += (optind - last_nonopt); last_nonopt = optind; } /* Initialize the internal data when the first call is made. */ static const char * _getopt_initialize (optstring) const char *optstring; { /* Start processing options with ARGV-element 1 (since ARGV-element 0 is the program name); the sequence of previously skipped non-option ARGV-elements is empty. */ first_nonopt = last_nonopt = optind = 1; nextchar = NULL; posixly_correct = getenv ("POSIXLY_CORRECT"); /* Determine how to handle the ordering of options and nonoptions. */ if (optstring[0] == '-') { ordering = RETURN_IN_ORDER; ++optstring; } else if (optstring[0] == '+') { ordering = REQUIRE_ORDER; ++optstring; } else if (posixly_correct != NULL) ordering = REQUIRE_ORDER; else ordering = PERMUTE; return optstring; } /* Scan elements of ARGV (whose length is ARGC) for option characters given in OPTSTRING. If an element of ARGV starts with '-', and is not exactly "-" or "--", then it is an option element. The characters of this element (aside from the initial '-') are option characters. If `getopt' is called repeatedly, it returns successively each of the option characters from each of the option elements. If `getopt' finds another option character, it returns that character, updating `optind' and `nextchar' so that the next call to `getopt' can resume the scan with the following option character or ARGV-element. If there are no more option characters, `getopt' returns `EOF'. Then `optind' is the index in ARGV of the first ARGV-element that is not an option. (The ARGV-elements have been permuted so that those that are not options now come last.) OPTSTRING is a string containing the legitimate option characters. If an option character is seen that is not listed in OPTSTRING, return '?' after printing an error message. If you set `opterr' to zero, the error message is suppressed but we still return '?'. If a char in OPTSTRING is followed by a colon, that means it wants an arg, so the following text in the same ARGV-element, or the text of the following ARGV-element, is returned in `optarg'. Two colons mean an option that wants an optional arg; if there is text in the current ARGV-element, it is returned in `optarg', otherwise `optarg' is set to zero. If OPTSTRING starts with `-' or `+', it requests different methods of handling the non-option ARGV-elements. See the comments about RETURN_IN_ORDER and REQUIRE_ORDER, above. Long-named options begin with `--' instead of `-'. Their names may be abbreviated as long as the abbreviation is unique or is an exact match for some defined option. If they have an argument, it follows the option name in the same ARGV-element, separated from the option name by a `=', or else the in next ARGV-element. When `getopt' finds a long-named option, it returns 0 if that option's `flag' field is nonzero, the value of the option's `val' field if the `flag' field is zero. The elements of ARGV aren't really const, because we permute them. But we pretend they're const in the prototype to be compatible with other systems. LONGOPTS is a vector of `struct option' terminated by an element containing a name which is zero. LONGIND returns the index in LONGOPT of the long-named option found. It is only valid when a long-named option has been found by the most recent call. If LONG_ONLY is nonzero, '-' as well as '--' can introduce long-named options. */ int _getopt_internal (argc, argv, optstring, longopts, longind, long_only) int argc; char *const *argv; const char *optstring; const struct option *longopts; int *longind; int long_only; { optarg = NULL; if (optind == 0) { optstring = _getopt_initialize (optstring); optind = 1; /* Don't scan ARGV[0], the program name. */ } if (nextchar == NULL || *nextchar == '\0') { /* Advance to the next ARGV-element. */ if (ordering == PERMUTE) { /* If we have just processed some options following some non-options, exchange them so that the options come first. */ if (first_nonopt != last_nonopt && last_nonopt != optind) exchange ((char **) argv); else if (last_nonopt != optind) first_nonopt = optind; /* Skip any additional non-options and extend the range of non-options previously skipped. */ while (optind < argc && (argv[optind][0] != '-' || argv[optind][1] == '\0')) optind++; last_nonopt = optind; } /* The special ARGV-element `--' means premature end of options. Skip it like a null option, then exchange with previous non-options as if it were an option, then skip everything else like a non-option. */ if (optind != argc && !strcmp (argv[optind], "--")) { optind++; if (first_nonopt != last_nonopt && last_nonopt != optind) exchange ((char **) argv); else if (first_nonopt == last_nonopt) first_nonopt = optind; last_nonopt = argc; optind = argc; } /* If we have done all the ARGV-elements, stop the scan and back over any non-options that we skipped and permuted. */ if (optind == argc) { /* Set the next-arg-index to point at the non-options that we previously skipped, so the caller will digest them. */ if (first_nonopt != last_nonopt) optind = first_nonopt; return EOF; } /* If we have come to a non-option and did not permute it, either stop the scan or describe it to the caller and pass it by. */ if ((argv[optind][0] != '-' || argv[optind][1] == '\0')) { if (ordering == REQUIRE_ORDER) return EOF; optarg = argv[optind++]; return 1; } /* We have found another option-ARGV-element. Skip the initial punctuation. */ nextchar = (argv[optind] + 1 + (longopts != NULL && argv[optind][1] == '-')); } /* Decode the current option-ARGV-element. */ /* Check whether the ARGV-element is a long option. If long_only and the ARGV-element has the form "-f", where f is a valid short option, don't consider it an abbreviated form of a long option that starts with f. Otherwise there would be no way to give the -f short option. On the other hand, if there's a long option "fubar" and the ARGV-element is "-fu", do consider that an abbreviation of the long option, just like "--fu", and not "-f" with arg "u". This distinction seems to be the most useful approach. */ if (longopts != NULL && (argv[optind][1] == '-' || (long_only && (argv[optind][2] || !my_index (optstring, argv[optind][1]))))) { char *nameend; const struct option *p; const struct option *pfound = NULL; int exact = 0; int ambig = 0; int indfound = 0; int option_index; for (nameend = nextchar; *nameend && *nameend != '='; nameend++) /* Do nothing. */ ; /* Test all long options for either exact match or abbreviated matches. */ for (p = longopts, option_index = 0; p->name; p++, option_index++) if (!strncmp (p->name, nextchar, nameend - nextchar)) { if (nameend - nextchar == strlen (p->name)) { /* Exact match found. */ pfound = p; indfound = option_index; exact = 1; break; } else if (pfound == NULL) { /* First nonexact match found. */ pfound = p; indfound = option_index; } else /* Second or later nonexact match found. */ ambig = 1; } if (ambig && !exact) { if (opterr) fprintf (stderr, _("%s: option `%s' is ambiguous\n"), argv[0], argv[optind]); nextchar += strlen (nextchar); optind++; return '?'; } if (pfound != NULL) { option_index = indfound; optind++; if (*nameend) { /* Don't test has_arg with >, because some C compilers don't allow it to be used on enums. */ if (pfound->has_arg) optarg = nameend + 1; else { if (opterr) { if (argv[optind - 1][1] == '-') /* --option */ fprintf (stderr, _("%s: option `--%s' doesn't allow an argument\n"), argv[0], pfound->name); else /* +option or -option */ fprintf (stderr, _("%s: option `%c%s' doesn't allow an argument\n"), argv[0], argv[optind - 1][0], pfound->name); } nextchar += strlen (nextchar); return '?'; } } else if (pfound->has_arg == 1) { if (optind < argc) optarg = argv[optind++]; else { if (opterr) fprintf (stderr, _("%s: option `%s' requires an argument\n"), argv[0], argv[optind - 1]); nextchar += strlen (nextchar); return optstring[0] == ':' ? ':' : '?'; } } nextchar += strlen (nextchar); if (longind != NULL) *longind = option_index; if (pfound->flag) { *(pfound->flag) = pfound->val; return 0; } return pfound->val; } /* Can't find it as a long option. If this is not getopt_long_only, or the option starts with '--' or is not a valid short option, then it's an error. Otherwise interpret it as a short option. */ if (!long_only || argv[optind][1] == '-' || my_index (optstring, *nextchar) == NULL) { if (opterr) { if (argv[optind][1] == '-') /* --option */ fprintf (stderr, _("%s: unrecognized option `--%s'\n"), argv[0], nextchar); else /* +option or -option */ fprintf (stderr, _("%s: unrecognized option `%c%s'\n"), argv[0], argv[optind][0], nextchar); } nextchar = (char *) ""; optind++; return '?'; } } /* Look at and handle the next short option-character. */ { char c = *nextchar++; char *temp = my_index (optstring, c); /* Increment `optind' when we start to process its last character. */ if (*nextchar == '\0') ++optind; if (temp == NULL || c == ':') { if (opterr) { if (posixly_correct) /* 1003.2 specifies the format of this message. */ fprintf (stderr, _("%s: illegal option -- %c\n"), argv[0], c); else fprintf (stderr, _("%s: invalid option -- %c\n"), argv[0], c); } optopt = c; return '?'; } if (temp[1] == ':') { if (temp[2] == ':') { /* This is an option that accepts an argument optionally. */ if (*nextchar != '\0') { optarg = nextchar; optind++; } else optarg = NULL; nextchar = NULL; } else { /* This is an option that requires an argument. */ if (*nextchar != '\0') { optarg = nextchar; /* If we end this ARGV-element by taking the rest as an arg, we must advance to the next element now. */ optind++; } else if (optind == argc) { if (opterr) { /* 1003.2 specifies the format of this message. */ fprintf (stderr, _("%s: option requires an argument -- %c\n"), argv[0], c); } optopt = c; if (optstring[0] == ':') c = ':'; else c = '?'; } else /* We already incremented `optind' once; increment it again when taking next ARGV-elt as argument. */ optarg = argv[optind++]; nextchar = NULL; } } return c; } } int getopt (argc, argv, optstring) int argc; char *const *argv; const char *optstring; { return _getopt_internal (argc, argv, optstring, (const struct option *) 0, (int *) 0, 0); } #endif /* _LIBC or not __GNU_LIBRARY__. */ #ifdef TEST /* Compile with -DTEST to make an executable for use in testing the above definition of `getopt'. */ int main (argc, argv) int argc; char **argv; { int c; int digit_optind = 0; while (1) { int this_option_optind = optind ? optind : 1; c = getopt (argc, argv, "abc:d:0123456789"); if (c == EOF) break; switch (c) { case '0': case '1': case '2': case '3': case '4': case '5': case '6': case '7': case '8': case '9': if (digit_optind != 0 && digit_optind != this_option_optind) printf ("digits occur in two different argv-elements.\n"); digit_optind = this_option_optind; printf ("option %c\n", c); break; case 'a': printf ("option a\n"); break; case 'b': printf ("option b\n"); break; case 'c': printf ("option c with value `%s'\n", optarg); break; case '?': break; default: printf ("?? getopt returned character code 0%o ??\n", c); } } if (optind < argc) { printf ("non-option ARGV-elements: "); while (optind < argc) printf ("%s ", argv[optind++]); printf ("\n"); } exit (0); } #endif /* TEST */ mtr-0.85/version.h.tmp0000664000175000017500000000136412162522230013722 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #define MTR_VERSION "0.85" mtr-0.85/img/0000775000175000017500000000000012162522231012036 5ustar wolffwolffmtr-0.85/img/Makefile0000664000175000017500000002341412162522231013502 0ustar wolffwolff# Makefile.in generated by automake 1.11.1 from Makefile.am. # img/Makefile. Generated from Makefile.in by configure. # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009 Free Software Foundation, # Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. pkgdatadir = $(datadir)/mtr pkgincludedir = $(includedir)/mtr pkglibdir = $(libdir)/mtr pkglibexecdir = $(libexecdir)/mtr am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = img DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = SOURCES = DIST_SOURCES = DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = ${SHELL} /home/wolff/mtr/missing --run aclocal-1.11 AMTAR = ${SHELL} /home/wolff/mtr/missing --run tar AUTOCONF = ${SHELL} /home/wolff/mtr/missing --run autoconf AUTOHEADER = ${SHELL} /home/wolff/mtr/missing --run autoheader AUTOMAKE = ${SHELL} /home/wolff/mtr/missing --run automake-1.11 AWK = gawk CC = gcc CCDEPMODE = depmode=gcc3 CFLAGS = -g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 -Wall -Wno-pointer-sign CPP = gcc -E CPPFLAGS = CURSES_OBJ = curses.o CYGPATH_W = echo DEFS = -DHAVE_CONFIG_H DEPDIR = .deps ECHO_C = ECHO_N = -n ECHO_T = EGREP = /bin/grep -E EXEEXT = GLIB_CFLAGS = GLIB_LIBS = GREP = /bin/grep GTK_CFLAGS = -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 GTK_LIBS = -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 GTK_OBJ = gtk.o INSTALL = /usr/bin/install -c INSTALL_DATA = ${INSTALL} -m 644 INSTALL_PROGRAM = ${INSTALL} INSTALL_SCRIPT = ${INSTALL} INSTALL_STRIP_PROGRAM = $(install_sh) -c -s LDFLAGS = LIBOBJS = LIBS = -lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm LTLIBOBJS = MAKEINFO = ${SHELL} /home/wolff/mtr/missing --run makeinfo MKDIR_P = /bin/mkdir -p OBJEXT = o PACKAGE = mtr PACKAGE_BUGREPORT = PACKAGE_NAME = mtr PACKAGE_STRING = mtr 0.85 PACKAGE_TARNAME = mtr PACKAGE_URL = PACKAGE_VERSION = 0.85 PATH_SEPARATOR = : PKG_CONFIG = /usr/bin/pkg-config PKG_CONFIG_LIBDIR = PKG_CONFIG_PATH = RESOLV_LIBS = -lresolv SET_MAKE = SHELL = /bin/bash STRIP = VERSION = 0.85 abs_builddir = /home/wolff/mtr/img abs_srcdir = /home/wolff/mtr/img abs_top_builddir = /home/wolff/mtr abs_top_srcdir = /home/wolff/mtr ac_ct_CC = gcc am__include = include am__leading_dot = . am__quote = am__tar = ${AMTAR} chof - "$$tardir" am__untar = ${AMTAR} xf - bindir = ${exec_prefix}/bin build_alias = builddir = . datadir = ${datarootdir} datarootdir = ${prefix}/share docdir = ${datarootdir}/doc/${PACKAGE_TARNAME} dvidir = ${docdir} exec_prefix = ${prefix} host_alias = htmldir = ${docdir} includedir = ${prefix}/include infodir = ${datarootdir}/info install_sh = ${SHELL} /home/wolff/mtr/install-sh libdir = ${exec_prefix}/lib libexecdir = ${exec_prefix}/libexec localedir = ${datarootdir}/locale localstatedir = ${prefix}/var mandir = ${datarootdir}/man mkdir_p = /bin/mkdir -p oldincludedir = /usr/include pdfdir = ${docdir} prefix = /usr/local program_transform_name = s,x,x, psdir = ${docdir} sbindir = ${exec_prefix}/sbin sharedstatedir = ${prefix}/com srcdir = . sysconfdir = ${prefix}/etc target_alias = top_build_prefix = ../ top_builddir = .. top_srcdir = .. EXTRA_DIST = mtr_icon.xpm all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign img/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --foreign img/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile installdirs: install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic distclean \ distclean-generic distdir dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-dvi \ install-dvi-am install-exec install-exec-am install-html \ install-html-am install-info install-info-am install-man \ install-pdf install-pdf-am install-ps install-ps-am \ install-strip installcheck installcheck-am installdirs \ maintainer-clean maintainer-clean-generic mostlyclean \ mostlyclean-generic pdf pdf-am ps ps-am uninstall uninstall-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: mtr-0.85/img/Makefile.am0000664000175000017500000000003212104136661014071 0ustar wolffwolffEXTRA_DIST = mtr_icon.xpm mtr-0.85/img/mtr_icon.xpm0000664000175000017500000001544712104136661014415 0ustar wolffwolff/* XPM */ static char * mtr_icon[] = { "48 48 131 2", " c #000000", ". c #020204", "+ c #3E7E3C", "@ c #62BA64", "# c #4E9E4C", "$ c #628664", "% c #6EDA6C", "& c #7A9E7C", "* c #468E44", "= c #6ACA6C", "- c #224224", "; c #56AE54", "> c #326234", ", c #567E54", "' c #7ABA7C", ") c #3A723C", "! c #629E64", "~ c #428644", "{ c #6E926C", "] c #7AEA7C", "^ c #4A964C", "/ c #62C264", "( c #52A654", "_ c #4A7E4C", ": c #82AE84", "< c #366A34", "[ c #5AB65C", "} c #4A764C", "| c #6AD26C", "1 c #8EC68C", "2 c #7A9A7C", "3 c #7AE27C", "4 c #82A684", "5 c #568E54", "6 c #568654", "7 c #3E7A3C", "8 c #6AC26C", "9 c #3E6A3C", "0 c #468244", "a c #56A254", "b c #4E8E4C", "c c #5EAE5C", "d c #86C684", "e c #427244", "f c #62A664", "g c #769A74", "h c #82F284", "i c #5A9A5C", "j c #5AA65C", "k c #428244", "l c #66BE64", "m c #6A8E6C", "n c #76DA74", "o c #7E9E7C", "p c #2A522C", "q c #5E825C", "r c #82BE84", "s c #669E64", "t c #6E966C", "u c #529A54", "v c #62C664", "w c #4A824C", "x c #366E34", "y c #72D674", "z c #427E3C", "A c #5EBE5C", "B c #52A254", "C c #628A64", "D c #4A924C", "E c #6ACE6C", "F c #5AB25C", "G c #326634", "H c #568254", "I c #7ABE7C", "J c #3A763C", "K c #468A44", "L c #7EEE7C", "M c #4E9A4C", "N c #56AA54", "O c #86B684", "P c #62B664", "Q c #162A14", "R c #529E54", "S c #72DA74", "T c #76A274", "U c #4A8E4C", "V c #264A24", "W c #5AAE5C", "X c #5EA25C", "Y c #468644", "Z c #729274", "` c #7EEA7C", " . c #4E964C", ".. c #66C264", "+. c #56A654", "@. c #4E7E4C", "#. c #8AB28C", "$. c #3A6A3C", "%. c #5EB65C", "&. c #527A54", "*. c #6ED26C", "=. c #92C694", "-. c #7E9A7C", ";. c #7AE67C", ">. c #86AA84", ",. c #5E865C", "'. c #6AC66C", "). c #3E6E3C", "!. c #5AA25C", "~. c #4E924C", "{. c #5EB25C", "]. c #467244", "^. c #86F284", "/. c #5AAA5C", "(. c #76DE74", "_. c #829E84", ":. c #325E34", "<. c #66A264", "[. c #729674", "}. c #66C664", "|. c #4E824C", "1. c #3A6E3C", "2. c #76D674", "3. c #427E44", "4. c #62BE64", "5. c #668A64", "6. c #6ECE6C", "7. c #366634", "8. c #5A825C", "9. c #7EBE7C", "0. c #3E763C", "G 7.G G G G G 7.G < z . .* k 1.G G G G G G 0.K x 7.7.7.7.7.< J Y D M D ) 7.7.7.7.7.7.< 7.7.7.7.", "7.G 7.> > > 7.G ) D M K 7 < > > > > > > > > + * < G G G G G G 7.G x k * M K x G G G G G G G G G ", "G G 7.G > > < ~ M D + G > > G > > 7.7.7.7.> 7 D x 7.7.7.7.7.G 7.7.G < ) ~ D M 7 7.7.7.7.7.7.7.7.", "7.7.G > 7.< * M ~ x > G > G > > 7.> > > > G 7 * 1.G G G G G 7.G G 7.G G G J * M ~ < G G G G G G ", "> G G > x D M k < G > G > > G > > G G G > 7.7 * x 7.7.7.7.G 7.7.G 7.7.7.7.G x ~ # Y < 7.7.7.7.7.", "G > > x ^ .0.G G G 7.> > > > > G > > > 7.> 7 U 1.G G G G 7.G G 7.G G G G 7.G < k # K < G G G G ", "G G < .^ J G G 7.G 7.> G > > > > 7.7.> 7.7.7 * x 7.7.7.G 7.7.G 7.7.7.7.G 7.G G 7.+ B ~ < 7.7.7.", "> < D M 7 G > > > G > G > > G > 7.> > G > > + U 1.G G G 7.G G 7.G G G G 7.G 7.7.G < k B + < G G ", "G k # k < 7.7.G > G > > G > > > > G x k .R F A N R U 7 x 7.G 7.7.7.7.G 7.G G 7.G G < K # J $.8.", ") ( K < > > G G 7.G G > > > G G + M +.B M D B W ^ ^ # ( +.^ ) G G G G 7.G 7.7.G 7.7.7.x u ! & o ", "^ .x > > > > G 7.7.G > > > 0. .+.M K + ) < + D ) < J k * R +.D x 7.G 7.G G 7.G G G 7.e T =.& H ", "+.+ < G G G 7.G > G G > G ~ ( B ~ ) G > G > 7 U < 7.7.G < J * B B 7 7.G 7.7.G 7.7.9 5.o Z s a ) ", "D x > > > > > G > G G < K ( D 0.> G 7.> G 7.+ * < G 7.7.G G < + # ( + G G 7.G $.,.2 [.$ ).0.( k ", "7 7.G G G G 7.G G > 7.K +.K x > G > > G > > 7 D < 7.G G 7.7.G 7.) M +.7 7.< &.[.2 C &.7.7.7.* B ", "x 7.> > > > > 7.7.G k +.* < > > > G > 7.G G 7 * < 7.7.G G 7.G G G ) M B &.[.o m &.7.G 7.G 7.) %.", "7.G 7.7.7.G 7.G G x B ^ ) > G > 7.> 7.> > > + D 7.G G 7.7.G 7.7.7.< w r #.{ , 9 7.7.7.G 7.G < ( ", "> G G > 7.G > 7.7.* ( 7 G > > > > > G 7.1.z B F D 7 < G 7.G G G $.q o : I _ < > G G 7.G 7.G 7.~ ", "7.7.> G > 7.7.> x +.* 7.> > G > G G < k # # +.[ B N ( k G 7.$.&.2 2 C |.B D < 7.7.7.G 7.G 7.G < ", "> 7.> G > G G > ~ +.+ > > > > > > < K R K + K M 3.K B W K } Z -.m &.< < Y W ) G G 7.G 7.G 7.G 7.", "> G G > > > 7.G # ^ ) > G > G > 7.~ # + < > 7 * < G J j d 4 { , $.G 7.G 7 F + 7.7.G 7.G 7.G 7.G ", "> > > G G > 7.7.N * 7.> > > > > J D Y > G 7.3.D < ).$ 4 1 ' e 7.7.G G G ) # D < G G 7.G 7.G 7.7.", "> 7.G > > G > x +.Y G > G > G > Y ~.x G > > 7 ~.8.-.2 5.i A 7 G G 7.7.7.< D # x 7.7.G 7.G 7.G G ", "< < x x < x x + ; * x x x x x ) ^ .1.) 1.) 5 r o t 6 0.K A D J ) ) ) J 7 .F k 7 7 7 7 J 0.0.x ", "D D * * D U U # A ( * * * K * * N W U U * K X 9.<.D K K R ..N U * * * * U ( A D K K K K U * K ) ", "7 z z 7 7 z 7 K {.M 7 7 7 0.0.7 # B J 7 7 7 U R 0.7 7 7 D / D 0.0.7 0.J 7 .F + 0.J 0.J 0.J 0.< ", "G > > > G > G < N K 7.> > G G > ~ D 1.G > > 3.U G G G G * A J G G G G 7.x D # x G 7.G 7.G 7.G G ", "G G G > G > G < ( * 7.> > > > > J ^ K G G > + D 7.7.7.7 N ( < 7.7.7.G G ) B * < G 7.G 7.G 7.7.G ", "G G > > > 7.G G # .) G > > G > > k u 0 7.G z U G G 7 ( F + < G G G 7.7.7 W + < 7.G 7.G 7.G G 7.", "> 7.G 7.> > > 7.~ B + > > > G G > x ~ # .+ ~ .7 D ; ; k G 7.7.7.G G G K W x G 7.G 7.G 7.7.G 7.", "7.G 7.> G 7.7.G < ( D < G > > > > > < z D # %.A +.B .7 < K = G G 7.7.J B D < 7.G 7.G 7.G G 7.x ", "G G G > > > > G G K ( 7 > > > > > G > G 1.+ R N K 7 x G ` (./.7.G G < K ; J G 7.G 7.G 7.7.G 7.Y ", "7.G G > > G G G G x B M ) > > G G > G G > > + D G G 7.7.;.E 4.G 7.7.7 N K < 7.G 7.G 7.G G 7.< ; ", "1.> G G > > > ` ] %.+ L 3 (.S S +.> /.L ;.(.S y 7.G 6.3 6.= = y ;...B # ` ] @ *.;.S B 7.G G J A ", "z G > > G 7.7.% = '.n ~.K %.= = = y *.u .4.= = {.7.c /.= = ..u M M B J y = E 6.!.b z G 7.< D W ", "M ) G > > G G y = ..7.. . +.@ '.= @ V . . 1.}.= {.. G 7.6.= B . . . . 7.y = ..> . . . . G ) [ D ", "[ + G G G > 7.S = a . . . . 4.E = z . . . G y = @ . . G (.6.a . . . . G y = .. . . . . < ^ W J ", "N B ) G G G 7.y = .. . . 7.}.6.'.0.. . . G (.= %.. . ~ y = B . . . 7.G *.'.0 . . . G 7.7 [ K < ", "+ [ D < > > G % = R . . > > }.6.}.0.. . +.+.3 = {.. . B (.E W . . G G 7.y = K . . G 7.x +.( J G ", "< D {.Y 7.> 7.y = u . . > > ..6.'.0.. . K U (.= %.. . + y = +.. . 7.G 7.y }.Y . . G < ^ F z 7.7.", "> x B ; + G > y = ( . . G > }.6.}.0.. . > G (.= {.. . G (.= {.. . G 7.G y = k . . < * [ U < G G ", "> G J +.N + G S '.R . . > G }.6.}.0.. . G G (.= [ . . G *.= }.J . G 7.G *.= ~ . . ~ %.^ x 7.7.7.", "G > G 7 +.N z y E B . . G > ..6.'.0.. . > > 3 = {.. . 7.'.= = = (.3 p 7.y '.0 . . {.# ) 7.G G G ", "G > G G 7 ( ; @ N ~.. . > > 4.W +.1.. . G 7.= /.B . . G > {.l 4.%.R G 7.@ /.+ . . M ) G 7.7.7.7.", "> 7.> > G 0.# %.^ . . . > > > > > . . > > > + D . . . 7.7.7.- - Q . . G < . . . . ) G 7.G G G G ", "G G 7.> 7.7.) ^ F . . < G > > > G . . 7.G > 3.D 7.. G G G 7.7.. . . . x D F . . < 7.G 7.7.7.7.7.", "> 7.G G > G G < ~ ( [ B + < > G > > > > > 7.+ U G 7.7.7.7.G G 7.G x K W [ R + < G G 7.G G G G G ", "> > > G > > > > 7.J D +.[ ; K x G 7.G 7.> 7.) z G G G G 7.7.< 0. .F F B ~ 1.G 7.7.G 7.7.7.7.7.7.", "G 7.7.> > G 7.G > 7.< M E | +.7 > > > > G > x ) 7.> 7.7.G G < k F % / ~ G G 7.G G 7.G G G G G G "}; mtr-0.85/img/Makefile.in0000664000175000017500000002127012162521740014111 0ustar wolffwolff# Makefile.in generated by automake 1.11.1 from Makefile.am. # @configure_input@ # Copyright (C) 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2001, 2002, # 2003, 2004, 2005, 2006, 2007, 2008, 2009 Free Software Foundation, # Inc. # This Makefile.in is free software; the Free Software Foundation # gives unlimited permission to copy and/or distribute it, # with or without modifications, as long as this notice is preserved. # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY, to the extent permitted by law; without # even the implied warranty of MERCHANTABILITY or FITNESS FOR A # PARTICULAR PURPOSE. @SET_MAKE@ VPATH = @srcdir@ pkgdatadir = $(datadir)/@PACKAGE@ pkgincludedir = $(includedir)/@PACKAGE@ pkglibdir = $(libdir)/@PACKAGE@ pkglibexecdir = $(libexecdir)/@PACKAGE@ am__cd = CDPATH="$${ZSH_VERSION+.}$(PATH_SEPARATOR)" && cd install_sh_DATA = $(install_sh) -c -m 644 install_sh_PROGRAM = $(install_sh) -c install_sh_SCRIPT = $(install_sh) -c INSTALL_HEADER = $(INSTALL_DATA) transform = $(program_transform_name) NORMAL_INSTALL = : PRE_INSTALL = : POST_INSTALL = : NORMAL_UNINSTALL = : PRE_UNINSTALL = : POST_UNINSTALL = : subdir = img DIST_COMMON = $(srcdir)/Makefile.am $(srcdir)/Makefile.in ACLOCAL_M4 = $(top_srcdir)/aclocal.m4 am__aclocal_m4_deps = $(top_srcdir)/configure.ac am__configure_deps = $(am__aclocal_m4_deps) $(CONFIGURE_DEPENDENCIES) \ $(ACLOCAL_M4) mkinstalldirs = $(install_sh) -d CONFIG_HEADER = $(top_builddir)/config.h CONFIG_CLEAN_FILES = CONFIG_CLEAN_VPATH_FILES = SOURCES = DIST_SOURCES = DISTFILES = $(DIST_COMMON) $(DIST_SOURCES) $(TEXINFOS) $(EXTRA_DIST) ACLOCAL = @ACLOCAL@ AMTAR = @AMTAR@ AUTOCONF = @AUTOCONF@ AUTOHEADER = @AUTOHEADER@ AUTOMAKE = @AUTOMAKE@ AWK = @AWK@ CC = @CC@ CCDEPMODE = @CCDEPMODE@ CFLAGS = @CFLAGS@ CPP = @CPP@ CPPFLAGS = @CPPFLAGS@ CURSES_OBJ = @CURSES_OBJ@ CYGPATH_W = @CYGPATH_W@ DEFS = @DEFS@ DEPDIR = @DEPDIR@ ECHO_C = @ECHO_C@ ECHO_N = @ECHO_N@ ECHO_T = @ECHO_T@ EGREP = @EGREP@ EXEEXT = @EXEEXT@ GLIB_CFLAGS = @GLIB_CFLAGS@ GLIB_LIBS = @GLIB_LIBS@ GREP = @GREP@ GTK_CFLAGS = @GTK_CFLAGS@ GTK_LIBS = @GTK_LIBS@ GTK_OBJ = @GTK_OBJ@ INSTALL = @INSTALL@ INSTALL_DATA = @INSTALL_DATA@ INSTALL_PROGRAM = @INSTALL_PROGRAM@ INSTALL_SCRIPT = @INSTALL_SCRIPT@ INSTALL_STRIP_PROGRAM = @INSTALL_STRIP_PROGRAM@ LDFLAGS = @LDFLAGS@ LIBOBJS = @LIBOBJS@ LIBS = @LIBS@ LTLIBOBJS = @LTLIBOBJS@ MAKEINFO = @MAKEINFO@ MKDIR_P = @MKDIR_P@ OBJEXT = @OBJEXT@ PACKAGE = @PACKAGE@ PACKAGE_BUGREPORT = @PACKAGE_BUGREPORT@ PACKAGE_NAME = @PACKAGE_NAME@ PACKAGE_STRING = @PACKAGE_STRING@ PACKAGE_TARNAME = @PACKAGE_TARNAME@ PACKAGE_URL = @PACKAGE_URL@ PACKAGE_VERSION = @PACKAGE_VERSION@ PATH_SEPARATOR = @PATH_SEPARATOR@ PKG_CONFIG = @PKG_CONFIG@ PKG_CONFIG_LIBDIR = @PKG_CONFIG_LIBDIR@ PKG_CONFIG_PATH = @PKG_CONFIG_PATH@ RESOLV_LIBS = @RESOLV_LIBS@ SET_MAKE = @SET_MAKE@ SHELL = @SHELL@ STRIP = @STRIP@ VERSION = @VERSION@ abs_builddir = @abs_builddir@ abs_srcdir = @abs_srcdir@ abs_top_builddir = @abs_top_builddir@ abs_top_srcdir = @abs_top_srcdir@ ac_ct_CC = @ac_ct_CC@ am__include = @am__include@ am__leading_dot = @am__leading_dot@ am__quote = @am__quote@ am__tar = @am__tar@ am__untar = @am__untar@ bindir = @bindir@ build_alias = @build_alias@ builddir = @builddir@ datadir = @datadir@ datarootdir = @datarootdir@ docdir = @docdir@ dvidir = @dvidir@ exec_prefix = @exec_prefix@ host_alias = @host_alias@ htmldir = @htmldir@ includedir = @includedir@ infodir = @infodir@ install_sh = @install_sh@ libdir = @libdir@ libexecdir = @libexecdir@ localedir = @localedir@ localstatedir = @localstatedir@ mandir = @mandir@ mkdir_p = @mkdir_p@ oldincludedir = @oldincludedir@ pdfdir = @pdfdir@ prefix = @prefix@ program_transform_name = @program_transform_name@ psdir = @psdir@ sbindir = @sbindir@ sharedstatedir = @sharedstatedir@ srcdir = @srcdir@ sysconfdir = @sysconfdir@ target_alias = @target_alias@ top_build_prefix = @top_build_prefix@ top_builddir = @top_builddir@ top_srcdir = @top_srcdir@ EXTRA_DIST = mtr_icon.xpm all: all-am .SUFFIXES: $(srcdir)/Makefile.in: $(srcdir)/Makefile.am $(am__configure_deps) @for dep in $?; do \ case '$(am__configure_deps)' in \ *$$dep*) \ ( cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh ) \ && { if test -f $@; then exit 0; else break; fi; }; \ exit 1;; \ esac; \ done; \ echo ' cd $(top_srcdir) && $(AUTOMAKE) --foreign img/Makefile'; \ $(am__cd) $(top_srcdir) && \ $(AUTOMAKE) --foreign img/Makefile .PRECIOUS: Makefile Makefile: $(srcdir)/Makefile.in $(top_builddir)/config.status @case '$?' in \ *config.status*) \ cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh;; \ *) \ echo ' cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe)'; \ cd $(top_builddir) && $(SHELL) ./config.status $(subdir)/$@ $(am__depfiles_maybe);; \ esac; $(top_builddir)/config.status: $(top_srcdir)/configure $(CONFIG_STATUS_DEPENDENCIES) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(top_srcdir)/configure: $(am__configure_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(ACLOCAL_M4): $(am__aclocal_m4_deps) cd $(top_builddir) && $(MAKE) $(AM_MAKEFLAGS) am--refresh $(am__aclocal_m4_deps): tags: TAGS TAGS: ctags: CTAGS CTAGS: distdir: $(DISTFILES) @srcdirstrip=`echo "$(srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ topsrcdirstrip=`echo "$(top_srcdir)" | sed 's/[].[^$$\\*]/\\\\&/g'`; \ list='$(DISTFILES)'; \ dist_files=`for file in $$list; do echo $$file; done | \ sed -e "s|^$$srcdirstrip/||;t" \ -e "s|^$$topsrcdirstrip/|$(top_builddir)/|;t"`; \ case $$dist_files in \ */*) $(MKDIR_P) `echo "$$dist_files" | \ sed '/\//!d;s|^|$(distdir)/|;s,/[^/]*$$,,' | \ sort -u` ;; \ esac; \ for file in $$dist_files; do \ if test -f $$file || test -d $$file; then d=.; else d=$(srcdir); fi; \ if test -d $$d/$$file; then \ dir=`echo "/$$file" | sed -e 's,/[^/]*$$,,'`; \ if test -d "$(distdir)/$$file"; then \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ if test -d $(srcdir)/$$file && test $$d != $(srcdir); then \ cp -fpR $(srcdir)/$$file "$(distdir)$$dir" || exit 1; \ find "$(distdir)/$$file" -type d ! -perm -700 -exec chmod u+rwx {} \;; \ fi; \ cp -fpR $$d/$$file "$(distdir)$$dir" || exit 1; \ else \ test -f "$(distdir)/$$file" \ || cp -p $$d/$$file "$(distdir)/$$file" \ || exit 1; \ fi; \ done check-am: all-am check: check-am all-am: Makefile installdirs: install: install-am install-exec: install-exec-am install-data: install-data-am uninstall: uninstall-am install-am: all-am @$(MAKE) $(AM_MAKEFLAGS) install-exec-am install-data-am installcheck: installcheck-am install-strip: $(MAKE) $(AM_MAKEFLAGS) INSTALL_PROGRAM="$(INSTALL_STRIP_PROGRAM)" \ install_sh_PROGRAM="$(INSTALL_STRIP_PROGRAM)" INSTALL_STRIP_FLAG=-s \ `test -z '$(STRIP)' || \ echo "INSTALL_PROGRAM_ENV=STRIPPROG='$(STRIP)'"` install mostlyclean-generic: clean-generic: distclean-generic: -test -z "$(CONFIG_CLEAN_FILES)" || rm -f $(CONFIG_CLEAN_FILES) -test . = "$(srcdir)" || test -z "$(CONFIG_CLEAN_VPATH_FILES)" || rm -f $(CONFIG_CLEAN_VPATH_FILES) maintainer-clean-generic: @echo "This command is intended for maintainers to use" @echo "it deletes files that may require special tools to rebuild." clean: clean-am clean-am: clean-generic mostlyclean-am distclean: distclean-am -rm -f Makefile distclean-am: clean-am distclean-generic dvi: dvi-am dvi-am: html: html-am html-am: info: info-am info-am: install-data-am: install-dvi: install-dvi-am install-dvi-am: install-exec-am: install-html: install-html-am install-html-am: install-info: install-info-am install-info-am: install-man: install-pdf: install-pdf-am install-pdf-am: install-ps: install-ps-am install-ps-am: installcheck-am: maintainer-clean: maintainer-clean-am -rm -f Makefile maintainer-clean-am: distclean-am maintainer-clean-generic mostlyclean: mostlyclean-am mostlyclean-am: mostlyclean-generic pdf: pdf-am pdf-am: ps: ps-am ps-am: uninstall-am: .MAKE: install-am install-strip .PHONY: all all-am check check-am clean clean-generic distclean \ distclean-generic distdir dvi dvi-am html html-am info info-am \ install install-am install-data install-data-am install-dvi \ install-dvi-am install-exec install-exec-am install-html \ install-html-am install-info install-info-am install-man \ install-pdf install-pdf-am install-ps install-ps-am \ install-strip installcheck installcheck-am installdirs \ maintainer-clean maintainer-clean-generic mostlyclean \ mostlyclean-generic pdf pdf-am ps ps-am uninstall uninstall-am # Tell versions [3.59,3.63) of GNU make to not export all variables. # Otherwise a system limit (for SysV at least) may be exceeded. .NOEXPORT: mtr-0.85/version.h0000664000175000017500000000136412162522254013131 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #define MTR_VERSION "0.85" mtr-0.85/report.c0000664000175000017500000002224712144202516012751 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #include #include #include #include "mtr.h" #include "version.h" #include "report.h" #include "net.h" #include "dns.h" #ifndef NO_IPINFO #include "asn.h" #endif #define MAXLOADBAL 5 extern int dns; extern char LocalHostname[]; extern char *Hostname; extern int fstTTL; extern int maxTTL; extern int cpacketsize; extern int bitpattern; extern int tos; extern int MaxPing; extern int af; extern int reportwide; char *get_time_string (void) { time_t now; char *t; now = time (NULL); t = ctime (&now); t [ strlen (t) -1] = 0; // remove the trailing newline return t; } void report_open(void) { printf ("Start: %s\n", get_time_string ()); } static size_t snprint_addr(char *dst, size_t dst_len, ip_t *addr) { if(addrcmp((void *) addr, (void *) &unspec_addr, af)) { struct hostent *host = dns ? addr2host((void *) addr, af) : NULL; if (!host) return snprintf(dst, dst_len, "%s", strlongip(addr)); else if (dns && show_ips) return snprintf(dst, dst_len, "%s (%s)", host->h_name, strlongip(addr)); else return snprintf(dst, dst_len, "%s", host->h_name); } else return snprintf(dst, dst_len, "%s", "???"); } #ifndef NO_IPINFO void print_mpls(struct mplslen *mpls) { int k; for (k=0; k < mpls->labels; k++) printf(" [MPLS: Lbl %lu Exp %u S %u TTL %u]\n", mpls->label[k], mpls->exp[k], mpls->s[k], mpls->ttl[k]); } #endif void report_close(void) { int i, j, at, max, z, w; struct mplslen *mpls, *mplss; ip_t *addr; ip_t *addr2 = NULL; char name[81]; char buf[1024]; char fmt[16]; int len=0; int len_hosts = 33; if (reportwide) { // get the longest hostname len_hosts = strlen(LocalHostname); max = net_max(); at = net_min(); for (; at < max; at++) { int nlen; addr = net_addr(at); if ((nlen = snprint_addr(name, sizeof(name), addr))) if (len_hosts < nlen) len_hosts = nlen; } } #ifndef NO_IPINFO int len_tmp = len_hosts; if (ipinfo_no >= 0) { ipinfo_no %= iiwidth_len; if (reportwide) { len_hosts++; // space len_tmp += get_iiwidth(); if (!ipinfo_no) len_tmp += 2; // align header: AS } } snprintf( fmt, sizeof(fmt), "HOST: %%-%ds", len_tmp); #else snprintf( fmt, sizeof(fmt), "HOST: %%-%ds", len_hosts); #endif snprintf(buf, sizeof(buf), fmt, LocalHostname); len = reportwide ? strlen(buf) : len_hosts; for( i=0; ilabels && z == 1 && enablempls) print_mpls(mpls); snprint_addr(name, sizeof(name), addr2); printf(" %s%s\n", fmt_ipinfo(addr2), name); if (enablempls) print_mpls(mplss); } else { #else int k; if (mpls->labels && z == 1 && enablempls) { for (k=0; k < mpls->labels; k++) { printf(" | |+-- [MPLS: Lbl %lu Exp %u S %u TTL %u]\n", mpls->label[k], mpls->exp[k], mpls->s[k], mpls->ttl[k]); } } if (z == 1) { printf (" | `|-- %s\n", strlongip(addr2)); for (k=0; k < mplss->labels && enablempls; k++) { printf(" | +-- [MPLS: Lbl %lu Exp %u S %u TTL %u]\n", mplss->label[k], mplss->exp[k], mplss->s[k], mplss->ttl[k]); } } else { printf (" | |-- %s\n", strlongip(addr2)); for (k=0; k < mplss->labels && enablempls; k++) { printf(" | +-- [MPLS: Lbl %lu Exp %u S %u TTL %u]\n", mplss->label[k], mplss->exp[k], mplss->s[k], mplss->ttl[k]); } } #endif #ifndef NO_IPINFO } #endif } } /* No multipath */ #ifndef NO_IPINFO if (is_printii()) { if (mpls->labels && z == 1 && enablempls) print_mpls(mpls); } else { #else if(mpls->labels && z == 1 && enablempls) { int k; for (k=0; k < mpls->labels; k++) { printf(" | +-- [MPLS: Lbl %lu Exp %u S %u TTL %u]\n", mpls->label[k], mpls->exp[k], mpls->s[k], mpls->ttl[k]); } } #endif #ifndef NO_IPINFO } #endif } } void txt_open(void) { } void txt_close(void) { report_close(); } void xml_open(void) { } void xml_close(void) { int i, j, at, max; ip_t *addr; char name[81]; printf("= 0) { printf(" PSIZE=%d", cpacketsize); } else { printf(" PSIZE=rand(%d-%d)",MINPACKET, -cpacketsize); } if( bitpattern>=0 ) { printf(" BITPATTERN=0x%02X", (unsigned char)(bitpattern)); } else { printf(" BITPATTERN=rand(0x00-FF)"); } printf(" TESTS=%d>\n", MaxPing); max = net_max(); at = net_min(); for(; at < max; at++) { addr = net_addr(at); snprint_addr(name, sizeof(name), addr); printf(" \n", at+1, name); for( i=0; i"); strcat(name, data_fields[j].format); strcat(name, "\n"); /* 1000.0 is a temporay hack for stats usec to ms, impacted net_loss. */ if( index( data_fields[j].format, 'f' ) ) { printf( name, data_fields[j].title, data_fields[j].net_xxx(at) /1000.0, data_fields[j].title ); } else { printf( name, data_fields[j].title, data_fields[j].net_xxx(at), data_fields[j].title ); } } printf(" \n"); } printf("\n"); } void csv_open(void) { } void csv_close(time_t now) { int i, j, at, max; ip_t *addr; char name[81]; for( i=0; i #if defined(HAVE_SYS_XTI_H) #include #endif #include #include #include #include #include #include #include #include #ifdef HAVE_FCNTL_H #include #endif #include #include #include #include #include #include "mtr.h" #include "net.h" #include "display.h" #include "dns.h" /* We can't rely on header files to provide this information, because the fields have different names between, for instance, Linux and Solaris */ struct ICMPHeader { uint8 type; uint8 code; uint16 checksum; uint16 id; uint16 sequence; }; /* Structure of an UDP header. */ struct UDPHeader { uint16 srcport; uint16 dstport; uint16 length; uint16 checksum; }; /* Structure of an TCP header, as far as we need it. */ struct TCPHeader { uint16 srcport; uint16 dstport; uint32 seq; }; /* Structure of an IPv4 UDP pseudoheader. */ struct UDPv4PHeader { uint32 saddr; uint32 daddr; uint8 zero; uint8 protocol; uint16 len; }; /* Structure of an IP header. */ struct IPHeader { uint8 version; uint8 tos; uint16 len; uint16 id; uint16 frag; uint8 ttl; uint8 protocol; uint16 check; uint32 saddr; uint32 daddr; }; #define ICMP_ECHO 8 #define ICMP_ECHOREPLY 0 #define ICMP_TSTAMP 13 #define ICMP_TSTAMPREPLY 14 #define ICMP_TIME_EXCEEDED 11 #define ICMP_UNREACHABLE 3 #ifndef SOL_IP #define SOL_IP 0 #endif struct nethost { ip_t addr; ip_t addrs[MAXPATH]; /* for multi paths byMin */ int xmit; int returned; int sent; int up; long long var;/* variance, could be overflowed */ int last; int best; int worst; int avg; /* average: addByMin */ int gmean; /* geometirc mean: addByMin */ int jitter; /* current jitter, defined as t1-t0 addByMin */ /*int jbest;*/ /* min jitter, of cause it is 0, not needed */ int javg; /* avg jitter */ int jworst; /* max jitter */ int jinta; /* estimated variance,? rfc1889's "Interarrival Jitter" */ int transit; int saved[SAVED_PINGS]; int saved_seq_offset; struct mplslen mpls; struct mplslen mplss[MAXPATH]; }; struct sequence { int index; int transit; int saved_seq; struct timeval time; int socket; }; /* Configuration parameter: How many queries to unknown hosts do we send? (This limits the amount of traffic generated if a host is not reachable) */ #define MAX_UNKNOWN_HOSTS 5 /* BSD-derived kernels use host byte order for the IP length and offset fields when using raw sockets. We detect this automatically at run-time and do the right thing. */ static int BSDfix = 0; static struct nethost host[MaxHost]; static struct sequence sequence[MaxSequence]; static struct timeval reset = { 0, 0 }; int timestamp; int sendsock4; int sendsock4_icmp; int sendsock4_udp; int recvsock4; int sendsock6; int sendsock6_icmp; int sendsock6_udp; int recvsock6; int sendsock; int recvsock; #ifdef ENABLE_IPV6 struct sockaddr_storage sourcesockaddr_struct; struct sockaddr_storage remotesockaddr_struct; struct sockaddr_in6 * ssa6 = (struct sockaddr_in6 *) &sourcesockaddr_struct; struct sockaddr_in6 * rsa6 = (struct sockaddr_in6 *) &remotesockaddr_struct; #else struct sockaddr_in sourcesockaddr_struct; struct sockaddr_in remotesockaddr_struct; #endif struct sockaddr * sourcesockaddr = (struct sockaddr *) &sourcesockaddr_struct; struct sockaddr * remotesockaddr = (struct sockaddr *) &remotesockaddr_struct; struct sockaddr_in * ssa4 = (struct sockaddr_in *) &sourcesockaddr_struct; struct sockaddr_in * rsa4 = (struct sockaddr_in *) &remotesockaddr_struct; ip_t * sourceaddress; ip_t * remoteaddress; /* XXX How do I code this to be IPV6 compatible??? */ #ifdef ENABLE_IPV6 char localaddr[INET6_ADDRSTRLEN]; #else #ifndef INET_ADDRSTRLEN #define INET_ADDRSTRLEN 16 #endif char localaddr[INET_ADDRSTRLEN]; #endif static int batch_at = 0; static int numhosts = 10; extern int fstTTL; /* initial hub(ttl) to ping byMin */ extern int maxTTL; /* last hub to ping byMin*/ extern int cpacketsize; /* packet size used by ping */ static int packetsize; /* packet size used by ping */ extern int bitpattern; /* packet bit pattern used by ping */ extern int tos; /* type of service set in ping packet*/ extern int af; /* address family of remote target */ extern int mtrtype; /* type of query packet used */ extern int remoteport; /* target port for TCP tracing */ extern int timeout; /* timeout for TCP connections */ /* return the number of microseconds to wait before sending the next ping */ int calc_deltatime (float waittime) { waittime /= numhosts; return 1000000 * waittime; } /* This doesn't work for odd sz. I don't know enough about this to say that this is wrong. It doesn't seem to cripple mtr though. -- REW */ int checksum(void *data, int sz) { unsigned short *ch; unsigned int sum; sum = 0; ch = data; sz = sz / 2; while (sz--) { sum += *(ch++); } sum = (sum >> 16) + (sum & 0xffff); return (~sum & 0xffff); } /* Prepend pseudoheader to the udp datagram and calculate checksum */ int udp_checksum(void *pheader, void *udata, int psize, int dsize) { unsigned int tsize = psize + dsize; char csumpacket[tsize]; memset(csumpacket, (unsigned char) abs(bitpattern), abs(tsize)); struct UDPv4PHeader *prepend = (struct UDPv4PHeader *) csumpacket; struct UDPv4PHeader *udppheader = (struct UDPv4PHeader *) pheader; prepend->saddr = udppheader->saddr; prepend->daddr = udppheader->daddr; prepend->zero = 0; prepend->protocol = udppheader->protocol; prepend->len = udppheader->len; struct UDPHeader *content = (struct UDPHeader *)(csumpacket + psize); struct UDPHeader *udpdata = (struct UDPHeader *) udata; content->srcport = udpdata->srcport; content->dstport = udpdata->dstport; content->length = udpdata->length; content->checksum = udpdata->checksum; return checksum(csumpacket,tsize); } void save_sequence(int index, int seq) { sequence[seq].index = index; sequence[seq].transit = 1; sequence[seq].saved_seq = ++host[index].xmit; memset(&sequence[seq].time, 0, sizeof(sequence[seq].time)); host[index].transit = 1; if (host[index].sent) host[index].up = 0; host[index].sent = 1; net_save_xmit(index); } int new_sequence(int index) { static int next_sequence = MinSequence; int seq; seq = next_sequence++; if (next_sequence >= MaxSequence) next_sequence = MinSequence; save_sequence(index, seq); return seq; } /* Attempt to connect to a TCP port with a TTL */ void net_send_tcp(int index) { int ttl, s; int opt = 1; int port; struct sockaddr_storage local; struct sockaddr_storage remote; struct sockaddr_in *local4 = (struct sockaddr_in *) &local; struct sockaddr_in6 *local6 = (struct sockaddr_in6 *) &local; struct sockaddr_in *remote4 = (struct sockaddr_in *) &remote; struct sockaddr_in6 *remote6 = (struct sockaddr_in6 *) &remote; socklen_t len; ttl = index + 1; s = socket(af, SOCK_STREAM, 0); if (s < 0) { display_clear(); perror("socket()"); exit(EXIT_FAILURE); } memset(&local, 0, sizeof (local)); memset(&remote, 0, sizeof (remote)); local.ss_family = af; remote.ss_family = af; switch (af) { case AF_INET: addrcpy((void *) &local4->sin_addr, (void *) &ssa4->sin_addr, af); addrcpy((void *) &remote4->sin_addr, (void *) remoteaddress, af); remote4->sin_port = htons(remoteport); break; #ifdef ENABLE_IPV6 case AF_INET6: addrcpy((void *) &local6->sin6_addr, (void *) &ssa6->sin6_addr, af); addrcpy((void *) &remote6->sin6_addr, (void *) remoteaddress, af); remote6->sin6_port = htons(remoteport); break; #endif } if (bind(s, (struct sockaddr *) &local, sizeof (local))) { display_clear(); perror("bind()"); exit(EXIT_FAILURE); } len = sizeof (local); if (getsockname(s, (struct sockaddr *) &local, &len)) { display_clear(); perror("getsockname()"); exit(EXIT_FAILURE); } opt = 1; if (ioctl(s, FIONBIO, &opt)) { display_clear(); perror("ioctl FIONBIO"); exit(EXIT_FAILURE); } switch (af) { case AF_INET: if (setsockopt(s, IPPROTO_IP, IP_TTL, &ttl, sizeof (ttl))) { display_clear(); perror("setsockopt IP_TTL"); exit(EXIT_FAILURE); } if (setsockopt(s, IPPROTO_IP, IP_TOS, &tos, sizeof (tos))) { display_clear(); perror("setsockopt IP_TOS"); exit(EXIT_FAILURE); } break; #ifdef ENABLE_IPV6 case AF_INET6: if (setsockopt(s, IPPROTO_IPV6, IPV6_UNICAST_HOPS, &ttl, sizeof (ttl))) { display_clear(); perror("setsockopt IP_TTL"); exit(EXIT_FAILURE); } break; #endif } switch (local.ss_family) { case AF_INET: port = ntohs(local4->sin_port); break; #ifdef ENABLE_IPV6 case AF_INET6: port = ntohs(local6->sin6_port); break; #endif default: display_clear(); perror("unknown AF?"); exit(EXIT_FAILURE); } save_sequence(index, port); gettimeofday(&sequence[port].time, NULL); sequence[port].socket = s; connect(s, (struct sockaddr *) &remote, sizeof (remote)); } /* Attempt to find the host at a particular number of hops away */ void net_send_query(int index) { if (mtrtype == IPPROTO_TCP) { net_send_tcp(index); return; } /*ok char packet[sizeof(struct IPHeader) + sizeof(struct ICMPHeader)];*/ char packet[MAXPACKET]; struct IPHeader *ip = (struct IPHeader *) packet; struct ICMPHeader *icmp = NULL; struct UDPHeader *udp = NULL; struct UDPv4PHeader *udpp = NULL; uint16 mypid; /*ok int packetsize = sizeof(struct IPHeader) + sizeof(struct ICMPHeader) + datasize;*/ int rv; static int first=1; int ttl, iphsize = 0, echotype = 0, salen = 0; ttl = index + 1; #ifdef ENABLE_IPV6 /* offset for ipv6 checksum calculation */ int offset = 6; #endif if ( packetsize < MINPACKET ) packetsize = MINPACKET; if ( packetsize > MAXPACKET ) packetsize = MAXPACKET; memset(packet, (unsigned char) abs(bitpattern), abs(packetsize)); switch ( af ) { case AF_INET: #if !defined(IP_HDRINCL) && defined(IP_TOS) && defined(IP_TTL) iphsize = 0; if ( setsockopt( sendsock, IPPROTO_IP, IP_TOS, &tos, sizeof tos ) ) { perror( "setsockopt IP_TOS" ); exit( EXIT_FAILURE ); } if ( setsockopt( sendsock, IPPROTO_IP, IP_TTL, &ttl, sizeof ttl ) ) { perror( "setsockopt IP_TTL" ); exit( EXIT_FAILURE ); } #else iphsize = sizeof (struct IPHeader); ip->version = 0x45; ip->tos = tos; ip->len = BSDfix ? abs(packetsize): htons (abs(packetsize)); ip->id = 0; ip->frag = 0; /* 1, if want to find mtu size? Min */ ip->ttl = ttl; ip->protocol = mtrtype; ip->check = 0; /* BSD needs the source address here, Linux & others do not... */ addrcpy( (void *) &(ip->saddr), (void *) &(ssa4->sin_addr), AF_INET ); addrcpy( (void *) &(ip->daddr), (void *) remoteaddress, AF_INET ); #endif echotype = ICMP_ECHO; salen = sizeof (struct sockaddr_in); break; #ifdef ENABLE_IPV6 case AF_INET6: iphsize = 0; if ( setsockopt( sendsock, IPPROTO_IPV6, IPV6_UNICAST_HOPS, &ttl, sizeof ttl ) ) { perror( "setsockopt IPV6_UNICAST_HOPS" ); exit( EXIT_FAILURE); } echotype = ICMP6_ECHO_REQUEST; salen = sizeof (struct sockaddr_in6); break; #endif } switch ( mtrtype ) { case IPPROTO_ICMP: icmp = (struct ICMPHeader *)(packet + iphsize); icmp->type = echotype; icmp->code = 0; icmp->checksum = 0; icmp->id = getpid(); icmp->sequence = new_sequence(index); icmp->checksum = checksum(icmp, abs(packetsize) - iphsize); gettimeofday(&sequence[icmp->sequence].time, NULL); break; case IPPROTO_UDP: udp = (struct UDPHeader *)(packet + iphsize); udp->checksum = 0; mypid = (uint16)getpid(); if (mypid < MinPort) mypid += MinPort; udp->srcport = htons(mypid); udp->length = abs(packetsize) - iphsize; if(!BSDfix) udp->length = htons(udp->length); udp->dstport = new_sequence(index); gettimeofday(&sequence[udp->dstport].time, NULL); udp->dstport = htons(udp->dstport); break; } switch ( af ) { case AF_INET: switch ( mtrtype ) { case IPPROTO_UDP: /* checksum is not mandatory. only calculate if we know ip->saddr */ if (ip->saddr) { udpp = (struct UDPv4PHeader *)(malloc(sizeof(struct UDPv4PHeader))); udpp->saddr = ip->saddr; udpp->daddr = ip->daddr; udpp->protocol = ip->protocol; udpp->len = udp->length; udp->checksum = udp_checksum(udpp, udp, sizeof(struct UDPv4PHeader), abs(packetsize) - iphsize); } break; } ip->check = checksum(packet, abs(packetsize)); break; #ifdef ENABLE_IPV6 case AF_INET6: switch ( mtrtype ) { case IPPROTO_UDP: /* kernel checksum calculation */ if ( setsockopt(sendsock, IPPROTO_IPV6, IPV6_CHECKSUM, &offset, sizeof(offset)) ) { perror( "setsockopt IPV6_CHECKSUM" ); exit( EXIT_FAILURE); } break; } break; #endif } rv = sendto(sendsock, packet, abs(packetsize), 0, remotesockaddr, salen); if (first && (rv < 0) && ((errno == EINVAL) || (errno == EMSGSIZE))) { /* Try the first packet again using host byte order. */ ip->len = abs (packetsize); rv = sendto(sendsock, packet, abs(packetsize), 0, remotesockaddr, salen); if (rv >= 0) { BSDfix = 1; } } first = 0; } /* We got a return on something we sent out. Record the address and time. */ void net_process_ping(int seq, struct mplslen mpls, void * addr, struct timeval now) { int index; int totusec; int oldavg; /* usedByMin */ int oldjavg; /* usedByMin */ int i; /* usedByMin */ #ifdef ENABLE_IPV6 char addrcopy[sizeof(struct in6_addr)]; #else char addrcopy[sizeof(struct in_addr)]; #endif /* Copy the from address ASAP because it can be overwritten */ addrcpy( (void *) &addrcopy, addr, af ); if (seq < 0 || seq >= MaxSequence) return; if (!sequence[seq].transit) return; sequence[seq].transit = 0; if (sequence[seq].socket > 0) { close(sequence[seq].socket); sequence[seq].socket = 0; } index = sequence[seq].index; totusec = (now.tv_sec - sequence[seq].time.tv_sec ) * 1000000 + (now.tv_usec - sequence[seq].time.tv_usec); /* impossible? if( totusec < 0 ) totusec = 0 */; if ( addrcmp( (void *) &(host[index].addr), (void *) &unspec_addr, af ) == 0 ) { /* should be out of if as addr can change */ addrcpy( (void *) &(host[index].addr), addrcopy, af ); host[index].mpls = mpls; display_rawhost(index, (void *) &(host[index].addr)); /* multi paths */ addrcpy( (void *) &(host[index].addrs[0]), addrcopy, af ); host[index].mplss[0] = mpls; } else { for( i=0; i=best[index-1] if index>0 * 2) best >= average-20,000 usec (good number?) if (index > 0) { if (totusec < host[index].best && totusec>= host[index-1].best) host[index].best = totusec; } else { if(totusec < host[index].best) host[index].best = totusec; } */ if (totusec < host[index].best ) host[index].best = totusec; if (totusec > host[index].worst) host[index].worst = totusec; if (host[index].jitter > host[index].jworst) host[index].jworst = host[index].jitter; host[index].returned++; oldavg = host[index].avg; host[index].avg += (totusec - oldavg +.0) / host[index].returned; host[index].var += (totusec - oldavg +.0) * (totusec - host[index].avg) / 1000000; oldjavg = host[index].javg; host[index].javg += (host[index].jitter - oldjavg) / host[index].returned; /* below algorithm is from rfc1889, A.8 */ host[index].jinta += host[index].jitter - ((host[index].jinta + 8) >> 4); if ( host[index].returned > 1 ) host[index].gmean = pow( (double) host[index].gmean, (host[index].returned-1.0)/host[index].returned ) * pow( (double) totusec, 1.0/host[index].returned ); host[index].sent = 0; host[index].up = 1; host[index].transit = 0; net_save_return(index, sequence[seq].saved_seq, totusec); display_rawping(index, totusec); } /* We know a packet has come in, because the main select loop has called us, now we just need to read it, see if it is for us, and if it is a reply to something we sent, then call net_process_ping() */ void net_process_return(void) { char packet[MAXPACKET]; #ifdef ENABLE_IPV6 struct sockaddr_storage fromsockaddr_struct; struct sockaddr_in6 * fsa6 = (struct sockaddr_in6 *) &fromsockaddr_struct; #else struct sockaddr_in fromsockaddr_struct; #endif struct sockaddr * fromsockaddr = (struct sockaddr *) &fromsockaddr_struct; struct sockaddr_in * fsa4 = (struct sockaddr_in *) &fromsockaddr_struct; socklen_t fromsockaddrsize; int num; struct ICMPHeader *header = NULL; struct UDPHeader *udpheader = NULL; struct TCPHeader *tcpheader = NULL; struct timeval now; ip_t * fromaddress = NULL; int echoreplytype = 0, timeexceededtype = 0, unreachabletype = 0; int sequence = 0; /* MPLS decoding */ struct mplslen mpls; mpls.labels = 0; gettimeofday(&now, NULL); switch ( af ) { case AF_INET: fromsockaddrsize = sizeof (struct sockaddr_in); fromaddress = (ip_t *) &(fsa4->sin_addr); echoreplytype = ICMP_ECHOREPLY; timeexceededtype = ICMP_TIME_EXCEEDED; unreachabletype = ICMP_UNREACHABLE; break; #ifdef ENABLE_IPV6 case AF_INET6: fromsockaddrsize = sizeof (struct sockaddr_in6); fromaddress = (ip_t *) &(fsa6->sin6_addr); echoreplytype = ICMP6_ECHO_REPLY; timeexceededtype = ICMP6_TIME_EXCEEDED; unreachabletype = ICMP6_DST_UNREACH; break; #endif } num = recvfrom(recvsock, packet, MAXPACKET, 0, fromsockaddr, &fromsockaddrsize); switch ( af ) { case AF_INET: if((size_t) num < sizeof(struct IPHeader) + sizeof(struct ICMPHeader)) return; header = (struct ICMPHeader *)(packet + sizeof(struct IPHeader)); break; #ifdef ENABLE_IPV6 case AF_INET6: if(num < sizeof(struct ICMPHeader)) return; header = (struct ICMPHeader *) packet; break; #endif } switch ( mtrtype ) { case IPPROTO_ICMP: if (header->type == echoreplytype) { if(header->id != (uint16)getpid()) return; sequence = header->sequence; } else if (header->type == timeexceededtype) { switch ( af ) { case AF_INET: if ((size_t) num < sizeof(struct IPHeader) + sizeof(struct ICMPHeader) + sizeof (struct IPHeader) + sizeof (struct ICMPHeader)) return; header = (struct ICMPHeader *)(packet + sizeof (struct IPHeader) + sizeof (struct ICMPHeader) + sizeof (struct IPHeader)); if(num > 160) decodempls(num, packet, &mpls, 156); break; #ifdef ENABLE_IPV6 case AF_INET6: if ( num < sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) + sizeof (struct ICMPHeader) ) return; header = (struct ICMPHeader *) ( packet + sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) ); if(num > 140) decodempls(num, packet, &mpls, 136); break; #endif } if (header->id != (uint16)getpid()) return; sequence = header->sequence; } break; case IPPROTO_UDP: if (header->type == timeexceededtype || header->type == unreachabletype) { switch ( af ) { case AF_INET: if ((size_t) num < sizeof(struct IPHeader) + sizeof(struct ICMPHeader) + sizeof (struct IPHeader) + sizeof (struct UDPHeader)) return; udpheader = (struct UDPHeader *)(packet + sizeof (struct IPHeader) + sizeof (struct ICMPHeader) + sizeof (struct IPHeader)); if(num > 160) decodempls(num, packet, &mpls, 156); break; #ifdef ENABLE_IPV6 case AF_INET6: if ( num < sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) + sizeof (struct UDPHeader) ) return; udpheader = (struct UDPHeader *) ( packet + sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) ); if(num > 140) decodempls(num, packet, &mpls, 136); break; #endif } sequence = ntohs(udpheader->dstport); } break; case IPPROTO_TCP: if (header->type == timeexceededtype || header->type == unreachabletype) { switch ( af ) { case AF_INET: if ((size_t) num < sizeof(struct IPHeader) + sizeof(struct ICMPHeader) + sizeof (struct IPHeader) + sizeof (struct TCPHeader)) return; tcpheader = (struct TCPHeader *)(packet + sizeof (struct IPHeader) + sizeof (struct ICMPHeader) + sizeof (struct IPHeader)); if(num > 160) decodempls(num, packet, &mpls, 156); break; #ifdef ENABLE_IPV6 case AF_INET6: if ( num < sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) + sizeof (struct TCPHeader) ) return; tcpheader = (struct TCPHeader *) ( packet + sizeof (struct ICMPHeader) + sizeof (struct ip6_hdr) ); if(num > 140) decodempls(num, packet, &mpls, 136); break; #endif } sequence = ntohs(tcpheader->srcport); } break; } if (sequence) net_process_ping (sequence, mpls, (void *) fromaddress, now); } ip_t *net_addr(int at) { return (ip_t *)&(host[at].addr); } ip_t *net_addrs(int at, int i) { return (ip_t *)&(host[at].addrs[i]); } void *net_mpls(int at) { return (struct mplslen *)&(host[at].mplss); } void *net_mplss(int at, int i) { return (struct mplslen *)&(host[at].mplss[i]); } int net_loss(int at) { if ((host[at].xmit - host[at].transit) == 0) return 0; /* times extra 1000 */ return 1000*(100 - (100.0 * host[at].returned / (host[at].xmit - host[at].transit)) ); } int net_drop(int at) { return (host[at].xmit - host[at].transit) - host[at].returned; } int net_last(int at) { return (host[at].last); } int net_best(int at) { return (host[at].best); } int net_worst(int at) { return (host[at].worst); } int net_avg(int at) { return (host[at].avg); } int net_gmean(int at) { return (host[at].gmean); } int net_stdev(int at) { if( host[at].returned > 1 ) { return ( 1000.0 * sqrt( host[at].var/(host[at].returned -1.0) ) ); } else { return( 0 ); } } int net_jitter(int at) { return (host[at].jitter); } int net_jworst(int at) { return (host[at].jworst); } int net_javg(int at) { return (host[at].javg); } int net_jinta(int at) { return (host[at].jinta); } int net_max(void) { int at; int max; max = 0; /* for(at = 0; at < MaxHost-2; at++) { */ for(at = 0; at < maxTTL-1; at++) { if ( addrcmp( (void *) &(host[at].addr), (void *) remoteaddress, af ) == 0 ) { return at + 1; } else if ( addrcmp( (void *) &(host[at].addr), (void *) &unspec_addr, af ) != 0 ) { max = at + 2; } } return max; } int net_min (void) { return ( fstTTL - 1 ); } int net_returned(int at) { return host[at].returned; } int net_xmit(int at) { return host[at].xmit; } int net_transit(int at) { return host[at].transit; } int net_up(int at) { return host[at].up; } char * net_localaddr (void) { return localaddr; } void net_end_transit(void) { int at; for(at = 0; at < MaxHost; at++) { host[at].transit = 0; } } int net_send_batch(void) { int n_unknown=0, i; /* randomized packet size and/or bit pattern if packetsize<0 and/or bitpattern<0. abs(packetsize) and/or abs(bitpattern) will be used */ if( batch_at < fstTTL ) { if( cpacketsize < 0 ) { /* Someone used a formula here that tried to correct for the "end-error" in "rand()". By "end-error" I mean that if you have a range for "rand()" that runs to 32768, and the destination range is 10000, you end up with 4 out of 32768 0-2768's and only 3 out of 32768 for results 2769 .. 9999. As our detination range (in the example 10000) is much smaller (reasonable packet sizes), and our rand() range much larger, this effect is insignificant. Oh! That other formula didn't work. */ packetsize = MINPACKET + rand () % (-cpacketsize - MINPACKET); } else { packetsize = cpacketsize; } if( bitpattern < 0 ) { bitpattern = - (int)(256 + 255*(rand()/(RAND_MAX+0.1))); } } /* printf ("cpacketsize = %d, packetsize = %d\n", cpacketsize, packetsize); */ net_send_query(batch_at); for (i=fstTTL-1;i MAX_UNKNOWN_HOSTS) || /* or reach limit */ (batch_at >= maxTTL-1)) { numhosts = batch_at+1; batch_at = fstTTL - 1; return 1; } batch_at++; return 0; } static void set_fd_flags(int fd) { #if defined(HAVE_FCNTL) && defined(FD_CLOEXEC) int oldflags; if (fd < 0) return; oldflags = fcntl(fd, F_GETFD); if (oldflags == -1) { perror("Couldn't get fd's flags"); return; } if (fcntl(fd, F_SETFD, oldflags | FD_CLOEXEC)) perror("Couldn't set fd's flags"); #endif } int net_preopen(void) { int trueopt = 1; #if !defined(IP_HDRINCL) && defined(IP_TOS) && defined(IP_TTL) sendsock4_icmp = socket(AF_INET, SOCK_RAW, IPPROTO_ICMP); sendsock4_udp = socket(AF_INET, SOCK_RAW, IPPROTO_UDP); #else sendsock4 = socket(AF_INET, SOCK_RAW, IPPROTO_RAW); #endif if (sendsock4 < 0) return -1; #ifdef ENABLE_IPV6 sendsock6_icmp = socket(AF_INET6, SOCK_RAW, IPPROTO_ICMPV6); sendsock6_udp = socket(AF_INET6, SOCK_RAW, IPPROTO_UDP); #endif #ifdef IP_HDRINCL /* FreeBSD wants this to avoid sending out packets with protocol type RAW to the network. */ if (setsockopt(sendsock4, SOL_IP, IP_HDRINCL, &trueopt, sizeof(trueopt))) { perror("setsockopt(IP_HDRINCL,1)"); return -1; } #endif /* IP_HDRINCL */ recvsock4 = socket(AF_INET, SOCK_RAW, IPPROTO_ICMP); if (recvsock4 < 0) return -1; set_fd_flags(recvsock4); #ifdef ENABLE_IPV6 recvsock6 = socket(AF_INET6, SOCK_RAW, IPPROTO_ICMPV6); if (recvsock6 >= 0) set_fd_flags(recvsock6); #endif return 0; } int net_selectsocket(void) { #if !defined(IP_HDRINCL) && defined(IP_TOS) && defined(IP_TTL) switch ( mtrtype ) { case IPPROTO_ICMP: sendsock4 = sendsock4_icmp; break; case IPPROTO_UDP: sendsock4 = sendsock4_udp; break; } #endif if (sendsock4 < 0) return -1; #ifdef ENABLE_IPV6 switch ( mtrtype ) { case IPPROTO_ICMP: sendsock6 = sendsock6_icmp; break; case IPPROTO_UDP: sendsock6 = sendsock6_udp; break; } if ((sendsock6 < 0) && (sendsock4 < 0)) return -1; #endif return 0; } int net_open(struct hostent * host) { #ifdef ENABLE_IPV6 struct sockaddr_storage name_struct; #else struct sockaddr_in name_struct; #endif struct sockaddr * name = (struct sockaddr *) &name_struct; socklen_t len; net_reset(); remotesockaddr->sa_family = host->h_addrtype; switch ( host->h_addrtype ) { case AF_INET: sendsock = sendsock4; recvsock = recvsock4; addrcpy( (void *) &(rsa4->sin_addr), host->h_addr, AF_INET ); sourceaddress = (ip_t *) &(ssa4->sin_addr); remoteaddress = (ip_t *) &(rsa4->sin_addr); break; #ifdef ENABLE_IPV6 case AF_INET6: if (sendsock6 < 0 || recvsock6 < 0) { fprintf( stderr, "Could not open IPv6 socket\n" ); exit( EXIT_FAILURE ); } sendsock = sendsock6; recvsock = recvsock6; addrcpy( (void *) &(rsa6->sin6_addr), host->h_addr, AF_INET6 ); sourceaddress = (ip_t *) &(ssa6->sin6_addr); remoteaddress = (ip_t *) &(rsa6->sin6_addr); break; #endif default: fprintf( stderr, "net_open bad address type\n" ); exit( EXIT_FAILURE ); } len = sizeof name_struct; getsockname (recvsock, name, &len); sockaddrtop( name, localaddr, sizeof localaddr ); #if 0 printf ("got localaddr: %s\n", localaddr); #endif return 0; } void net_reopen(struct hostent * addr) { int at; for(at = 0; at < MaxHost; at++) { memset(&host[at], 0, sizeof(host[at])); } remotesockaddr->sa_family = addr->h_addrtype; addrcpy( (void *) remoteaddress, addr->h_addr, addr->h_addrtype ); switch ( addr->h_addrtype ) { case AF_INET: addrcpy( (void *) &(rsa4->sin_addr), addr->h_addr, AF_INET ); break; #ifdef ENABLE_IPV6 case AF_INET6: addrcpy( (void *) &(rsa6->sin6_addr), addr->h_addr, AF_INET6 ); break; #endif default: fprintf( stderr, "net_reopen bad address type\n" ); exit( EXIT_FAILURE ); } net_reset (); net_send_batch(); } void net_reset(void) { int at; int i; batch_at = fstTTL - 1; /* above replacedByMin */ numhosts = 10; for (at = 0; at < MaxHost; at++) { host[at].xmit = 0; host[at].transit = 0; host[at].returned = 0; host[at].sent = 0; host[at].up = 0; host[at].last = 0; host[at].avg = 0; host[at].best = 0; host[at].worst = 0; host[at].gmean = 0; host[at].var = 0; host[at].jitter = 0; host[at].javg = 0; host[at].jworst = 0; host[at].jinta = 0; for (i=0; i 0) { close(sequence[at].socket); sequence[at].socket = 0; } } gettimeofday(&reset, NULL); } int net_set_interfaceaddress (char *InterfaceAddress) { int len = 0; if (!InterfaceAddress) return 0; sourcesockaddr->sa_family = af; switch ( af ) { case AF_INET: ssa4->sin_port = 0; if ( inet_aton( InterfaceAddress, &(ssa4->sin_addr) ) < 1 ) { fprintf( stderr, "mtr: bad interface address: %s\n", InterfaceAddress ); return( 1 ); } len = sizeof (struct sockaddr); break; #ifdef ENABLE_IPV6 case AF_INET6: ssa6->sin6_port = 0; if ( inet_pton( af, InterfaceAddress, &(ssa6->sin6_addr) ) < 1 ) { fprintf( stderr, "mtr: bad interface address: %s\n", InterfaceAddress ); return( 1 ); } len = sizeof (struct sockaddr_in6); break; #endif } if ( bind( sendsock, sourcesockaddr, len ) == -1 ) { perror("mtr: failed to bind to interface"); return( 1 ); } return 0; } void net_close(void) { if (sendsock4 >= 0) { close(sendsock4_icmp); close(sendsock4_udp); } if (recvsock4 >= 0) close(recvsock4); if (sendsock6 >= 0) { close(sendsock6_icmp); close(sendsock6_udp); } if (recvsock6 >= 0) close(recvsock6); } int net_waitfd(void) { return recvsock; } int* net_saved_pings(int at) { return host[at].saved; } void net_save_increment(void) { int at; for (at = 0; at < MaxHost; at++) { memmove(host[at].saved, host[at].saved+1, (SAVED_PINGS-1)*sizeof(int)); host[at].saved[SAVED_PINGS-1] = -2; host[at].saved_seq_offset += 1; } } void net_save_xmit(int at) { if (host[at].saved[SAVED_PINGS-1] != -2) net_save_increment(); host[at].saved[SAVED_PINGS-1] = -1; } void net_save_return(int at, int seq, int ms) { int idx; idx = seq - host[at].saved_seq_offset; if (idx < 0 || idx > SAVED_PINGS) { return; } host[at].saved[idx] = ms; } /* Similar to inet_ntop but uses a sockaddr as it's argument. */ void sockaddrtop( struct sockaddr * saddr, char * strptr, size_t len ) { struct sockaddr_in * sa4; #ifdef ENABLE_IPV6 struct sockaddr_in6 * sa6; #endif switch ( saddr->sa_family ) { case AF_INET: sa4 = (struct sockaddr_in *) saddr; strncpy( strptr, inet_ntoa( sa4->sin_addr ), len - 1 ); strptr[ len - 1 ] = '\0'; return; #ifdef ENABLE_IPV6 case AF_INET6: sa6 = (struct sockaddr_in6 *) saddr; inet_ntop( sa6->sin6_family, &(sa6->sin6_addr), strptr, len ); return; #endif default: fprintf( stderr, "sockaddrtop unknown address type\n" ); strptr[0] = '\0'; return; } } /* Address comparison. */ int addrcmp( char * a, char * b, int af ) { int rc = -1; switch ( af ) { case AF_INET: rc = memcmp( a, b, sizeof (struct in_addr) ); break; #ifdef ENABLE_IPV6 case AF_INET6: rc = memcmp( a, b, sizeof (struct in6_addr) ); break; #endif } return rc; } /* Address copy. */ void addrcpy( char * a, char * b, int af ) { switch ( af ) { case AF_INET: memcpy( a, b, sizeof (struct in_addr) ); break; #ifdef ENABLE_IPV6 case AF_INET6: memcpy( a, b, sizeof (struct in6_addr) ); break; #endif } } /* Decode MPLS */ void decodempls(int num, char *packet, struct mplslen *mpls, int offset) { int i; unsigned int ext_ver, ext_res, ext_chk, obj_hdr_len; u_char obj_hdr_class, obj_hdr_type; /* loosely derived from the traceroute-nanog.c * decoding by Jorge Boncompte */ ext_ver = packet[offset]>>4; ext_res = (packet[offset]&15)+ packet[offset+1]; ext_chk = ((unsigned int)packet[offset+2]<<8)+packet[offset+3]; /* Check for ICMP extension header */ if (ext_ver == 2 && ext_res == 0 && ext_chk != 0 && num >= (offset+6)) { obj_hdr_len = ((int)packet[offset+4]<<8)+packet[offset+5]; obj_hdr_class = packet[offset+6]; obj_hdr_type = packet[offset+7]; /* make sure we have an MPLS extension */ if (obj_hdr_len >= 8 && obj_hdr_class == 1 && obj_hdr_type == 1) { /* how many labels do we have? will be at least 1 */ mpls->labels = (obj_hdr_len-4)/4; /* save all label objects */ for(i=0; (ilabels) && (i < MAXLABELS) && (num >= (offset+8)+(i*4)); i++) { /* piece together the 20 byte label value */ mpls->label[i] = ((unsigned long) (packet[(offset+8)+(i*4)] << 12 & 0xff000) + (unsigned int) (packet[(offset+9)+(i*4)] << 4 & 0xff0) + (packet[(offset+10)+(i*4)] >> 4 & 0xf)); mpls->exp[i] = (packet[(offset+10)+(i*4)] >> 1) & 0x7; mpls->s[i] = (packet[(offset+10)+(i*4)] & 0x1); /* should be 1 if only one label */ mpls->ttl[i] = packet[(offset+11)+(i*4)]; } } } } /* Add open sockets to select() */ void net_add_fds(fd_set *writefd, int *maxfd) { int at, fd; for (at = 0; at < MaxSequence; at++) { fd = sequence[at].socket; if (fd > 0) { FD_SET(fd, writefd); if (fd >= *maxfd) *maxfd = fd + 1; } } } /* check if we got connection or error on any fds */ void net_process_fds(fd_set *writefd) { int at, fd, r; struct timeval now; uint64_t unow, utime; /* Can't do MPLS decoding */ struct mplslen mpls; mpls.labels = 0; gettimeofday(&now, NULL); unow = now.tv_sec * 1000000L + now.tv_usec; for (at = 0; at < MaxSequence; at++) { fd = sequence[at].socket; if (fd > 0 && FD_ISSET(fd, writefd)) { r = write(fd, "G", 1); /* if write was successful, or connection refused we have * (probably) reached the remote address. Anything else happens to the * connection, we write it off to avoid leaking sockets */ if (r == 1 || errno == ECONNREFUSED) net_process_ping(at, mpls, remoteaddress, now); else if (errno != EAGAIN) { close(fd); sequence[at].socket = 0; } } if (fd > 0) { utime = sequence[at].time.tv_sec * 1000000L + sequence[at].time.tv_usec; if (unow - utime > timeout) { close(fd); sequence[at].socket = 0; } } } } /* for GTK frontend */ void net_harvest_fds(void) { fd_set writefd; int maxfd = 0; struct timeval tv; FD_ZERO(&writefd); tv.tv_sec = 0; tv.tv_usec = 0; net_add_fds(&writefd, &maxfd); select(maxfd, NULL, &writefd, NULL, &tv); net_process_fds(&writefd); }mtr-0.85/mtr.c0000664000175000017500000004332012144202516012233 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ #include #include #include #include #include #include #include #include #include #include #include #include #include #include #include #include #include #include "mtr.h" #include "mtr-curses.h" #include "getopt.h" #include "display.h" #include "dns.h" #include "report.h" #include "net.h" #ifndef NO_IPINFO #include "asn.h" #endif #include "version.h" #ifdef ENABLE_IPV6 #define DEFAULT_AF AF_UNSPEC #else #define DEFAULT_AF AF_INET #endif #ifdef NO_HERROR #define herror(str) fprintf(stderr, str ": error looking up \"%s\"\n", Hostname); #endif int DisplayMode; int display_mode; int Interactive = 1; int PrintVersion = 0; int PrintHelp = 0; int MaxPing = 10; int ForceMaxPing = 0; float WaitTime = 1.0; char *Hostname = NULL; char *InterfaceAddress = NULL; char LocalHostname[128]; int dns = 1; int show_ips = 0; int enablempls = 0; int cpacketsize = 64; /* default packet size */ int bitpattern = 0; int tos = 0; int reportwide = 0; int af = DEFAULT_AF; int mtrtype = IPPROTO_ICMP; /* Use ICMP as default packet type */ /* begin ttl windows addByMin */ int fstTTL = 1; /* default start at first hop */ /*int maxTTL = MaxHost-1; */ /* max you can go is 255 hops */ int maxTTL = 30; /* inline with traceroute */ /* end ttl window stuff. */ int remoteport = 80; /* for TCP tracing */ int timeout = 10 * 1000000; /* for TCP tracing */ /* default display field(defined by key in net.h) and order */ unsigned char fld_active[2*MAXFLD] = "LS NABWV"; int fld_index[256]; char available_options[MAXFLD]; struct fields data_fields[MAXFLD] = { /* key, Remark, Header, Format, Width, CallBackFunc */ {' ', ": Space between fields", " ", " ", 1, &net_drop }, {'L', "L: Loss Ratio", "Loss%", " %4.1f%%", 6, &net_loss }, {'D', "D: Dropped Packets", "Drop", " %4d", 5, &net_drop }, {'R', "R: Received Packets", "Rcv", " %5d", 6, &net_returned}, {'S', "S: Sent Packets", "Snt", " %5d", 6, &net_xmit }, {'N', "N: Newest RTT(ms)", "Last", " %5.1f", 6, &net_last }, {'B', "B: Min/Best RTT(ms)", "Best", " %5.1f", 6, &net_best }, {'A', "A: Average RTT(ms)", "Avg", " %5.1f", 6, &net_avg }, {'W', "W: Max/Worst RTT(ms)", "Wrst", " %5.1f", 6, &net_worst }, {'V', "V: Standard Deviation", "StDev", " %5.1f", 6, &net_stdev }, {'G', "G: Geometric Mean", "Gmean", " %5.1f", 6, &net_gmean }, {'J', "J: Current Jitter", "Jttr", " %4.1f", 5, &net_jitter}, {'M', "M: Jitter Mean/Avg.", "Javg", " %4.1f", 5, &net_javg }, {'X', "X: Worst Jitter", "Jmax", " %4.1f", 5, &net_jworst}, {'I', "I: Interarrival Jitter", "Jint", " %4.1f", 5, &net_jinta }, {'\0', NULL, NULL, NULL, 0, NULL} }; typedef struct names { char* name; struct names* next; } names_t; static names_t *names = NULL; char * trim(char * s) { char * p = s; int l = strlen(p); while(isspace(p[l-1]) && l) p[--l] = 0; while(*p && isspace(*p) && l) ++p, --l; return p; } static void append_to_names(const char* progname, const char* item) { names_t* name = calloc(1, sizeof(names_t)); if (name == NULL) { fprintf(stderr, "%s: memory allocation failure\n", progname); exit(EXIT_FAILURE); } name->name = strdup(item); name->next = names; names = name; } static void read_from_file(const char* progname, const char *filename) { FILE *in; char line[512]; if (! filename || strcmp(filename, "-") == 0) { clearerr(stdin); in = stdin; } else { in = fopen(filename, "r"); if (! in) { fprintf(stderr, "%s: fopen: %s\n", progname, strerror(errno)); exit(EXIT_FAILURE); } } while (fgets(line, sizeof(line), in)) { char* name = trim(line); append_to_names(progname, name); } if (ferror(in)) { fprintf(stderr, "%s: ferror: %s\n", progname, strerror(errno)); exit(EXIT_FAILURE); } if (in != stdin) fclose(in); } /* * If the file stream is associated with a regular file, lock the file * in order coordinate writes to a common file from multiple mtr * instances. This is useful if, for example, multiple mtr instances * try to append results to a common file. */ static void lock(const char* progname, FILE *f) { int fd; struct stat buf; static struct flock lock; assert(f); lock.l_type = F_WRLCK; lock.l_start = 0; lock.l_whence = SEEK_END; lock.l_len = 0; lock.l_pid = getpid(); fd = fileno(f); if ((fstat(fd, &buf) == 0) && S_ISREG(buf.st_mode)) { if (fcntl(fd, F_SETLKW, &lock) == -1) { fprintf(stderr, "%s: fcntl: %s (ignored)\n", progname, strerror(errno)); } } } /* * If the file stream is associated with a regular file, unlock the * file (which presumably has previously been locked). */ static void unlock(const char* progname, FILE *f) { int fd; struct stat buf; static struct flock lock; assert(f); lock.l_type = F_UNLCK; lock.l_start = 0; lock.l_whence = SEEK_END; lock.l_len = 0; lock.l_pid = getpid(); fd = fileno(f); if ((fstat(fd, &buf) == 0) && S_ISREG(buf.st_mode)) { if (fcntl(fd, F_SETLKW, &lock) == -1) { fprintf(stderr, "%s: fcntl: %s (ignored)\n", progname, strerror(errno)); } } } void init_fld_options (void) { int i; for (i=0;i < 256;i++) fld_index[i] = -1; for (i=0;data_fields[i].key != 0;i++) { available_options[i] = data_fields[i].key; fld_index[data_fields[i].key] = i; } available_options[i] = 0; } void parse_arg (int argc, char **argv) { int opt; int i; static struct option long_options[] = { { "version", 0, 0, 'v' }, { "help", 0, 0, 'h' }, { "report", 0, 0, 'r' }, { "report-wide", 0, 0, 'w' }, { "xml", 0, 0, 'x' }, { "curses", 0, 0, 't' }, { "gtk", 0, 0, 'g' }, { "raw", 0, 0, 'l' }, { "csv", 0, 0, 'C' }, { "split", 0, 0, 'p' }, /* BL */ /* maybe above should change to -d 'x' */ { "order", 1, 0, 'o' }, /* fileds to display & their order */ { "interval", 1, 0, 'i' }, { "report-cycles", 1, 0, 'c' }, { "psize", 1, 0, 's' }, /* changed 'p' to 's' to match ping option overload psize<0, ->rand(min,max) */ { "bitpattern", 1, 0, 'B' },/* overload b>255, ->rand(0,255) */ { "tos", 1, 0, 'Q' }, /* typeof service (0,255) */ { "mpls", 0, 0, 'e' }, { "no-dns", 0, 0, 'n' }, { "show-ips", 0, 0, 'b' }, { "address", 1, 0, 'a' }, { "first-ttl", 1, 0, 'f' }, /* -f & -m are borrowed from traceroute */ { "filename", 1, 0, 'F' }, { "max-ttl", 1, 0, 'm' }, { "udp", 0, 0, 'u' }, /* UDP (default is ICMP) */ { "tcp", 0, 0, 'T' }, /* TCP (default is ICMP) */ { "port", 1, 0, 'P' }, /* target port number for TCP */ { "timeout", 1, 0, 'Z' }, /* timeout for TCP sockets */ { "inet", 0, 0, '4' }, /* IPv4 only */ { "inet6", 0, 0, '6' }, /* IPv6 only */ #ifndef NO_IPINFO { "ipinfo", 1, 0, 'y' }, /* IP info lookup */ { "aslookup", 0, 0, 'z' }, /* Do AS lookup (--ipinfo 0) */ #endif { 0, 0, 0, 0 } }; opt = 0; while(1) { /* added f:m:o: byMin */ opt = getopt_long(argc, argv, "vhrwxtglCpo:B:i:c:s:Q:ena:f:m:uTP:Zby:z46", long_options, NULL); if(opt == -1) break; switch(opt) { case 'v': PrintVersion = 1; break; case 'h': PrintHelp = 1; break; case 'r': DisplayMode = DisplayReport; break; case 'w': reportwide = 1; DisplayMode = DisplayReport; break; case 't': DisplayMode = DisplayCurses; break; case 'g': DisplayMode = DisplayGTK; break; case 'p': /* BL */ DisplayMode = DisplaySplit; break; case 'l': DisplayMode = DisplayRaw; break; case 'C': DisplayMode = DisplayCSV; break; case 'x': DisplayMode = DisplayXML; break; case 'c': MaxPing = atoi (optarg); ForceMaxPing = 1; break; case 's': cpacketsize = atoi (optarg); break; case 'a': InterfaceAddress = optarg; break; case 'e': enablempls = 1; break; case 'n': dns = 0; break; case 'i': WaitTime = atof (optarg); if (WaitTime <= 0.0) { fprintf (stderr, "mtr: wait time must be positive\n"); exit (1); } if (getuid() != 0 && WaitTime < 1.0) { fprintf (stderr, "non-root users cannot request an interval < 1.0 seconds\r\n"); exit (1); } break; case 'f': fstTTL = atoi (optarg); if (fstTTL > maxTTL) { fstTTL = maxTTL; } if (fstTTL < 1) { /* prevent 0 hop */ fstTTL = 1; } break; case 'F': read_from_file(argv[0], optarg); break; case 'm': maxTTL = atoi (optarg); if (maxTTL > (MaxHost - 1)) { maxTTL = MaxHost-1; } if (maxTTL < 1) { /* prevent 0 hop */ maxTTL = 1; } if (fstTTL > maxTTL) { /* don't know the pos of -m or -f */ fstTTL = maxTTL; } break; case 'o': /* Check option before passing it on to fld_active. */ if (strlen (optarg) > MAXFLD) { fprintf (stderr, "Too many fields: %s\n", optarg); exit (1); } for (i=0; optarg[i]; i++) { if(!strchr (available_options, optarg[i])) { fprintf (stderr, "Unknown field identifier: %c\n", optarg[i]); exit (1); } } strcpy ((char*)fld_active, optarg); break; case 'B': bitpattern = atoi (optarg); if (bitpattern > 255) bitpattern = -1; break; case 'Q': tos = atoi (optarg); if (tos > 255 || tos < 0) { /* error message, should do more checking for valid values, * details in rfc2474 */ tos = 0; } break; case 'u': if (mtrtype != IPPROTO_ICMP) { fprintf(stderr, "-u and -T are mutually exclusive.\n"); exit(EXIT_FAILURE); } mtrtype = IPPROTO_UDP; break; case 'T': if (mtrtype != IPPROTO_ICMP) { fprintf(stderr, "-u and -T are mutually exclusive.\n"); exit(EXIT_FAILURE); } mtrtype = IPPROTO_TCP; break; case 'b': show_ips = 1; break; case 'P': remoteport = atoi(optarg); if (remoteport > 65535 || remoteport < 1) { fprintf(stderr, "Illegal port number.\n"); exit(EXIT_FAILURE); } break; case 'Z': timeout = atoi(optarg); timeout *= 1000000; break; case '4': af = AF_INET; break; case '6': #ifdef ENABLE_IPV6 af = AF_INET6; break; #else fprintf( stderr, "IPv6 not enabled.\n" ); break; #endif #ifndef NO_IPINFO case 'y': ipinfo_no = atoi (optarg); if (ipinfo_no < 0) ipinfo_no = 0; break; case 'z': ipinfo_no = 0; break; #endif } } if (DisplayMode == DisplayReport || DisplayMode == DisplayTXT || DisplayMode == DisplayXML || DisplayMode == DisplayRaw || DisplayMode == DisplayCSV) Interactive = 0; if (optind > argc - 1) return; } void parse_mtr_options (char *string) { int argc; char *argv[128], *p; if (!string) return; argv[0] = "mtr"; argc = 1; p = strtok (string, " \t"); while (p != NULL && ((size_t) argc < (sizeof(argv)/sizeof(argv[0])))) { argv[argc++] = p; p = strtok (NULL, " \t"); } if (p != NULL) { fprintf (stderr, "Warning: extra arguments ignored: %s", p); } parse_arg (argc, argv); optind = 0; } int main(int argc, char **argv) { struct hostent * host = NULL; int net_preopen_result; #ifdef ENABLE_IPV6 struct addrinfo hints, *res; int error; struct hostent trhost; char * alptr[2]; struct sockaddr_in * sa4; struct sockaddr_in6 * sa6; #endif /* Get the raw sockets first thing, so we can drop to user euid immediately */ if ( ( net_preopen_result = net_preopen () ) ) { fprintf( stderr, "mtr: unable to get raw sockets.\n" ); exit( EXIT_FAILURE ); } /* Now drop to user permissions */ if (setgid(getgid()) || setuid(getuid())) { fprintf (stderr, "mtr: Unable to drop permissions.\n"); exit(1); } /* Double check, just in case */ if ((geteuid() != getuid()) || (getegid() != getgid())) { fprintf (stderr, "mtr: Unable to drop permissions.\n"); exit(1); } /* reset the random seed */ srand (getpid()); display_detect(&argc, &argv); /* The field options are now in a static array all together, but that requires a run-time initialization. */ init_fld_options (); parse_mtr_options (getenv ("MTR_OPTIONS")); parse_arg (argc, argv); while (optind < argc) { char* name = argv[optind++]; append_to_names(argv[0], name); } /* Now that we know mtrtype we can select which socket to use */ if (net_selectsocket() != 0) { fprintf( stderr, "mtr: Couldn't determine raw socket type.\n" ); exit( EXIT_FAILURE ); } if (PrintVersion) { printf ("mtr " MTR_VERSION "\n"); exit(0); } if (PrintHelp) { printf("usage: %s [-hvrwctglspniuT46] [--help] [--version] [--report]\n" "\t\t[--report-wide] [--report-cycles=COUNT] [--curses] [--gtk]\n" "\t\t[--csv|-C] [--raw] [--split] [--mpls] [--no-dns] [--show-ips]\n" "\t\t[--address interface] [--filename=FILE|-F]\n" /* BL */ #ifndef NO_IPINFO "\t\t[--ipinfo=item_no|-y item_no]\n" "\t\t[--aslookup|-z]\n" #endif "\t\t[--psize=bytes/-s bytes]\n" /* ok */ "\t\t[--report-wide|-w] [-u|-T] [--port=PORT] [--timeout=SECONDS]\n" /* rew */ "\t\t[--interval=SECONDS] HOSTNAME\n", argv[0]); exit(0); } time_t now = time(NULL); names_t* head = names; while (names != NULL) { Hostname = names->name; if (Hostname == NULL) Hostname = "localhost"; if (gethostname(LocalHostname, sizeof(LocalHostname))) { strcpy(LocalHostname, "UNKNOWNHOST"); } if (net_preopen_result != 0) { fprintf(stderr, "mtr: Unable to get raw socket. (Executable not suid?)\n"); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } #ifdef ENABLE_IPV6 /* gethostbyname2() is deprecated so we'll use getaddrinfo() instead. */ bzero( &hints, sizeof hints ); hints.ai_family = af; hints.ai_socktype = SOCK_DGRAM; error = getaddrinfo( Hostname, NULL, &hints, &res ); if ( error ) { if (error == EAI_SYSTEM) perror ("Failed to resolve host"); else fprintf (stderr, "Failed to resolve host: %s\n", gai_strerror(error)); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } /* Convert the first addrinfo into a hostent. */ host = &trhost; bzero( host, sizeof trhost ); host->h_name = res->ai_canonname; host->h_aliases = NULL; host->h_addrtype = res->ai_family; af = res->ai_family; host->h_length = res->ai_addrlen; host->h_addr_list = alptr; switch ( af ) { case AF_INET: sa4 = (struct sockaddr_in *) res->ai_addr; alptr[0] = (void *) &(sa4->sin_addr); break; case AF_INET6: sa6 = (struct sockaddr_in6 *) res->ai_addr; alptr[0] = (void *) &(sa6->sin6_addr); break; default: fprintf( stderr, "mtr unknown address type\n" ); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } alptr[1] = NULL; #else host = gethostbyname(Hostname); if (host == NULL) { herror("mtr gethostbyname"); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } af = host->h_addrtype; #endif if (net_open(host) != 0) { fprintf(stderr, "mtr: Unable to start net module.\n"); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } if (net_set_interfaceaddress (InterfaceAddress) != 0) { fprintf( stderr, "mtr: Couldn't set interface address.\n" ); if ( DisplayMode != DisplayCSV ) exit(EXIT_FAILURE); else { names = names->next; continue; } } lock(argv[0], stdout); display_open(); dns_open(); display_mode = 0; display_loop(); net_end_transit(); display_close(now); unlock(argv[0], stdout); if ( DisplayMode != DisplayCSV ) break; else names = names->next; } net_close(); while (head != NULL) { names_t* item = head; free(item->name); item->name = NULL; head = head->next; free(item); item = NULL; } head=NULL; return 0; } mtr-0.85/asn.h0000664000175000017500000000163612135723235012231 0ustar wolffwolff/* mtr -- a network diagnostic tool Copyright (C) 1997,1998 Matt Kimball This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License version 2 as published by the Free Software Foundation. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. */ extern int ipinfo_no; extern int ipinfo_max; extern int iiwidth_len; extern int iihash; void asn_open(); void asn_close(); char *fmt_ipinfo(ip_t *addr); int get_iiwidth(void); int is_printii(void); mtr-0.85/TODO0000664000175000017500000001115412104140215011746 0ustar wolffwolff Hi everyone, This is the "todo" file for mtr. I just realized that some people might think that this is all in MY queue to implement. That is not true: This is the "for everybody" todo list. Feel free to pick a "project" and implement something off this list. Students: Feel free to take up one of these as a programming exercise for one of your courses. Everybody: If you want to start on something, contact me first, so that the effort isn't wasted by someone who finishes just a tad earlier. I'll happily provide "coaching" to anyone who wants to implement something on this list. That way we get the design of these things the way I like them. This should result in a better maintainable mtr. Oh, Feel free to provide suggestions for this list. -- REW ---------------------------------------------------------------------- - Stuff to implement: - Allow mtr to log the return packets, for later analysis. Done: 0.25 . Todo: allow the user interface(s) to work while still logging to a file. Write a "logfile displaying" mode to mtr. - Request timestamping at the remote site. Andreas Fasbender has an algorithm that will allow us to convert these measurements into one-way measurements, not just round-trip. - allow "keyboard navigation" in the GTK version. - Keep all packets and make the "best" and "worst" columns show the xx-th percentile.... - Can the reports generated also include any secondary servers? In the interactive mode, any new servers that are found in the traceroute are added to the list, but it seems to only include one set of servers when using the -r option. - Being able to expand the "column width" of the hosts listed would be nice, too. - Bugs to fix? - Do something useful if host couldn't be resolved. -- Done. - Revert to curses mode even if DISPLAY is set, but a problem prevents us from running in X11 mode. --> The problem is that gtk_init simply calls exit for us if it finds a problem. Tricky! Suggestions welcome. --> Call "gtk_check_init" when available. (i.e. new enough (1.2?) GTK version). - Nice to have: - stop sending packets when a new host is getting entered. - Show state ("looking up host") while doing the DNS lookup for a new host. - to have a choice of icmp, tcp, and udp pings. -- Matt Martini - Autoconf 2.13 has a neat function that can be used to find the res_init function: AC_SEARCH_LIBS(res_init, bind resolv, , AC_MSG_ERROR(No resolver library found)) At the moment (march 1999) autoconf 2.13 is still too new to require everyone to upgrade. About a year from now we can put this in.... - Implement rfc2317 mechanism to do reverse lookups for networks that have DNS delegations on non-octet boundaries. -- Daniel Bergstrom (noa@melody.se) - The longer MTR runs, the less meaningful the packet loss statistic. Or more meaningful, depending on your point of view. Perhaps MTR should use a circular buffer of some configurable number of results, and calculate the loss against that. -- Jacob Elder - It would be nice if the window size wasn't fixed. If I'm only 5 hops from the host I'm monitoring, MTR wastes a lot of screen real estate. -- Jacob Elder - Colors in the curses version. -- Amix - If we run a mtr to monitor a connection it would be nice if the time at which mtr was started is print somewhere. -- Sebastian Ganschow ------------------------------------------------------------------------ Things that shouldn't be on the TODO list because they're done. ;-) - Allow a toggle between hostname/IP number display. (for example a click on the hostname could revert to ip number display in gtk version. curses: "n" key toggles hostnames/ipnumbers?) - Allow mtr to also send larger packets. This will enable us to get a feel for the speed of the links we're traversing. (Van Jacobson was working on this His tool was slow, mtr will rock with this feature.... :-) (Anybody have the statistics experience to tell me how to do the data analysis?) -- DONE. Thanks to Olav Kvittem ... - The "don't probe all hosts at once" strategy can be improved a bit. It should not probe more than 10 unknown hosts, but the counter need not be reset at the start of the "round". This way if you probe slowly (relative to the RTT time to the end host), it can probe all hosts in the first "round". -- DONE. - Read environment variable "MTR_DEFAULTS" as a commandline before parsing the commandline. -- DONE. (ok it's MTR_OPTIONS.) mtr-0.85/config.status0000775000175000017500000010434612162522230014006 0ustar wolffwolff#! /bin/bash # Generated by configure. # Run this file to recreate the current configuration. # Compiler output produced by configure, useful for debugging # configure, is in config.log if it exists. debug=false ac_cs_recheck=false ac_cs_silent=false SHELL=${CONFIG_SHELL-/bin/bash} export SHELL ## -------------------- ## ## M4sh Initialization. ## ## -------------------- ## # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST else case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( *) : ;; esac fi as_nl=' ' export as_nl # Printing a long string crashes Solaris 7 /usr/bin/printf. as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo # Prefer a ksh shell builtin over an external printf program on Solaris, # but without wasting forks for bash or zsh. if test -z "$BASH_VERSION$ZSH_VERSION" \ && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='print -r --' as_echo_n='print -rn --' elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then as_echo='printf %s\n' as_echo_n='printf %s' else if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' as_echo_n='/usr/ucb/echo -n' else as_echo_body='eval expr "X$1" : "X\\(.*\\)"' as_echo_n_body='eval arg=$1; case $arg in #( *"$as_nl"*) expr "X$arg" : "X\\(.*\\)$as_nl"; arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; esac; expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" ' export as_echo_n_body as_echo_n='sh -c $as_echo_n_body as_echo' fi export as_echo_body as_echo='sh -c $as_echo_body as_echo' fi # The user is always right. if test "${PATH_SEPARATOR+set}" != set; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || PATH_SEPARATOR=';' } fi # IFS # We need space, tab and new line, in precisely that order. Quoting is # there to prevent editors from complaining about space-tab. # (If _AS_PATH_WALK were called with IFS unset, it would disable word # splitting by setting IFS to empty value.) IFS=" "" $as_nl" # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( *[\\/]* ) as_myself=$0 ;; *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS test -z "$as_dir" && as_dir=. test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break done IFS=$as_save_IFS ;; esac # We did not find ourselves, most probably we were run as `sh COMMAND' # in which case we are not to be found in the path. if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi # Unset variables that we do not need and which cause bugs (e.g. in # pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" # suppresses any "Segmentation fault" message there. '((' could # trigger a bug in pdksh 5.2.14. for as_var in BASH_ENV ENV MAIL MAILPATH do eval test x\${$as_var+set} = xset \ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : done PS1='$ ' PS2='> ' PS4='+ ' # NLS nuisances. LC_ALL=C export LC_ALL LANGUAGE=C export LANGUAGE # CDPATH. (unset CDPATH) >/dev/null 2>&1 && unset CDPATH # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- # Output "`basename $0`: error: ERROR" to stderr. If LINENO and LOG_FD are # provided, also output the error to LOG_FD, referencing LINENO. Then exit the # script with STATUS, using 1 if that was 0. as_fn_error () { as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi $as_echo "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. as_fn_set_status () { return $1 } # as_fn_set_status # as_fn_exit STATUS # ----------------- # Exit the shell with STATUS, even in a "trap 0" or "set -e" context. as_fn_exit () { set +e as_fn_set_status $1 exit $1 } # as_fn_exit # as_fn_unset VAR # --------------- # Portably unset VAR. as_fn_unset () { { eval $1=; unset $1;} } as_unset=as_fn_unset # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : eval 'as_fn_append () { eval $1+=\$2 }' else as_fn_append () { eval $1=\$$1\$2 } fi # as_fn_append # as_fn_arith ARG... # ------------------ # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : eval 'as_fn_arith () { as_val=$(( $* )) }' else as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith if expr a : '\(a\)' >/dev/null 2>&1 && test "X`expr 00001 : '.*\(...\)'`" = X001; then as_expr=expr else as_expr=false fi if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then as_basename=basename else as_basename=false fi if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then as_dirname=dirname else as_dirname=false fi as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || $as_echo X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q } /^X\/\(\/\/\)$/{ s//\1/ q } /^X\/\(\/\).*/{ s//\1/ q } s/.*/./; q'` # Avoid depending upon Character Ranges. as_cr_letters='abcdefghijklmnopqrstuvwxyz' as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) case `echo 'xy\c'` in *c*) ECHO_T=' ';; # ECHO_T is single tab character. xy) ECHO_C='\c';; *) echo `echo ksh88 bug on AIX 6.1` > /dev/null ECHO_T=' ';; esac;; *) ECHO_N='-n';; esac rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file else rm -f conf$$.dir mkdir conf$$.dir 2>/dev/null fi if (echo >conf$$.file) 2>/dev/null; then if ln -s conf$$.file conf$$ 2>/dev/null; then as_ln_s='ln -s' # ... but there are two gotchas: # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. # In both cases, we have to default to `cp -p'. ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || as_ln_s='cp -p' elif ln conf$$.file conf$$ 2>/dev/null; then as_ln_s=ln else as_ln_s='cp -p' fi else as_ln_s='cp -p' fi rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file rmdir conf$$.dir 2>/dev/null # as_fn_mkdir_p # ------------- # Create "$as_dir" as a directory, including parents if necessary. as_fn_mkdir_p () { case $as_dir in #( -*) as_dir=./$as_dir;; esac test -d "$as_dir" || eval $as_mkdir_p || { as_dirs= while :; do case $as_dir in #( *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" as_dir=`$as_dirname -- "$as_dir" || $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` test -d "$as_dir" && break done test -z "$as_dirs" || eval "mkdir $as_dirs" } || test -d "$as_dir" || as_fn_error $? "cannot create directory $as_dir" } # as_fn_mkdir_p if mkdir -p . 2>/dev/null; then as_mkdir_p='mkdir -p "$as_dir"' else test -d ./-p && rmdir ./-p as_mkdir_p=false fi if test -x / >/dev/null 2>&1; then as_test_x='test -x' else if ls -dL / >/dev/null 2>&1; then as_ls_L_option=L else as_ls_L_option= fi as_test_x=' eval sh -c '\'' if test -d "$1"; then test -d "$1/."; else case $1 in #( -*)set "./$1";; esac; case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in #(( ???[sx]*):;;*)false;;esac;fi '\'' sh ' fi as_executable_p=$as_test_x # Sed expression to map a string onto a valid CPP name. as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" # Sed expression to map a string onto a valid variable name. as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" exec 6>&1 ## ----------------------------------- ## ## Main body of $CONFIG_STATUS script. ## ## ----------------------------------- ## # Save the log message, to keep $0 and so on meaningful, and to # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" This file was extended by mtr $as_me 0.85, which was generated by GNU Autoconf 2.68. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS CONFIG_LINKS = $CONFIG_LINKS CONFIG_COMMANDS = $CONFIG_COMMANDS $ $0 $@ on `(hostname || uname -n) 2>/dev/null | sed 1q` " # Files that config.status was made for. config_files=" version.h.tmp:version.h.in Makefile img/Makefile" config_headers=" config.h" config_commands=" depfiles" ac_cs_usage="\ \`$as_me' instantiates files and other configuration actions from templates according to the current configuration. Unless the files and actions are specified as TAGs, all are instantiated by default. Usage: $0 [OPTION]... [TAG]... -h, --help print this help, then exit -V, --version print version number and configuration settings, then exit --config print configuration, then exit -q, --quiet, --silent do not print progress messages -d, --debug don't remove temporary files --recheck update $as_me by reconfiguring in the same conditions --file=FILE[:TEMPLATE] instantiate the configuration file FILE --header=FILE[:TEMPLATE] instantiate the configuration header FILE Configuration files: $config_files Configuration headers: $config_headers Configuration commands: $config_commands Report bugs to the package provider." ac_cs_config="" ac_cs_version="\ mtr config.status 0.85 configured by ./configure, generated by GNU Autoconf 2.68, with options \"$ac_cs_config\" Copyright (C) 2010 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." ac_pwd='/home/wolff/mtr' srcdir='.' INSTALL='/usr/bin/install -c' MKDIR_P='/bin/mkdir -p' AWK='gawk' test -n "$AWK" || AWK=awk # The default lists apply if the user does not specify any file. ac_need_defaults=: while test $# != 0 do case $1 in --*=?*) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` ac_shift=: ;; --*=) ac_option=`expr "X$1" : 'X\([^=]*\)='` ac_optarg= ac_shift=: ;; *) ac_option=$1 ac_optarg=$2 ac_shift=shift ;; esac case $ac_option in # Handling of the options. -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) $as_echo "$ac_cs_version"; exit ;; --config | --confi | --conf | --con | --co | --c ) $as_echo "$ac_cs_config"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; '') as_fn_error $? "missing file argument" ;; esac as_fn_append CONFIG_FILES " '$ac_optarg'" ac_need_defaults=false;; --header | --heade | --head | --hea ) $ac_shift case $ac_optarg in *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; esac as_fn_append CONFIG_HEADERS " '$ac_optarg'" ac_need_defaults=false;; --he | --h) # Conflict between --help and --header as_fn_error $? "ambiguous option: \`$1' Try \`$0 --help' for more information.";; --help | --hel | -h ) $as_echo "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; # This is an error. -*) as_fn_error $? "unrecognized option: \`$1' Try \`$0 --help' for more information." ;; *) as_fn_append ac_config_targets " $1" ac_need_defaults=false ;; esac shift done ac_configure_extra_args= if $ac_cs_silent; then exec 6>/dev/null ac_configure_extra_args="$ac_configure_extra_args --silent" fi if $ac_cs_recheck; then set X '/bin/bash' './configure' $ac_configure_extra_args --no-create --no-recursion shift $as_echo "running CONFIG_SHELL=/bin/bash $*" >&6 CONFIG_SHELL='/bin/bash' export CONFIG_SHELL exec "$@" fi exec 5>>config.log { echo sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX $as_echo "$ac_log" } >&5 # # INIT-COMMANDS # AMDEP_TRUE="" ac_aux_dir="." # Handling of arguments. for ac_config_target in $ac_config_targets do case $ac_config_target in "version.h.tmp") CONFIG_FILES="$CONFIG_FILES version.h.tmp:version.h.in" ;; "depfiles") CONFIG_COMMANDS="$CONFIG_COMMANDS depfiles" ;; "config.h") CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;; "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; "img/Makefile") CONFIG_FILES="$CONFIG_FILES img/Makefile" ;; *) as_fn_error $? "invalid argument: \`$ac_config_target'" "$LINENO" 5;; esac done # If the user did not use the arguments to specify the items to instantiate, # then the envvar interface is used. Set only those that are not. # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers test "${CONFIG_COMMANDS+set}" = set || CONFIG_COMMANDS=$config_commands fi # Have a temporary directory for convenience. Make it in the build tree # simply because there is no reason against having it here, and in addition, # creating and moving files from /tmp can sometimes cause problems. # Hook for its removal unless debugging. # Note that there is a small window in which the directory will not be cleaned: # after its creation but before its name has been assigned to `$tmp'. $debug || { tmp= ac_tmp= trap 'exit_status=$? : "${ac_tmp:=$tmp}" { test ! -d "$ac_tmp" || rm -fr "$ac_tmp"; } && exit $exit_status ' 0 trap 'as_fn_exit 1' 1 2 13 15 } # Create a (secure) tmp directory for tmp files. { tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && test -d "$tmp" } || { tmp=./conf$$-$RANDOM (umask 077 && mkdir "$tmp") } || as_fn_error $? "cannot create a temporary directory in ." "$LINENO" 5 ac_tmp=$tmp # Set up the scripts for CONFIG_FILES section. # No need to generate them if there are no CONFIG_FILES. # This happens for instance with `./config.status config.h'. if test -n "$CONFIG_FILES"; then ac_cr=`echo X | tr X '\015'` # On cygwin, bash can eat \r inside `` if the user requested igncr. # But we know of no other shell where ac_cr would be empty at this # point, so we can use a bashism as a fallback. if test "x$ac_cr" = x; then eval ac_cr=\$\'\\r\' fi ac_cs_awk_cr=`$AWK 'BEGIN { print "a\rb" }' /dev/null` if test "$ac_cs_awk_cr" = "a${ac_cr}b"; then ac_cs_awk_cr='\\r' else ac_cs_awk_cr=$ac_cr fi echo 'BEGIN {' >"$ac_tmp/subs1.awk" && cat >>"$ac_tmp/subs1.awk" <<\_ACAWK && S["am__EXEEXT_FALSE"]="" S["am__EXEEXT_TRUE"]="#" S["LTLIBOBJS"]="" S["LIBOBJS"]="" S["RESOLV_LIBS"]="-lresolv" S["GLIB_LIBS"]="" S["GLIB_CFLAGS"]="" S["PKG_CONFIG_LIBDIR"]="" S["PKG_CONFIG_PATH"]="" S["GTK_LIBS"]="-pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0 -lfreetype -lfontconfi"\ "g -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 " S["GTK_CFLAGS"]="-pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pixbuf-2."\ "0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/pixman-1"\ " -I/usr/include/freetype2 -I/usr/include/libpng12 " S["PKG_CONFIG"]="/usr/bin/pkg-config" S["IPINFO_FALSE"]="#" S["IPINFO_TRUE"]="" S["EGREP"]="/bin/grep -E" S["GREP"]="/bin/grep" S["CPP"]="gcc -E" S["am__fastdepCC_FALSE"]="#" S["am__fastdepCC_TRUE"]="" S["CCDEPMODE"]="depmode=gcc3" S["AMDEPBACKSLASH"]="\\" S["AMDEP_FALSE"]="#" S["AMDEP_TRUE"]="" S["am__quote"]="" S["am__include"]="include" S["DEPDIR"]=".deps" S["OBJEXT"]="o" S["EXEEXT"]="" S["ac_ct_CC"]="gcc" S["CPPFLAGS"]="" S["LDFLAGS"]="" S["CFLAGS"]="-g -O2 -pthread -I/usr/include/gtk-2.0 -I/usr/lib/x86_64-linux-gnu/gtk-2.0/include -I/usr/include/atk-1.0 -I/usr/include/cairo -I/usr/include/gdk-pi"\ "xbuf-2.0 -I/usr/include/pango-1.0 -I/usr/include/gio-unix-2.0/ -I/usr/include/glib-2.0 -I/usr/lib/x86_64-linux-gnu/glib-2.0/include -I/usr/include/p"\ "ixman-1 -I/usr/include/freetype2 -I/usr/include/libpng12 -Wall -Wno-pointer-sign" S["CC"]="gcc" S["CURSES_OBJ"]="curses.o" S["GTK_OBJ"]="gtk.o" S["am__untar"]="${AMTAR} xf -" S["am__tar"]="${AMTAR} chof - \"$$tardir\"" S["AMTAR"]="${SHELL} /home/wolff/mtr/missing --run tar" S["am__leading_dot"]="." S["SET_MAKE"]="" S["AWK"]="gawk" S["mkdir_p"]="/bin/mkdir -p" S["MKDIR_P"]="/bin/mkdir -p" S["INSTALL_STRIP_PROGRAM"]="$(install_sh) -c -s" S["STRIP"]="" S["install_sh"]="${SHELL} /home/wolff/mtr/install-sh" S["MAKEINFO"]="${SHELL} /home/wolff/mtr/missing --run makeinfo" S["AUTOHEADER"]="${SHELL} /home/wolff/mtr/missing --run autoheader" S["AUTOMAKE"]="${SHELL} /home/wolff/mtr/missing --run automake-1.11" S["AUTOCONF"]="${SHELL} /home/wolff/mtr/missing --run autoconf" S["ACLOCAL"]="${SHELL} /home/wolff/mtr/missing --run aclocal-1.11" S["VERSION"]="0.85" S["PACKAGE"]="mtr" S["CYGPATH_W"]="echo" S["am__isrc"]="" S["INSTALL_DATA"]="${INSTALL} -m 644" S["INSTALL_SCRIPT"]="${INSTALL}" S["INSTALL_PROGRAM"]="${INSTALL}" S["target_alias"]="" S["host_alias"]="" S["build_alias"]="" S["LIBS"]="-lm -ltinfo -ltermcap -pthread -lgtk-x11-2.0 -lgdk-x11-2.0 -latk-1.0 -lgio-2.0 -lpangoft2-1.0 -lpangocairo-1.0 -lgdk_pixbuf-2.0 -lcairo -lpango-1.0"\ " -lfreetype -lfontconfig -lgobject-2.0 -lgmodule-2.0 -lgthread-2.0 -lrt -lglib-2.0 -lm" S["ECHO_T"]="" S["ECHO_N"]="-n" S["ECHO_C"]="" S["DEFS"]="-DHAVE_CONFIG_H" S["mandir"]="${datarootdir}/man" S["localedir"]="${datarootdir}/locale" S["libdir"]="${exec_prefix}/lib" S["psdir"]="${docdir}" S["pdfdir"]="${docdir}" S["dvidir"]="${docdir}" S["htmldir"]="${docdir}" S["infodir"]="${datarootdir}/info" S["docdir"]="${datarootdir}/doc/${PACKAGE_TARNAME}" S["oldincludedir"]="/usr/include" S["includedir"]="${prefix}/include" S["localstatedir"]="${prefix}/var" S["sharedstatedir"]="${prefix}/com" S["sysconfdir"]="${prefix}/etc" S["datadir"]="${datarootdir}" S["datarootdir"]="${prefix}/share" S["libexecdir"]="${exec_prefix}/libexec" S["sbindir"]="${exec_prefix}/sbin" S["bindir"]="${exec_prefix}/bin" S["program_transform_name"]="s,x,x," S["prefix"]="/usr/local" S["exec_prefix"]="${prefix}" S["PACKAGE_URL"]="" S["PACKAGE_BUGREPORT"]="" S["PACKAGE_STRING"]="mtr 0.85" S["PACKAGE_VERSION"]="0.85" S["PACKAGE_TARNAME"]="mtr" S["PACKAGE_NAME"]="mtr" S["PATH_SEPARATOR"]=":" S["SHELL"]="/bin/bash" _ACAWK cat >>"$ac_tmp/subs1.awk" <<_ACAWK && for (key in S) S_is_set[key] = 1 FS = "" } { line = $ 0 nfields = split(line, field, "@") substed = 0 len = length(field[1]) for (i = 2; i < nfields; i++) { key = field[i] keylen = length(key) if (S_is_set[key]) { value = S[key] line = substr(line, 1, len) "" value "" substr(line, len + keylen + 3) len += length(value) + length(field[++i]) substed = 1 } else len += 1 + keylen } print line } _ACAWK if sed "s/$ac_cr//" < /dev/null > /dev/null 2>&1; then sed "s/$ac_cr\$//; s/$ac_cr/$ac_cs_awk_cr/g" else cat fi < "$ac_tmp/subs1.awk" > "$ac_tmp/subs.awk" \ || as_fn_error $? "could not setup config files machinery" "$LINENO" 5 fi # test -n "$CONFIG_FILES" # Set up the scripts for CONFIG_HEADERS section. # No need to generate them if there are no CONFIG_HEADERS. # This happens for instance with `./config.status Makefile'. if test -n "$CONFIG_HEADERS"; then cat >"$ac_tmp/defines.awk" <<\_ACAWK || BEGIN { D["PACKAGE_NAME"]=" \"mtr\"" D["PACKAGE_TARNAME"]=" \"mtr\"" D["PACKAGE_VERSION"]=" \"0.85\"" D["PACKAGE_STRING"]=" \"mtr 0.85\"" D["PACKAGE_BUGREPORT"]=" \"\"" D["PACKAGE_URL"]=" \"\"" D["PACKAGE"]=" \"mtr\"" D["VERSION"]=" \"0.85\"" D["STDC_HEADERS"]=" 1" D["HAVE_SYS_TYPES_H"]=" 1" D["HAVE_SYS_STAT_H"]=" 1" D["HAVE_STDLIB_H"]=" 1" D["HAVE_STRING_H"]=" 1" D["HAVE_MEMORY_H"]=" 1" D["HAVE_STRINGS_H"]=" 1" D["HAVE_INTTYPES_H"]=" 1" D["HAVE_STDINT_H"]=" 1" D["HAVE_UNISTD_H"]=" 1" D["SIZEOF_UNSIGNED_CHAR"]=" 1" D["SIZEOF_UNSIGNED_SHORT"]=" 2" D["SIZEOF_UNSIGNED_INT"]=" 4" D["SIZEOF_UNSIGNED_LONG"]=" 8" D["HAVE_NCURSES_H"]=" 1" D["HAVE_CURSES_H"]=" 1" D["HAVE_SYS_TYPES_H"]=" 1" D["HAVE_FCNTL_H"]=" 1" D["HAVE_SYS_SOCKET_H"]=" 1" D["HAVE_ARPA_NAMESER_COMPAT_H"]=" 1" D["HAVE_LIBTERMCAP"]=" 1" D["HAVE_LIBTINFO"]=" 1" D["HAVE_ATTRON"]=" 1" D["HAVE_FCNTL"]=" 1" D["HAVE_LIBM"]=" 1" D["HAVE_SETEUID"]=" 1" D["ENABLE_IPV6"]=" /**/" D["HAVE_DECL_ERRNO"]=" 1" D["HAVE_SOCKLEN_T"]=" /**/" D["HAVE_STRUCT_INADDR"]=" /**/" for (key in D) D_is_set[key] = 1 FS = "" } /^[\t ]*#[\t ]*(define|undef)[\t ]+[_abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ][_abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789]*([\t (]|$)/ { line = $ 0 split(line, arg, " ") if (arg[1] == "#") { defundef = arg[2] mac1 = arg[3] } else { defundef = substr(arg[1], 2) mac1 = arg[2] } split(mac1, mac2, "(") #) macro = mac2[1] prefix = substr(line, 1, index(line, defundef) - 1) if (D_is_set[macro]) { # Preserve the white space surrounding the "#". print prefix "define", macro P[macro] D[macro] next } else { # Replace #undef with comments. This is necessary, for example, # in the case of _POSIX_SOURCE, which is predefined and required # on some systems where configure will not decide to define it. if (defundef == "undef") { print "/*", prefix defundef, macro, "*/" next } } } { print } _ACAWK as_fn_error $? "could not setup config headers machinery" "$LINENO" 5 fi # test -n "$CONFIG_HEADERS" eval set X " :F $CONFIG_FILES :H $CONFIG_HEADERS :C $CONFIG_COMMANDS" shift for ac_tag do case $ac_tag in :[FHLC]) ac_mode=$ac_tag; continue;; esac case $ac_mode$ac_tag in :[FHL]*:*);; :L* | :C*:*) as_fn_error $? "invalid tag \`$ac_tag'" "$LINENO" 5;; :[FH]-) ac_tag=-:-;; :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; esac ac_save_IFS=$IFS IFS=: set x $ac_tag IFS=$ac_save_IFS shift ac_file=$1 shift case $ac_mode in :L) ac_source=$1;; :[FH]) ac_file_inputs= for ac_f do case $ac_f in -) ac_f="$ac_tmp/stdin";; *) # Look for the file first in the build tree, then in the source tree # (if the path is not absolute). The absolute path cannot be DOS-style, # because $ac_f cannot contain `:'. test -f "$ac_f" || case $ac_f in [\\/$]*) false;; *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; esac || as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;; esac case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac as_fn_append ac_file_inputs " '$ac_f'" done # Let's still pretend it is `configure' which instantiates (i.e., don't # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 $as_echo "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) ac_sed_conf_input=`$as_echo "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac case $ac_tag in *:-:* | *:-) cat >"$ac_tmp/stdin" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; esac ;; esac ac_dir=`$as_dirname -- "$ac_file" || $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir="$ac_dir"; as_fn_mkdir_p ac_builddir=. case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; esac ;; esac ac_abs_top_builddir=$ac_pwd ac_abs_builddir=$ac_pwd$ac_dir_suffix # for backward compatibility: ac_top_builddir=$ac_top_build_prefix case $srcdir in .) # We are building in place. ac_srcdir=. ac_top_srcdir=$ac_top_builddir_sub ac_abs_top_srcdir=$ac_pwd ;; [\\/]* | ?:[\\/]* ) # Absolute name. ac_srcdir=$srcdir$ac_dir_suffix; ac_top_srcdir=$srcdir ac_abs_top_srcdir=$srcdir ;; *) # Relative name. ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix ac_top_srcdir=$ac_top_build_prefix$srcdir ac_abs_top_srcdir=$ac_pwd/$srcdir ;; esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix case $ac_mode in :F) # # CONFIG_FILE # case $INSTALL in [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; esac ac_MKDIR_P=$MKDIR_P case $MKDIR_P in [\\/$]* | ?:[\\/]* ) ;; */*) ac_MKDIR_P=$ac_top_build_prefix$MKDIR_P ;; esac # If the template does not know about datarootdir, expand it. # FIXME: This hack should be removed a few years after 2.60. ac_datarootdir_hack=; ac_datarootdir_seen= ac_sed_dataroot=' /datarootdir/ { p q } /@datadir@/p /@docdir@/p /@infodir@/p /@localedir@/p /@mandir@/p' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 $as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} ac_datarootdir_hack=' s&@datadir@&${datarootdir}&g s&@docdir@&${datarootdir}/doc/${PACKAGE_TARNAME}&g s&@infodir@&${datarootdir}/info&g s&@localedir@&${datarootdir}/locale&g s&@mandir@&${datarootdir}/man&g s&\${datarootdir}&${prefix}/share&g' ;; esac ac_sed_extra="/^[ ]*VPATH[ ]*=[ ]*/{ h s/// s/^/:/ s/[ ]*$/:/ s/:\$(srcdir):/:/g s/:\${srcdir}:/:/g s/:@srcdir@:/:/g s/^:*// s/:*$// x s/\(=[ ]*\).*/\1/ G s/\n// s/^[^=]*=[ ]*$// } :t /@[a-zA-Z_][a-zA-Z_0-9]*@/!b s|@configure_input@|$ac_sed_conf_input|;t t s&@top_builddir@&$ac_top_builddir_sub&;t t s&@top_build_prefix@&$ac_top_build_prefix&;t t s&@srcdir@&$ac_srcdir&;t t s&@abs_srcdir@&$ac_abs_srcdir&;t t s&@top_srcdir@&$ac_top_srcdir&;t t s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t s&@builddir@&$ac_builddir&;t t s&@abs_builddir@&$ac_abs_builddir&;t t s&@abs_top_builddir@&$ac_abs_top_builddir&;t t s&@INSTALL@&$ac_INSTALL&;t t s&@MKDIR_P@&$ac_MKDIR_P&;t t $ac_datarootdir_hack " eval sed \"\$ac_sed_extra\" "$ac_file_inputs" | $AWK -f "$ac_tmp/subs.awk" \ >$ac_tmp/out || as_fn_error $? "could not create $ac_file" "$LINENO" 5 test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \ "$ac_tmp/out"`; test -z "$ac_out"; } && { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&5 $as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&2;} rm -f "$ac_tmp/stdin" case $ac_file in -) cat "$ac_tmp/out" && rm -f "$ac_tmp/out";; *) rm -f "$ac_file" && mv "$ac_tmp/out" "$ac_file";; esac \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 ;; :H) # # CONFIG_HEADER # if test x"$ac_file" != x-; then { $as_echo "/* $configure_input */" \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" } >"$ac_tmp/config.h" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 if diff "$ac_file" "$ac_tmp/config.h" >/dev/null 2>&1; then { $as_echo "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5 $as_echo "$as_me: $ac_file is unchanged" >&6;} else rm -f "$ac_file" mv "$ac_tmp/config.h" "$ac_file" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 fi else $as_echo "/* $configure_input */" \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" \ || as_fn_error $? "could not create -" "$LINENO" 5 fi # Compute "$ac_file"'s index in $config_headers. _am_arg="$ac_file" _am_stamp_count=1 for _am_header in $config_headers :; do case $_am_header in $_am_arg | $_am_arg:* ) break ;; * ) _am_stamp_count=`expr $_am_stamp_count + 1` ;; esac done echo "timestamp for $_am_arg" >`$as_dirname -- "$_am_arg" || $as_expr X"$_am_arg" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$_am_arg" : 'X\(//\)[^/]' \| \ X"$_am_arg" : 'X\(//\)$' \| \ X"$_am_arg" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$_am_arg" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'`/stamp-h$_am_stamp_count ;; :C) { $as_echo "$as_me:${as_lineno-$LINENO}: executing $ac_file commands" >&5 $as_echo "$as_me: executing $ac_file commands" >&6;} ;; esac case $ac_file$ac_mode in "depfiles":C) test x"$AMDEP_TRUE" != x"" || { # Autoconf 2.62 quotes --file arguments for eval, but not when files # are listed without --file. Let's play safe and only enable the eval # if we detect the quoting. case $CONFIG_FILES in *\'*) eval set x "$CONFIG_FILES" ;; *) set x $CONFIG_FILES ;; esac shift for mf do # Strip MF so we end up with the name of the file. mf=`echo "$mf" | sed -e 's/:.*$//'` # Check whether this is an Automake generated Makefile or not. # We used to match only the files named `Makefile.in', but # some people rename them; so instead we look at the file content. # Grep'ing the first line is not enough: some people post-process # each Makefile.in and add a new line on top of each file to say so. # Grep'ing the whole file is not good either: AIX grep has a line # limit of 2048, but all sed's we know have understand at least 4000. if sed -n 's,^#.*generated by automake.*,X,p' "$mf" | grep X >/dev/null 2>&1; then dirpart=`$as_dirname -- "$mf" || $as_expr X"$mf" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$mf" : 'X\(//\)[^/]' \| \ X"$mf" : 'X\(//\)$' \| \ X"$mf" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$mf" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` else continue fi # Extract the definition of DEPDIR, am__include, and am__quote # from the Makefile without running `make'. DEPDIR=`sed -n 's/^DEPDIR = //p' < "$mf"` test -z "$DEPDIR" && continue am__include=`sed -n 's/^am__include = //p' < "$mf"` test -z "am__include" && continue am__quote=`sed -n 's/^am__quote = //p' < "$mf"` # When using ansi2knr, U may be empty or an underscore; expand it U=`sed -n 's/^U = //p' < "$mf"` # Find all dependency output files, they are included files with # $(DEPDIR) in their names. We invoke sed twice because it is the # simplest approach to changing $(DEPDIR) to its actual value in the # expansion. for file in `sed -n " s/^$am__include $am__quote\(.*(DEPDIR).*\)$am__quote"'$/\1/p' <"$mf" | \ sed -e 's/\$(DEPDIR)/'"$DEPDIR"'/g' -e 's/\$U/'"$U"'/g'`; do # Make sure the directory exists. test -f "$dirpart/$file" && continue fdir=`$as_dirname -- "$file" || $as_expr X"$file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$file" : 'X\(//\)[^/]' \| \ X"$file" : 'X\(//\)$' \| \ X"$file" : 'X\(/\)' \| . 2>/dev/null || $as_echo X"$file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q'` as_dir=$dirpart/$fdir; as_fn_mkdir_p # echo "creating $dirpart/$file" echo '# dummy' > "$dirpart/$file" done done } ;; esac done # for ac_tag as_fn_exit 0 mtr-0.85/SECURITY0000664000175000017500000000363012104225675012466 0ustar wolffwolffSECURITY ISSUES RELATED TO MTR You can limit mtr usage to the root user by not putting a setuid bit on the mtr binary. In that case, the security implications are minimal. Or you can make mtr setuid-root, and the following applies to you.... Since mtr is installed as suid-root, some concern over security is justified. Since version 0.21 of mtr, does the following two things after it is launched: * mtr requests a pair of raw sockets from the kernel. * mtr sets the effective uid to match the real uid. See main() in mtr.c and net_preopen() in net.c for the details of this process. Note that no code from GTK+ or curses is executed before the drop in permissions. This should severely limit the possibilities of using mtr to breach system security. This means the worst case scenerio is as follows: Due to some oversight in the mtr code, a malicious user is able to overrun one of mtr's internal buffers with binary code that is eventually executed. The malicious user is still not able to read from or write to any system files which they wouldn't normally have permission to write to. The only priveledge gained is access to the raw socket descriptors, which would allow the malicious user to listen to all ICMP packets arriving at the system, and send forged packets with arbitrary contents. The mtr-code does its best to prevent calling of external library code before dropping privileges. It seems that C++ library code has the ability to issue a "please execute me before calling main" to the loader/linker. That would mean that we're still vulnerable to errors in that code. This is why I would prefer to drop the backends, have mtr-core always run in "raw" mode, and have the backends interpret the output from the mtr-core. Maybe a nice project for a college-level student. If you have further questions or comments about security issues, please direct them to the mtr mailing list. See README for details.