sdl12-compat-1.2.74/BUGS.md0000664000000000000000000000077314304237025012034 0ustar00 # Reporting bugs Bugs are now managed in sdl12-compat's GitHub Issues tracker: https://github.com/libsdl-org/sdl12-compat/issues You may report bugs there, and search to see if a given issue has already been reported, discussed, and maybe even fixed. # Discussion with other humans You may also find help at the SDL forums: https://discourse.libsdl.org/ Bug reports are welcome here, but we really appreciate if you use the bug tracker, as bugs discussed on the forums may be forgotten or missed. sdl12-compat-1.2.74/CMakeLists.txt0000664000000000000000000002300115140471502013476 0ustar00# NOTE: If you installed SDL2 at an unusual place and FindSDL2 fails, # you can define SDL2_INCLUDE_DIR on the cmdline. For example: # cmake -DSDL2_INCLUDE_DIR=/opt/SDL2/include/SDL2 [other stuff] cmake_minimum_required(VERSION 3.0.0...4.1) project(sdl12_compat VERSION 1.2.74 LANGUAGES C) option(SDL12TESTS "Enable to build SDL-1.2 test programs" ON) option(SDL12DEVEL "Enable installing SDL-1.2 development headers" ON) option(STATICDEVEL "Enable installing static link library" OFF) if(STATICDEVEL AND NOT (CMAKE_SYSTEM_NAME MATCHES "Linux")) message(FATAL_ERROR "Static builds are only supported on Linux.") endif() list(APPEND CMAKE_MODULE_PATH "${CMAKE_CURRENT_LIST_DIR}/cmake/modules" ) include(CheckCSourceCompiles) include(CheckIncludeFile) include(CheckCCompilerFlag) include(GNUInstallDirs) if(APPLE) set(OSX_SRCS "src/SDL12_compat_objc.m") set_source_files_properties(${OSX_SRCS} PROPERTIES LANGUAGE C) if(NOT CMAKE_VERSION VERSION_LESS "3.16") enable_language(OBJC) set_source_files_properties(${OSX_SRCS} PROPERTIES LANGUAGE OBJC) endif() # compatibility version set to match SDL-1.2 autotools build # Xcode project file uses 1.0.0, but it's more compatible to use the # higher version. set(DYLIB_COMPAT_VERSION 12.0.0 CACHE STRING "library compatibility version") set(DYLIB_CURRENT_VERSION 12.73.0 CACHE STRING "library current version") include_directories("/opt/X11/include") # hack. if(CMAKE_VERSION VERSION_LESS 3.9) else() cmake_policy(SET CMP0068 NEW) # on macOS, don't let RPATH affect install_name. endif() endif() if(WIN32) set(WIN32_SRCS "src/version.rc") endif() set(SDL12COMPAT_SRCS src/SDL12_compat.c ${OSX_SRCS} ${WIN32_SRCS} ) add_library(SDL SHARED ${SDL12COMPAT_SRCS}) add_library(SDL::SDL-shared ALIAS SDL) add_library(SDL::SDL ALIAS SDL) find_package(SDL2 CONFIG) find_package(SDL2 MODULE) if(NOT SDL2_INCLUDE_DIRS) message(FATAL_ERROR "Could not find SDL2 headers") endif() target_include_directories(SDL PRIVATE ${SDL2_INCLUDE_DIRS}) set(EXTRA_CFLAGS ) if (CMAKE_C_COMPILER_ID MATCHES "Clang|GNU") set(EXTRA_CFLAGS "${EXTRA_CFLAGS} -Wall") check_c_compiler_flag(-Wdeclaration-after-statement HAVE_WDECLARATION_AFTER_STATEMENT) if(HAVE_WDECLARATION_AFTER_STATEMENT) set(EXTRA_CFLAGS "${EXTRA_CFLAGS} -Wdeclaration-after-statement") endif() check_c_compiler_flag(-Werror=declaration-after-statement HAVE_WERROR_DECLARATION_AFTER_STATEMENT) if(HAVE_WERROR_DECLARATION_AFTER_STATEMENT) set(EXTRA_CFLAGS "${EXTRA_CFLAGS} -Werror=declaration-after-statement") endif() endif() # just in case: check_include_file("immintrin.h" HAVE_IMMINTRIN_H) if(NOT HAVE_IMMINTRIN_H) set(EXTRA_CFLAGS "${EXTRA_CFLAGS} -DSDL_DISABLE_IMMINTRIN_H") endif() set(CMAKE_C_FLAGS "${CMAKE_C_FLAGS} ${EXTRA_CFLAGS}") string(STRIP "${CMAKE_C_FLAGS}" CMAKE_C_FLAGS) if(UNIX AND NOT APPLE) set_target_properties(SDL PROPERTIES COMPILE_DEFINITIONS "_REENTRANT") target_link_libraries(SDL PRIVATE ${CMAKE_DL_LIBS}) endif() if(APPLE) set_target_properties(SDL PROPERTIES COMPILE_DEFINITIONS "_THREAD_SAFE") set_target_properties(SDL PROPERTIES LINK_FLAGS "-Wl,-compatibility_version,${DYLIB_COMPAT_VERSION} -Wl,-current_version,${DYLIB_CURRENT_VERSION}") target_link_libraries(SDL PRIVATE "-framework AppKit") set_target_properties(SDL PROPERTIES OUTPUT_NAME "SDL-1.2.0" ) elseif(UNIX AND NOT ANDROID) set_target_properties(SDL PROPERTIES VERSION "${PROJECT_VERSION}" SOVERSION "0" OUTPUT_NAME "SDL-1.2") elseif(WIN32) # avoid DLL having 'lib' prefix with MinGW set(CMAKE_SHARED_LIBRARY_PREFIX "") set_target_properties(SDL PROPERTIES COMPILE_DEFINITIONS "DLL_EXPORT") set_target_properties(SDL PROPERTIES VERSION "${PROJECT_VERSION}" SOVERSION "0" OUTPUT_NAME "SDL") elseif(OS2) set_target_properties(SDL PROPERTIES COMPILE_DEFINITIONS "BUILD_SDL") # for DECLSPEC set_target_properties(SDL PROPERTIES VERSION "${PROJECT_VERSION}" SOVERSION "0" OUTPUT_NAME "SDL12") else() set_target_properties(SDL PROPERTIES VERSION "${PROJECT_VERSION}" SOVERSION "0" OUTPUT_NAME "SDL") endif() if(MINGW) set_target_properties(SDL PROPERTIES LINK_FLAGS "-nostdlib") target_link_libraries(SDL PRIVATE "-static-libgcc -lgcc") # libgcc is needed for 32 bit (x86) builds endif() if(MSVC) # Don't try to link with the default set of libraries. set(MSVC_FLAGS "/GS-") check_c_source_compiles("int main(void) { #ifndef _M_IX86 #error not x86 #endif return 0; }" IS_X86) if(IS_X86) # don't emit SSE2 in x86 builds set(MSVC_FLAGS "${MSVC_FLAGS} /arch:SSE") endif() set_target_properties(SDL PROPERTIES COMPILE_FLAGS ${MSVC_FLAGS}) set_target_properties(SDL PROPERTIES LINK_FLAGS "/NODEFAULTLIB") # Make sure /RTC1 is disabled: (from SDL2 CMake) set_property(TARGET SDL PROPERTY MSVC_RUNTIME_CHECKS "") foreach(flag_var CMAKE_C_FLAGS CMAKE_C_FLAGS_DEBUG CMAKE_C_FLAGS_RELEASE CMAKE_C_FLAGS_MINSIZEREL CMAKE_C_FLAGS_RELWITHDEBINFO) string(REGEX REPLACE "/RTC(su|[1su])" "" ${flag_var} "${${flag_var}}") endforeach(flag_var) endif() # SDLmain library... if(APPLE) add_library(SDLmain STATIC src/SDLmain/macosx/SDLMain.m) set_source_files_properties(src/SDLmain/macosx/SDLMain.m PROPERTIES LANGUAGE C) if(NOT CMAKE_VERSION VERSION_LESS "3.16") set_source_files_properties("src/SDLmain/macosx/SDLMain.m" PROPERTIES LANGUAGE OBJC) endif() elseif(WIN32) add_library(SDLmain STATIC src/SDLmain/win32/SDL_win32_main.c) set_target_properties(SDLmain PROPERTIES COMPILE_DEFINITIONS "_CRT_SECURE_NO_WARNINGS;_CRT_SECURE_NO_DEPRECATE;_CRT_NONSTDC_NO_DEPRECATE") # !!! FIXME: don't use C runtime? We fixed this in SDL2. else() add_library(SDLmain STATIC src/SDLmain/dummy/SDL_dummy_main.c) endif() add_library(SDL::SDLmain ALIAS SDLmain) target_include_directories(SDLmain PUBLIC "$") target_include_directories(SDLmain PUBLIC "$") if(MINGW OR CYGWIN) if(CMAKE_SIZEOF_VOID_P EQUAL 4) target_link_libraries(SDLmain PUBLIC "$<$,EXECUTABLE>:-Wl,--undefined=_WinMain@16>") else() target_link_libraries(SDLmain PUBLIC "$<$,EXECUTABLE>:-Wl,--undefined=WinMain>") endif() endif() if(SDL12TESTS) add_subdirectory(test) endif() install(TARGETS SDL SDLmain LIBRARY DESTINATION ${CMAKE_INSTALL_LIBDIR} ARCHIVE DESTINATION ${CMAKE_INSTALL_LIBDIR} RUNTIME DESTINATION ${CMAKE_INSTALL_BINDIR} ) if(SDL12DEVEL) install(DIRECTORY include/ DESTINATION ${CMAKE_INSTALL_INCLUDEDIR}) if(NOT MSVC) if(WIN32) set(SDL_CFLAGS "") set(SDL_RLD_FLAGS "") set(SDL_LIBS "-lmingw32 -lSDLmain -lSDL -mwindows") set(SDL_STATIC_LIBS "") elseif(APPLE) set(SDL_CFLAGS "-D_THREAD_SAFE") set(SDL_LIBS "-lSDLmain -lSDL -Wl,-framework,Cocoa") set(SDL_STATIC_LIBS "") set(SDL_RLD_FLAGS "") # !!! FIXME: this forces rpath, which we might want? else() # unix set(SDL_CFLAGS "-D_GNU_SOURCE=1 -D_REENTRANT") set(SDL_RLD_FLAGS "") # !!! FIXME: this forces rpath, which we might want? set(SDL_LIBS "-lSDL") set(SDL_STATIC_LIBS "") foreach(lib ${CMAKE_DL_LIBS}) set(SDL_STATIC_LIBS "-l${lib}") endforeach() if(NOT STATICDEVEL) set(SDL_STATIC_LIBS "") endif() endif() # !!! FIXME: do we _want_ static builds? if(STATICDEVEL) set(ENABLE_STATIC_TRUE "") set(ENABLE_STATIC_FALSE "#") else() set(ENABLE_STATIC_TRUE "#") set(ENABLE_STATIC_FALSE "") endif() set(ENABLE_SHARED_TRUE "") set(ENABLE_SHARED_FALSE "#") configure_file(sdl12_compat.pc.in sdl12_compat.pc @ONLY) install(FILES ${CMAKE_CURRENT_BINARY_DIR}/sdl12_compat.pc DESTINATION ${CMAKE_INSTALL_LIBDIR}/pkgconfig ) configure_file("${CMAKE_CURRENT_SOURCE_DIR}/sdl-config.in" "${CMAKE_CURRENT_BINARY_DIR}/sdl-config" @ONLY) install(PROGRAMS "${CMAKE_CURRENT_BINARY_DIR}/sdl-config" DESTINATION bin) # uninstall if(NOT TARGET uninstall) configure_file(cmake/cmake_uninstall.cmake.in "${CMAKE_CURRENT_BINARY_DIR}/cmake_uninstall.cmake" IMMEDIATE @ONLY) add_custom_target(uninstall COMMAND ${CMAKE_COMMAND} -P "${CMAKE_CURRENT_BINARY_DIR}/cmake_uninstall.cmake") endif() endif() set(SOEXT ${CMAKE_SHARED_LIBRARY_SUFFIX}) get_target_property(SONAME SDL OUTPUT_NAME) if(UNIX AND NOT ANDROID) install(CODE " execute_process(COMMAND ${CMAKE_COMMAND} -E create_symlink \"lib${SONAME}${SOPOSTFIX}${SOEXT}\" \"libSDL${SOPOSTFIX}${SOEXT}\" WORKING_DIRECTORY \"${CMAKE_CURRENT_BINARY_DIR}\")") install(FILES ${CMAKE_CURRENT_BINARY_DIR}/libSDL${SOPOSTFIX}${SOEXT} DESTINATION "${CMAKE_INSTALL_LIBDIR}") endif() install(FILES "${CMAKE_CURRENT_SOURCE_DIR}/sdl.m4" DESTINATION "${CMAKE_INSTALL_DATAROOTDIR}/aclocal") endif() if(STATICDEVEL AND SDL12DEVEL) add_library(SDL-static STATIC ${SDL12COMPAT_SRCS}) add_library(SDL::SDL-static ALIAS SDL-static) target_include_directories(SDL-static PRIVATE ${SDL2_INCLUDE_DIRS}) set_target_properties(SDL-static PROPERTIES COMPILE_DEFINITIONS "_REENTRANT") target_link_libraries(SDL-static PRIVATE ${CMAKE_DL_LIBS}) set_target_properties(SDL-static PROPERTIES VERSION "${PROJECT_VERSION}" OUTPUT_NAME "SDL") install(TARGETS SDL-static ARCHIVE DESTINATION ${CMAKE_INSTALL_LIBDIR} ) endif() sdl12-compat-1.2.74/COMPATIBILITY.md0000664000000000000000000001143314431673477013320 0ustar00# Compatibility notes This is a list of quirks and known-issues for specific games, with possible workarounds. We are currently building and maintaining a list of all known SDL 1.2 games and their current state with sdl12-compat over here: https://docs.google.com/spreadsheets/d/1u8Rq3LVQYYgu28sBuxrZ371QolbiZu5z_LjENc4ddZs/edit?usp=sharing ## Dynamite Jack (Linux) More modern builds are ported to SDL2, but the older 1.2 binaries will work on X11 if you turn off OpenGL Scaling. export SDL12COMPAT_OPENGL_SCALING=0 Note that this game calls glXGetProcAddress() directly and likely will not work as a native Wayland app (XWayland works fine, however). You have to set this environment variable yourself. Dynamic Jack's binary is called "main" so we can't reasonably set up an automatic entry for it in our quirks table. ## Hammerfight (Linux) You probably aren't getting usable mouse input, as the game talks directly to XInput2 on X11 (and tries to use /dev/input if that fails). This is not an sdl12-compat bug, as this is going outside of SDL to get multiple mice input. The game is statically linked to a copy of [ManyMouse](https://icculus.org/manymouse/), which provides multiple mice access. The simplest way to deal with this is change this line in the game's Config.ini file: CORE_INIT_RI=true Make that `false` and it won't even try to initialize ManyMouse, and will use standard SDL 1.2 mouse events for single-player input. (The "RI" stands for "RawInput," which Hammerfight uses on Windows for multi-mice support). Of course, with this change, you can't have multiple players on the same machine using separate mice. Hammerfight dlopen()'s the XInput2 libraries instead of linking to them directly, so this does not prevent the game from working on Wayland. No XWayland needed! ## Tucnak (Linux) There is an SDL2 target for libzia (which tucnak uses for rendering), and you should use that in modern times. But if you're on the SDL 1.2 target, tucnak tries to render from a background thread, and does its event loop on another, so we can't cleanly hook in to make it draw from the main thread. sdl12-compat will force SDL2 to use X11, software rendering, and no texture framebuffer, to avoid using OpenGL, to avoid the threading problems this will cause. The app is perfectly usable in this configuration (and largely matches how they expected you to use it with SDL 1.2 anyhow). ## Awesomenauts (Linux) Awesomenauts requires X11 because it talks directly to glX, can't use our scaling code because it uses framebuffer objects without going through SDL_GL_GetProcAddress() to get entry points, and does something weird with OpenGL contexts on multiple threads. sdl12-compat detects this and forces on the correct hints to make this work, but it limits how one can use the game. This game will work in a Wayland environment, but only as an X11 app through XWayland. ## Braid (Linux) Braid requires X11 because it talks directly to glX, and can't use our scaling code because it uses framebuffer objects without going through SDL_GL_GetProcAddress() to get entry points. sdl12-compat detects this and forces on the correct hints to make this work, but it limits how one can use the game. This game will work in a Wayland environment, but only as an X11 app through XWayland. ## DOSBox (Linux) DOSBox has some pretty strict requirements for keyboard input. We detect some common names for DOSBox binaries ("dosbox", "dosbox_i686", etc), and force the correct hints to make it work, but if you have an uncommon binary name and keyboard input isn't working as you expect, try exporting this environment variable: export SDL12COMPAT_USE_KEYBOARD_LAYOUT=0 ## Multiwinia (Linux) Multiwinia calls SDL_Quit() when changing video modes but doesn't reinitialize SDL before using it further. We detect this binary and force the correct hints to make it work, but if you have an uncommon binary name and the game isn't working, try this environment variable: export SDL12COMPAT_NO_QUIT_VIDEO=1 ## Civilization: Call to Power (Linux) The Linux port of Civilization: Call to Power is very old, and has a number of issues running on modern systems. The relevant ones for sdl12-compat are that the game uses SDL 1.1 (not SDL 1.2), and that it uses CD audio. To fix the former, you'll need to either rename the sdl12-compat files, or patch the game binary to look for libSDL-1.2.so.0. For the latter, you'll need to rip the game's CD audio, and set the SDL12COMPAT_FAKE_CDROM_PATH environment variable. Make sure you set this to an absolute path, as the game changes directories before initializing SDL. A more complete guide for getting the game to work on modern systems with sdl12-compat is available [here](https://davidgow.net/hacks/civctp.html). (Some of these tricks may also work for other old Loki Entertainment ports, too.) sdl12-compat-1.2.74/HOW_TO_TEST_GAMES.md0000664000000000000000000001344114325556375014121 0ustar00# Testing games with sdl12-compat sdl12-compat is here to make sure older games not only work well, but work _correctly_, and for that, we need an army of testers. Here's how to test games with sdl12-compat. ## The general idea - Build [SDL2](https://github.com/libsdl-org/SDL) or find a prebuilt binary. - Build sdl12-compat (documentation is in README.md) - Find a game to test. - Make sure a game uses sdl12-compat instead of classic SDL 1.2 - See if game works or blows up, report back. ## Find a game to test We are keeping a spreadsheet of known games that still use SDL 1.2 [here](https://docs.google.com/spreadsheets/d/1u8Rq3LVQYYgu28sBuxrZ371QolbiZu5z_LjENc4ddZs/edit?usp=sharing). Find something that hasn't been tested, or hasn't been tested recently, and give it a try! Then update the spreadsheet. Extra credit if you [file bug reports](https://github.com/libsdl-org/sdl12-compat/issues) but we're grateful if you just make notes on the spreadsheet, too. ## Make sure the game works with real SDL 1.2 first! You'd be surprised how many games have bitrotted! If it doesn't work with real 1.2 anymore, it's not a bug if sdl12-compat doesn't work either. That being said, lots of games that stopped working _because_ of SDL 1.2 will now work again with sdl12-compat, which is nice, but just make sure you have a baseline before you start testing. ## Force it to use sdl12-compat instead. Either overwrite the copy of SDL-1.2 that the game uses with sdl12-compat, or (on Linux) export LD_LIBRARY_PATH to point to your copy, so the system will favor it when loading libraries. ## Watch out for setuid/setgid binaries! On Linux, if you're testing a binary that's setgid to a "games" group (which we ran into several times with Debian packages), or setuid root or whatever, then the system will ignore the LD_LIBRARY_PATH variable, as a security measure. The reason some games are packaged like this is usually because they want to write to a high score list in a global, shared directory. Often times the games will just carry on if they fail to do so. There are several ways to bypass this: - On some distros, you can run `ld.so` directly: ```bash LD_LIBRARY_PATH=/where/i/can/find/sdl12-compat ld.so /usr/games/mygame ``` - You can remove the setgid bit: ```bash # (it's `u-s` for the setuid bit) sudo chmod g-s /usr/games/mygame ``` - You can install sdl12-compat system-wide, so the game uses that instead of SDL 1.2 by default. - If you don't have root access at all, you can try to copy the game somewhere else or install a personal copy, or build from source code, but these are drastic measures. Definitely read the next section ("Am I actually running sdl12-compat?") in these scenarios to make sure you ended up with the right library! ## Am I actually running sdl12-compat? The easiest way to know is to set some environment variables: ```bash export SDL12COMPAT_DEBUG_LOGGING=1 ``` If this is set, when loading sdl12-compat, it'll write something like this to stderr (on Linux and Mac, at least)... ``` INFO: sdl12-compat, built on Sep 2 2022 at 11:27:37, talking to SDL2 2.25.0 ``` You can also use this: ```bash export SDL_EVENT_LOGGING=1 ``` Which will report every event SDL 2 sends to stderr: ``` INFO: SDL EVENT: SDL_WINDOWEVENT (timestamp=317 windowid=1 event=SDL_WINDOWEVENT_MOVED data1=1280 data2=674) INFO: SDL EVENT: SDL_WINDOWEVENT (timestamp=318 windowid=1 event=SDL_WINDOWEVENT_EXPOSED data1=0 data2=0) INFO: SDL EVENT: SDL_WINDOWEVENT (timestamp=318 windowid=1 event=SDL_WINDOWEVENT_ENTER data1=0 data2=0) ``` Since this is a new feature in SDL2, it'll only show up because sdl12-compat talks to SDL2 and classic SDL 1.2 doesn't. ## Steam If testing a Steam game, you'll want to launch the game outside of the Steam Client, so that Steam doesn't overwrite files you replaced and so you can easily control environment variables. Since you'll be using the Steam Runtime, you don't have to find your own copy of SDL2, as Steam provides it. On Linux, Steam stores games in ~/.local/share/Steam/steamapps/common, each in its own usually-well-named subdirectory. You'll want to add a file named "steam_appid.txt" to the same directory as the binary, which will encourage Steamworks to _not_ terminate the process and have the Steam Client relaunch it. This file should just have the appid for the game in question, which you can find from the store page. For example, the store page for Braid is: https://store.steampowered.com/app/26800/Braid/ See that `26800`? That's the appid. ```bash echo 26800 > steam_appid.txt ``` For Linux, you can make sure that, from the command line, the game still runs with the Steam Runtime and has the Steam Overlay by launching it with a little script: - [steamapp32](https://raw.githubusercontent.com/icculus/twisty-little-utilities/main/steamapp32) for x86 binaries. - [steamapp64](https://raw.githubusercontent.com/icculus/twisty-little-utilities/main/steamapp64) for x86-64 binaries. (And make sure you have a 32-bit or 64-bit build of sdl12-compat!) And then make sure you force it to use _your_ sdl12-compat instead of the system/Steam Runtime build: ```bash export LD_LIBRARY_PATH=/where/i/installed/sdl12-compat ``` Putting this all together, you might run [BIT.TRIP Runner2](https://store.steampowered.com/app/218060/) like this: ```bash cd ~/.local/share/Steam/steamapps/common/bittriprunner2 export LD_LIBRARY_PATH=/where/i/installed/sdl12-compat export SDL12COMPAT_DEBUG_LOGGING=1 echo 218060 > steam_appid.txt steamapp32 ./runner2 ``` ## Windows Generally, Windows games just ship with an SDL.dll, and you just need to overwrite it with an sdl12-compat build, then run as usual. ## macOS, etc. (write me.) ## Questions? If something isn't clear, make a note [here](https://github.com/libsdl-org/sdl12-compat/issues/new) and we'll update this document. Thanks! sdl12-compat-1.2.74/LICENSE.txt0000664000000000000000000000201115125533266012570 0ustar00Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. This project includes code from dr_mp3 ( https://github.com/mackron/dr_libs ) which can be treated as public domain or MIT-0 licensed, at your option. sdl12-compat-1.2.74/README.md0000664000000000000000000003614415042674342012241 0ustar00# Simple DirectMedia Layer (SDL) sdl12-compat https://www.libsdl.org/ This is the Simple DirectMedia Layer, a general API that provides low level access to audio, keyboard, mouse, joystick, 3D hardware via OpenGL, and 2D framebuffer across multiple platforms. This code is a compatibility layer; it provides a binary and source compatible API for programs written against SDL 1.2, but it uses SDL 2.0 behind the scenes. If you are writing new code, please target SDL 3.0 directly and do not use this layer. If you absolutely must have the real SDL 1.2 ("SDL 1.2 Classic"), please use the source tree at https://github.com/libsdl-org/SDL-1.2, which occasionally gets bug fixes but no formal release. But we strongly encourage you not to do that. # How to use: - Build the library. This will need access to SDL2's headers (v2.0.7 or newer), [CMake](https://cmake.org/) and the build tools of your choice. Once built, you will have a drop-in replacement that can be used with any existing binary that relies on SDL 1.2. You can copy this library over the existing 1.2 build, or force it to take priority over a system copy with LD_LIBRARY_PATH, etc. At runtime, sdl12-compat needs to be able to find a copy of SDL2 (v2.0.7 or newer -- v2.0.12 or newer for Windows), so plan to include it with the library if necessary. - If you want to build an SDL 1.2 program from source code, we have included compatibility headers, so that sdl12-compat can completely replace SDL 1.2 at all points. These headers are just the bare minimum needed for source-level compatibility and don't have a lot of documentation or fanciness at all. The new headers are also under the zlib license. Note that sdl12-compat itself does not use these headers, so if you just want the library, you don't need them. # Building the library: These are quick-start instructions; there isn't anything out of the ordinary here if you're used to using CMake. You'll need to use CMake to build sdl12-compat. Download at [cmake.org](https://cmake.org/) or install from your package manager (`sudo apt-get install cmake` on Ubuntu, etc). Please refer to the [CMake documentation](https://cmake.org/documentation/) for complete details, as platform and build tool details vary. You'll need a copy of SDL2 to build sdl12-compat, because we need the SDL2 headers. You can build this from source or install from a package manager. Windows and Mac users can download prebuilt binaries from [SDL's download page](https://libsdl.org/download-2.0.php); make sure you get the "development libraries" and not "runtime binaries" there. Linux users might need some packages from their Linux distribution. On Ubuntu, you might need to do: ```bash sudo apt-get install build-essential cmake libsdl2-2.0-0 libsdl2-dev libgl-dev ``` Now just point CMake at sdl12-compat's directory. Here's a command-line example: ```bash cd sdl12-compat cmake -Bbuild -DCMAKE_BUILD_TYPE=Release . cmake --build build ``` On Windows or macOS, you might prefer to use CMake's GUI, but it's the same idea: give it the directory where sdl12-compat is located, click "Configure," choose your favorite compiler, then click "Generate." Now you have project files! Click "Open Project" to launch your development environment. Then you can build however you like with Visual Studio, Xcode, etc. If necessary, you might have to fill in the location of the SDL2 headers when using CMake. sdl12-compat does not need SDL2's library to _build_, just its headers (although it may complain about the missing library, you can ignore that). From the command line, add `-DSDL2_INCLUDE_DIR=/path/to/SDL2/include`, or find this in the CMake GUI and set it appropriately, click "Configure" again, and then "Generate." When the build is complete, you'll have a shared library you can drop in as a replacement for an existing SDL 1.2 build. This will also build the original SDL 1.2 test apps, so you can verify the library is working. # Building for older CPU architectures on Linux: There are a lot of binaries from many years ago that used SDL 1.2, which is to say they are for CPU architectures that are likely not your current system's. If you want to build a 32-bit x86 library on an x86-64 Linux machine, for compatibility with older games, you should install some basic 32-bit development libraries for your distribution. On Ubuntu, this would be: ```bash sudo apt-get install gcc-multilib libsdl2-dev:i386 ``` ...and then add `-m32` to your build options: ```bash cd sdl12-compat cmake -Bbuild32 -DCMAKE_BUILD_TYPE=Release -DCMAKE_C_FLAGS=-m32 cmake --build build32 ``` # Building for older CPU architectures on macOS: macOS users can try adding `-DCMAKE_OSX_ARCHITECTURES='arm64;x86_64'` instead of `-DCMAKE_C_FLAGS=-m32` to make a Universal Binary for both 64-bit Intel and Apple Silicon machines. If you have an older (or much older!) version of Xcode, you can try to build with "i386" or maybe even "powerpc" for 32-bit Intel or PowerPC systems, but Xcode (and macOS itself) has not supported either of these for quite some time, and you will likely struggle to get SDL2 to compile here in small ways, as well...but with some effort, it's maybe _possible_ to run SDL2 and sdl12-compat on Apple's abandoned architectures. # Building for older CPU architectures on Windows: Windows users just select a 32-bit version of Visual Studio when running CMake, when it asks you what compiler to target in the CMake GUI. # Configuration options: sdl12-compat has a number of configuration options which can be used to work around issues with individual applications, or to better fit your system or preferences. These options are all specified as environment variables, and can be set by running your application with them set on the command-line, for example: ``` SDL12COMPAT_HIGHDPI=1 SDL12COMPAT_OPENGL_SCALING=0 %command% ``` will run `%command%` with high-dpi monitor support enabled, but OpenGL scaling support disabled. (While these environment variables are checked at various times throughout the lifetime of the app, sdl12-compat expects these to be set before the process starts and not change during the life of the process, and any places where changing it later might affect operation is purely accidental and might change. That is to say: don't write an SDL 1.2-based app with plans to tweak these values on the fly!) The available options are: - SDL12COMPAT_DEBUG_LOGGING: (checked at startup) If enabled, print debugging messages to stderr. These messages are mostly useful to developers, or when trying to track down a specific bug. - SDL12COMPAT_FAKE_CDROM_PATH: (checked during SDL_Init) A path to a directory containing MP3 files (named trackXX.mp3, where XX is a two-digit track number) to be used by applications which play CD audio. Using an absolute path is recommended: relative paths are not guaranteed to work correctly. - SDL12COMPAT_OPENGL_SCALING: (checked during SDL_Init) Enables scaling of OpenGL applications to the current desktop resolution. If disabled, applications can change the real screen resolution. This option is enabled by default, but not all applications are compatible with it: try changing this if you can only see a black screen. - SDL12COMPAT_FIX_BORDERLESS_FS_WIN: (checked during SDL_SetVideoMode) Enables turning borderless windows at the desktop resolution into actual fullscreen windows (so they'll go into a separate space on macOS and properly hide dock windows on other desktop environments, etc). If disabled, applications may not get the full display to theirselves as they expect. This option is enabled by default, but this option is here so it can be manually disabled, in case this causes some negative result we haven't anticipated. - SDL12COMPAT_SCALE_METHOD: (checked during SDL_Init) Choose the scaling method used when applications render at a non-native resolution. The options are `nearest`, for nearest-neighbour sampling (more pixelated) and `linear` for bilinear sampling (blurrier). - SDL12COMPAT_HIGHDPI: (checked during SDL_SetVideoMode) Advertise the application as supporting high-DPI displays. Enabling this will usually result in sharper graphics, but on some applications text and other elements may become very small. - SDL12COMPAT_SYNC_TO_VBLANK: (checked during SDL_SetVideoMode) Force the application to sync (or not sync) to the vertical blanking interval (VSync). When enabled, this will cap the application's framerate to the screen's refresh rate (and may resolve issues with screen tearing). - SDL12COMPAT_USE_KEYBOARD_LAYOUT: (checked during SDL_Init) Make all keyboard input take the current keyboard layout into account. This may need to be disabled for applications which provide their own keyboard layout support, or if the position of the keys on the keyboard is more important than the character they produce. Note that text input (in most applications) will take the keyboard layout into account regardless of this option. - SDL12COMPAT_USE_GAME_CONTROLLERS: (checked during SDL_Init) Use SDL2's higher-level Game Controller API to expose joysticks instead of its lower-level joystick API. The benefit of this is that you can exert more control over arbitrary hardware (deadzones, button mapping, device name, etc), and button and axes layouts are consistent (what is physically located where an Xbox360's "A" button is will always be SDL 1.2 joystick button 0, "B" will be 1, etc). The downside is it might not expose all of a given piece of hardware's functionality, or simply not make sense in general...if you need to use a flight stick, for example, you should not use this hint. If there is no known game controller mapping for a joystick, and this hint is in use, it will not be listed as an availble device. - SDL12COMPAT_WINDOW_SCALING: (checked during SDL_SetVideoMode) When creating non-fullscreen, non-resizable windows, use this variable to size the window differently. If, for example, you have a 4K monitor and the game is running in a window the size of a postage stamp, you might set this to 2 to double the size of the window. Fractional values work, so "1.5" might be a more-pleasing value on your hardware. You can even shrink the window with values less than 1.0! When scaling a window like this, sdl12-compat will use all the usual scaling options (SDL12COMPAT_OPENGL_SCALING, SDL12COMPAT_SCALE_METHOD, etc). If sdl12-compat can't scale the contents of the window for various technical reasons, it will create the window at the originally-requested size. If this variable isn't specified, it defaults to 1.0 (no scaling). - SDL12COMPAT_MAX_VIDMODE: (checked during SDL_Init) This is a string in the form of `WxH`, where `W` is the maximum width and `H` is the maximum height (for example: `640x480`). The list of valid resolutions that will be reported by SDL_ListModes and SDL_VideoModeOK will not include any dimensions that are wider or taller than these sizes. A size of zero will be ignored, so for `0x480` a resolution of 1920x480 would be accepted). If not specified, or set to `0x0`, no resolution clamping is done. This is for old software-rendered games that might always choose the largest resolution offered, but never conceived of 4K displays. In these cases, it might be better for them to use a smaller resolution and let sdl12-compat scale their output up with the GPU. - SDL_MOUSE_RELATIVE_SCALING: (checked during SDL_SetVideoMode) If enabled, relative mouse motion is scaled when the application is running at a non-native resolution. This may be required with some applications which use their own mouse cursors. See also: https://wiki.libsdl.org/SDL_HINT_MOUSE_RELATIVE_SCALING - SDL12COMPAT_ALLOW_THREADED_DRAWS: (checked during SDL_Init) Enabled by default. If disabled, calls to `SDL_UpdateRects()` from non-main threads are converted into requests for the main thread to carry out the update later. The thread that called `SDL_SetVideoMode()` is treated as the main thread. - SDL12COMPAT_ALLOW_THREADED_PUMPS: (checked during SDL_Init) Enabled by default. If disabled, calls to `SDL_PumpEvents()` from non-main threads are completely ignored. The thread that called `SDL_SetVideoMode()` is treated as the main thread. - SDL12COMPAT_ALLOW_SYSWM: (checked during SDL_Init) Enabled by default. If disabled, SDL_SYSWMEVENT events will not be delivered to the app, and SDL_GetWMInfo() will fail; this is useful if you have a program that tries to access X11 directly through SDL's interfaces, but can survive without it, becoming compatible with, for example, Wayland, or perhaps just avoiding a bug in target-specific code. Note that sdl12-compat already disallows SysWM things unless SDL2 is using its "windows" or "x11" video backends, because SDL 1.2 didn't have wide support for its SysWM APIs outside of Windows and X11 anyhow. - SDL12COMPAT_NO_QUIT_VIDEO: (checked during SDL_QuitSubsystem) If enabled, SDL_Quit() and SDL_QuitSubsystem() will never shut down the video subsystem. This works around buggy applications which try to use the video subsystem after shutting it down. - SDL12COMPAT_WINDOWED_MODE_LIST: (checked during SDL_ListModes) If enabled, returns the list of available video modes in SDL_ListModes(), even if the flags provided do not include SDL_FULLSCREEN. Otherwise (by default), it will return -1 to tell the application that all modes are available. This may cause some applications to fall back to an internal list, which may not be as exhaustive as the one sdl12-compat provides. Try this if a game is not listing all of the screen resolutions it should support. # Compatibility issues with OpenGL scaling The OpenGL scaling feature of sdl12-compat allows applications which wish to run at a non-native screen resolution to do so without changing the system resolution. It does this by redirecting OpenGL rendering calls to a "fake" backbuffer which is scaled when rendering. This works well for simple applications, but for more complicated applications which use Frame Buffer Objects, sdl12-compat needs to intercept and redirect some OpenGL calls. Applications which access these functions without going though SDL (even if via a library) may not successfully render anything, or may render incorrectly if OpenGL scaling is enabled. In these cases, you can disable OpenGL scaling by setting the environment variable: ``` SDL12COMPAT_OPENGL_SCALING=0 ``` # Compatibility issues with applications directly accessing underlying APIs Some applications combine the use of SDL with direct access to the underlying OS or window system. When running these applications on the same OS and SDL video driver (e.g. a program written for X11 on Linux is run on X11 on Linux), sdl12-compat is usually compatible. However, if you wish to run an application on a different video driver, the application will be unable to access the underlying API it is expecting, and may fail. This often occurs trying to run applications written for X11 under Wayland, and particularly affects a number of popular OpenGL extension loaders. In this case, the best workaround is to run under a compatibility layer like XWayland, and set the SDL_VIDEODRIVER environment variable to the driver the program is expecting: ``` SDL_VIDEODRIVER=x11 ``` sdl12-compat-1.2.74/build-scripts/build-release.py0000775000000000000000000023661715077717063016655 0ustar00#!/usr/bin/env python3 """ This script is shared between SDL2, SDL3, and all satellite libraries. Don't specialize this script for doing project-specific modifications. Rather, modify release-info.json. """ import argparse import collections import dataclasses from collections.abc import Callable import contextlib import datetime import fnmatch import glob import io import json import logging import multiprocessing import os from pathlib import Path import platform import re import shlex import shutil import subprocess import sys import tarfile import tempfile import textwrap import typing import zipfile logger = logging.getLogger(__name__) GIT_HASH_FILENAME = ".git-hash" REVISION_TXT = "REVISION.txt" RE_ILLEGAL_MINGW_LIBRARIES = re.compile(r"(?:lib)?(?:gcc|(?:std)?c[+][+]|(?:win)?pthread).*", flags=re.I) def safe_isotime_to_datetime(str_isotime: str) -> datetime.datetime: try: return datetime.datetime.fromisoformat(str_isotime) except ValueError: pass logger.warning("Invalid iso time: %s", str_isotime) if str_isotime[-6:-5] in ("+", "-"): # Commits can have isotime with invalid timezone offset (e.g. "2021-07-04T20:01:40+32:00") modified_str_isotime = str_isotime[:-6] + "+00:00" try: return datetime.datetime.fromisoformat(modified_str_isotime) except ValueError: pass raise ValueError(f"Invalid isotime: {str_isotime}") def arc_join(*parts: list[str]) -> str: assert all(p[:1] != "/" and p[-1:] != "/" for p in parts), f"None of {parts} may start or end with '/'" return "/".join(p for p in parts if p) @dataclasses.dataclass(frozen=True) class VsArchPlatformConfig: arch: str configuration: str platform: str def extra_context(self): return { "ARCH": self.arch, "CONFIGURATION": self.configuration, "PLATFORM": self.platform, } @contextlib.contextmanager def chdir(path): original_cwd = os.getcwd() try: os.chdir(path) yield finally: os.chdir(original_cwd) class Executer: def __init__(self, root: Path, dry: bool=False): self.root = root self.dry = dry def run(self, cmd, cwd=None, env=None): logger.info("Executing args=%r", cmd) sys.stdout.flush() if not self.dry: subprocess.check_call(cmd, cwd=cwd or self.root, env=env, text=True) def check_output(self, cmd, cwd=None, dry_out=None, env=None, text=True): logger.info("Executing args=%r", cmd) sys.stdout.flush() if self.dry: return dry_out return subprocess.check_output(cmd, cwd=cwd or self.root, env=env, text=text) class SectionPrinter: @contextlib.contextmanager def group(self, title: str): print(f"{title}:") yield class GitHubSectionPrinter(SectionPrinter): def __init__(self): super().__init__() self.in_group = False @contextlib.contextmanager def group(self, title: str): print(f"::group::{title}") assert not self.in_group, "Can enter a group only once" self.in_group = True yield self.in_group = False print("::endgroup::") class VisualStudio: def __init__(self, executer: Executer, year: typing.Optional[str]=None): self.executer = executer self.vsdevcmd = self.find_vsdevcmd(year) self.msbuild = self.find_msbuild() @property def dry(self) -> bool: return self.executer.dry VS_YEAR_TO_VERSION = { "2022": 17, "2019": 16, "2017": 15, "2015": 14, "2013": 12, } def find_vsdevcmd(self, year: typing.Optional[str]=None) -> typing.Optional[Path]: vswhere_spec = ["-latest"] if year is not None: try: version = self.VS_YEAR_TO_VERSION[year] except KeyError: logger.error("Invalid Visual Studio year") return None vswhere_spec.extend(["-version", f"[{version},{version+1})"]) vswhere_cmd = ["vswhere"] + vswhere_spec + ["-property", "installationPath"] vs_install_path = Path(self.executer.check_output(vswhere_cmd, dry_out="/tmp").strip()) logger.info("VS install_path = %s", vs_install_path) assert vs_install_path.is_dir(), "VS installation path does not exist" vsdevcmd_path = vs_install_path / "Common7/Tools/vsdevcmd.bat" logger.info("vsdevcmd path = %s", vsdevcmd_path) if self.dry: vsdevcmd_path.parent.mkdir(parents=True, exist_ok=True) vsdevcmd_path.touch(exist_ok=True) assert vsdevcmd_path.is_file(), "vsdevcmd.bat batch file does not exist" return vsdevcmd_path def find_msbuild(self) -> typing.Optional[Path]: vswhere_cmd = ["vswhere", "-latest", "-requires", "Microsoft.Component.MSBuild", "-find", r"MSBuild\**\Bin\MSBuild.exe"] msbuild_path = Path(self.executer.check_output(vswhere_cmd, dry_out="/tmp/MSBuild.exe").strip()) logger.info("MSBuild path = %s", msbuild_path) if self.dry: msbuild_path.parent.mkdir(parents=True, exist_ok=True) msbuild_path.touch(exist_ok=True) assert msbuild_path.is_file(), "MSBuild.exe does not exist" return msbuild_path def build(self, arch_platform: VsArchPlatformConfig, projects: list[Path]): assert projects, "Need at least one project to build" vsdev_cmd_str = f"\"{self.vsdevcmd}\" -arch={arch_platform.arch}" msbuild_cmd_str = " && ".join([f"\"{self.msbuild}\" \"{project}\" /m /p:BuildInParallel=true /p:Platform={arch_platform.platform} /p:Configuration={arch_platform.configuration}" for project in projects]) bat_contents = f"{vsdev_cmd_str} && {msbuild_cmd_str}\n" bat_path = Path(tempfile.gettempdir()) / "cmd.bat" with bat_path.open("w") as f: f.write(bat_contents) logger.info("Running cmd.exe script (%s): %s", bat_path, bat_contents) cmd = ["cmd.exe", "/D", "/E:ON", "/V:OFF", "/S", "/C", f"CALL {str(bat_path)}"] self.executer.run(cmd) class Archiver: def __init__(self, zip_path: typing.Optional[Path]=None, tgz_path: typing.Optional[Path]=None, txz_path: typing.Optional[Path]=None): self._zip_files = [] self._tar_files = [] self._added_files = set() if zip_path: self._zip_files.append(zipfile.ZipFile(zip_path, "w", compression=zipfile.ZIP_DEFLATED)) if tgz_path: self._tar_files.append(tarfile.open(tgz_path, "w:gz")) if txz_path: self._tar_files.append(tarfile.open(txz_path, "w:xz")) @property def added_files(self) -> set[str]: return self._added_files def add_file_data(self, arcpath: str, data: bytes, mode: int, time: datetime.datetime): for zf in self._zip_files: file_data_time = (time.year, time.month, time.day, time.hour, time.minute, time.second) zip_info = zipfile.ZipInfo(filename=arcpath, date_time=file_data_time) zip_info.external_attr = mode << 16 zip_info.compress_type = zipfile.ZIP_DEFLATED zf.writestr(zip_info, data=data) for tf in self._tar_files: tar_info = tarfile.TarInfo(arcpath) tar_info.type = tarfile.REGTYPE tar_info.mode = mode tar_info.size = len(data) tar_info.mtime = int(time.timestamp()) tf.addfile(tar_info, fileobj=io.BytesIO(data)) self._added_files.add(arcpath) def add_symlink(self, arcpath: str, target: str, time: datetime.datetime, files_for_zip): logger.debug("Adding symlink (target=%r) -> %s", target, arcpath) for zf in self._zip_files: file_data_time = (time.year, time.month, time.day, time.hour, time.minute, time.second) for f in files_for_zip: zip_info = zipfile.ZipInfo(filename=f["arcpath"], date_time=file_data_time) zip_info.external_attr = f["mode"] << 16 zip_info.compress_type = zipfile.ZIP_DEFLATED zf.writestr(zip_info, data=f["data"]) for tf in self._tar_files: tar_info = tarfile.TarInfo(arcpath) tar_info.type = tarfile.SYMTYPE tar_info.mode = 0o777 tar_info.mtime = int(time.timestamp()) tar_info.linkname = target tf.addfile(tar_info) self._added_files.update(f["arcpath"] for f in files_for_zip) def add_git_hash(self, arcdir: str, commit: str, time: datetime.datetime): arcpath = arc_join(arcdir, GIT_HASH_FILENAME) data = f"{commit}\n".encode() self.add_file_data(arcpath=arcpath, data=data, mode=0o100644, time=time) def add_file_path(self, arcpath: str, path: Path): assert path.is_file(), f"{path} should be a file" logger.debug("Adding %s -> %s", path, arcpath) for zf in self._zip_files: zf.write(path, arcname=arcpath) for tf in self._tar_files: tf.add(path, arcname=arcpath) def add_file_directory(self, arcdirpath: str, dirpath: Path): assert dirpath.is_dir() if arcdirpath and arcdirpath[-1:] != "/": arcdirpath += "/" for f in dirpath.iterdir(): if f.is_file(): arcpath = f"{arcdirpath}{f.name}" logger.debug("Adding %s to %s", f, arcpath) self.add_file_path(arcpath=arcpath, path=f) def close(self): # Archiver is intentionally made invalid after this function del self._zip_files self._zip_files = None del self._tar_files self._tar_files = None def __enter__(self): return self def __exit__(self, type, value, traceback): self.close() class NodeInArchive: def __init__(self, arcpath: str, path: typing.Optional[Path]=None, data: typing.Optional[bytes]=None, mode: typing.Optional[int]=None, symtarget: typing.Optional[str]=None, time: typing.Optional[datetime.datetime]=None, directory: bool=False): self.arcpath = arcpath self.path = path self.data = data self.mode = mode self.symtarget = symtarget self.time = time self.directory = directory @classmethod def from_fs(cls, arcpath: str, path: Path, mode: int=0o100644, time: typing.Optional[datetime.datetime]=None) -> "NodeInArchive": if time is None: time = datetime.datetime.fromtimestamp(os.stat(path).st_mtime) return cls(arcpath=arcpath, path=path, mode=mode) @classmethod def from_data(cls, arcpath: str, data: bytes, time: datetime.datetime) -> "NodeInArchive": return cls(arcpath=arcpath, data=data, time=time, mode=0o100644) @classmethod def from_text(cls, arcpath: str, text: str, time: datetime.datetime) -> "NodeInArchive": return cls.from_data(arcpath=arcpath, data=text.encode(), time=time) @classmethod def from_symlink(cls, arcpath: str, symtarget: str) -> "NodeInArchive": return cls(arcpath=arcpath, symtarget=symtarget) @classmethod def from_directory(cls, arcpath: str) -> "NodeInArchive": return cls(arcpath=arcpath, directory=True) def __repr__(self) -> str: return f"<{type(self).__name__}:arcpath={self.arcpath},path='{str(self.path)}',len(data)={len(self.data) if self.data else 'n/a'},directory={self.directory},symtarget={self.symtarget}>" def configure_file(path: Path, context: dict[str, str]) -> bytes: text = path.read_text() return configure_text(text, context=context).encode() def configure_text(text: str, context: dict[str, str]) -> str: original_text = text for txt, repl in context.items(): text = text.replace(f"@<@{txt}@>@", repl) success = all(thing not in text for thing in ("@<@", "@>@")) if not success: raise ValueError(f"Failed to configure {repr(original_text)}") return text def configure_text_list(text_list: list[str], context: dict[str, str]) -> list[str]: return [configure_text(text=e, context=context) for e in text_list] class ArchiveFileTree: def __init__(self): self._tree: dict[str, NodeInArchive] = {} def add_file(self, file: NodeInArchive): self._tree[file.arcpath] = file def __iter__(self) -> typing.Iterable[NodeInArchive]: yield from self._tree.values() def __contains__(self, value: str) -> bool: return value in self._tree def get_latest_mod_time(self) -> datetime.datetime: return max(item.time for item in self._tree.values() if item.time) def add_to_archiver(self, archive_base: str, archiver: Archiver): remaining_symlinks = set() added_files = dict() def calculate_symlink_target(s: NodeInArchive) -> str: dest_dir = os.path.dirname(s.arcpath) if dest_dir: dest_dir += "/" target = dest_dir + s.symtarget while True: new_target, n = re.subn(r"([^/]+/+[.]{2}/)", "", target) target = new_target if not n: break return target # Add files in first pass for arcpath, node in self._tree.items(): assert node is not None, f"{arcpath} -> node" if node.data is not None: archiver.add_file_data(arcpath=arc_join(archive_base, arcpath), data=node.data, time=node.time, mode=node.mode) assert node.arcpath is not None, f"{node=}" added_files[node.arcpath] = node elif node.path is not None: archiver.add_file_path(arcpath=arc_join(archive_base, arcpath), path=node.path) assert node.arcpath is not None, f"{node=}" added_files[node.arcpath] = node elif node.symtarget is not None: remaining_symlinks.add(node) elif node.directory: pass else: raise ValueError(f"Invalid Archive Node: {repr(node)}") assert None not in added_files # Resolve symlinks in second pass: zipfile does not support symlinks, so add files to zip archive while True: if not remaining_symlinks: break symlinks_this_time = set() extra_added_files = {} for symlink in remaining_symlinks: symlink_files_for_zip = {} symlink_target_path = calculate_symlink_target(symlink) if symlink_target_path in added_files: symlink_files_for_zip[symlink.arcpath] = added_files[symlink_target_path] else: symlink_target_path_slash = symlink_target_path + "/" for added_file in added_files: if added_file.startswith(symlink_target_path_slash): path_in_symlink = symlink.arcpath + "/" + added_file.removeprefix(symlink_target_path_slash) symlink_files_for_zip[path_in_symlink] = added_files[added_file] if symlink_files_for_zip: symlinks_this_time.add(symlink) extra_added_files.update(symlink_files_for_zip) files_for_zip = [{"arcpath": f"{archive_base}/{sym_path}", "data": sym_info.data, "mode": sym_info.mode} for sym_path, sym_info in symlink_files_for_zip.items()] archiver.add_symlink(arcpath=f"{archive_base}/{symlink.arcpath}", target=symlink.symtarget, time=symlink.time, files_for_zip=files_for_zip) # if not symlinks_this_time: # logger.info("files added: %r", set(path for path in added_files.keys())) assert symlinks_this_time, f"No targets found for symlinks: {remaining_symlinks}" remaining_symlinks.difference_update(symlinks_this_time) added_files.update(extra_added_files) def add_directory_tree(self, arc_dir: str, path: Path, time: datetime.datetime): assert path.is_dir() for files_dir, _, filenames in os.walk(path): files_dir_path = Path(files_dir) rel_files_path = files_dir_path.relative_to(path) for filename in filenames: self.add_file(NodeInArchive.from_fs(arcpath=arc_join(arc_dir, str(rel_files_path), filename), path=files_dir_path / filename, time=time)) def _add_files_recursively(self, arc_dir: str, paths: list[Path], time: datetime.datetime): logger.debug(f"_add_files_recursively({arc_dir=} {paths=})") for path in paths: arcpath = arc_join(arc_dir, path.name) if path.is_file(): logger.debug("Adding %s as %s", path, arcpath) self.add_file(NodeInArchive.from_fs(arcpath=arcpath, path=path, time=time)) elif path.is_dir(): self._add_files_recursively(arc_dir=arc_join(arc_dir, path.name), paths=list(path.iterdir()), time=time) else: raise ValueError(f"Unsupported file type to add recursively: {path}") def add_file_mapping(self, arc_dir: str, file_mapping: dict[str, list[str]], file_mapping_root: Path, context: dict[str, str], time: datetime.datetime): for meta_rel_destdir, meta_file_globs in file_mapping.items(): rel_destdir = configure_text(meta_rel_destdir, context=context) assert "@" not in rel_destdir, f"archive destination should not contain an @ after configuration ({repr(meta_rel_destdir)}->{repr(rel_destdir)})" for meta_file_glob in meta_file_globs: file_glob = configure_text(meta_file_glob, context=context) assert "@" not in rel_destdir, f"archive glob should not contain an @ after configuration ({repr(meta_file_glob)}->{repr(file_glob)})" if ":" in file_glob: original_path, new_filename = file_glob.rsplit(":", 1) assert ":" not in original_path, f"Too many ':' in {repr(file_glob)}" assert "/" not in new_filename, f"New filename cannot contain a '/' in {repr(file_glob)}" path = file_mapping_root / original_path arcpath = arc_join(arc_dir, rel_destdir, new_filename) if path.suffix == ".in": data = configure_file(path, context=context) logger.debug("Adding processed %s -> %s", path, arcpath) self.add_file(NodeInArchive.from_data(arcpath=arcpath, data=data, time=time)) else: logger.debug("Adding %s -> %s", path, arcpath) self.add_file(NodeInArchive.from_fs(arcpath=arcpath, path=path, time=time)) else: relative_file_paths = glob.glob(file_glob, root_dir=file_mapping_root) assert relative_file_paths, f"Glob '{file_glob}' does not match any file" self._add_files_recursively(arc_dir=arc_join(arc_dir, rel_destdir), paths=[file_mapping_root / p for p in relative_file_paths], time=time) class SourceCollector: # TreeItem = collections.namedtuple("TreeItem", ("path", "mode", "data", "symtarget", "directory", "time")) def __init__(self, root: Path, commit: str, filter: typing.Optional[Callable[[str], bool]], executer: Executer): self.root = root self.commit = commit self.filter = filter self.executer = executer def get_archive_file_tree(self) -> ArchiveFileTree: git_archive_args = ["git", "archive", "--format=tar.gz", self.commit, "-o", "/dev/stdout"] logger.info("Executing args=%r", git_archive_args) contents_tgz = subprocess.check_output(git_archive_args, cwd=self.root, text=False) tar_archive = tarfile.open(fileobj=io.BytesIO(contents_tgz), mode="r:gz") filenames = tuple(m.name for m in tar_archive if (m.isfile() or m.issym())) file_times = self._get_file_times(paths=filenames) git_contents = ArchiveFileTree() for ti in tar_archive: if self.filter and not self.filter(ti.name): continue data = None symtarget = None directory = False file_time = None if ti.isfile(): contents_file = tar_archive.extractfile(ti.name) data = contents_file.read() file_time = file_times[ti.name] elif ti.issym(): symtarget = ti.linkname file_time = file_times[ti.name] elif ti.isdir(): directory = True else: raise ValueError(f"{ti.name}: unknown type") node = NodeInArchive(arcpath=ti.name, data=data, mode=ti.mode, symtarget=symtarget, time=file_time, directory=directory) git_contents.add_file(node) return git_contents def _get_file_times(self, paths: tuple[str, ...]) -> dict[str, datetime.datetime]: dry_out = textwrap.dedent("""\ time=2024-03-14T15:40:25-07:00 M\tCMakeLists.txt """) git_log_out = self.executer.check_output(["git", "log", "--name-status", '--pretty=time=%cI', self.commit], dry_out=dry_out, cwd=self.root).splitlines(keepends=False) current_time = None set_paths = set(paths) path_times: dict[str, datetime.datetime] = {} for line in git_log_out: if not line: continue if line.startswith("time="): current_time = safe_isotime_to_datetime(line.removeprefix("time=")) continue mod_type, file_paths = line.split(maxsplit=1) assert current_time is not None for file_path in file_paths.split("\t"): if file_path in set_paths and file_path not in path_times: path_times[file_path] = current_time # FIXME: find out why some files are not shown in "git log" # assert set(path_times.keys()) == set_paths if set(path_times.keys()) != set_paths: found_times = set(path_times.keys()) paths_without_times = set_paths.difference(found_times) logger.warning("No times found for these paths: %s", paths_without_times) max_time = max(time for time in path_times.values()) for path in paths_without_times: path_times[path] = max_time return path_times class AndroidApiVersion: def __init__(self, name: str, ints: tuple[int, ...]): self.name = name self.ints = ints def __repr__(self) -> str: return f"<{self.name} ({'.'.join(str(v) for v in self.ints)})>" ANDROID_ABI_EXTRA_LINK_OPTIONS = {} class Releaser: def __init__(self, release_info: dict, commit: str, revision: str, root: Path, dist_path: Path, section_printer: SectionPrinter, executer: Executer, cmake_generator: str, deps_path: Path, overwrite: bool, github: bool, fast: bool): self.release_info = release_info self.project = release_info["name"] self.version = self.extract_sdl_version(root=root, release_info=release_info) self.root = root self.commit = commit self.revision = revision self.dist_path = dist_path self.section_printer = section_printer self.executer = executer self.cmake_generator = cmake_generator self.cpu_count = multiprocessing.cpu_count() self.deps_path = deps_path self.overwrite = overwrite self.github = github self.fast = fast self.arc_time = datetime.datetime.now() self.artifacts: dict[str, Path] = {} def get_context(self, extra_context: typing.Optional[dict[str, str]]=None) -> dict[str, str]: ctx = { "PROJECT_NAME": self.project, "PROJECT_VERSION": self.version, "PROJECT_COMMIT": self.commit, "PROJECT_REVISION": self.revision, "PROJECT_ROOT": str(self.root), } if extra_context: ctx.update(extra_context) return ctx @property def dry(self) -> bool: return self.executer.dry def prepare(self): logger.debug("Creating dist folder") self.dist_path.mkdir(parents=True, exist_ok=True) @classmethod def _path_filter(cls, path: str) -> bool: if ".gitmodules" in path: return True if path.startswith(".git"): return False return True @classmethod def _external_repo_path_filter(cls, path: str) -> bool: if not cls._path_filter(path): return False if path.startswith("test/") or path.startswith("tests/"): return False return True def create_source_archives(self) -> None: source_collector = SourceCollector(root=self.root, commit=self.commit, executer=self.executer, filter=self._path_filter) print(f"Collecting sources of {self.project}...") archive_tree: ArchiveFileTree = source_collector.get_archive_file_tree() latest_mod_time = archive_tree.get_latest_mod_time() archive_tree.add_file(NodeInArchive.from_text(arcpath=REVISION_TXT, text=f"{self.revision}\n", time=latest_mod_time)) archive_tree.add_file(NodeInArchive.from_text(arcpath=f"{GIT_HASH_FILENAME}", text=f"{self.commit}\n", time=latest_mod_time)) archive_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["source"].get("files", {}), file_mapping_root=self.root, context=self.get_context(), time=latest_mod_time) if "Makefile.am" in archive_tree: patched_time = latest_mod_time + datetime.timedelta(minutes=1) print(f"Makefile.am detected -> touching aclocal.m4, */Makefile.in, configure") for node_data in archive_tree: arc_name = os.path.basename(node_data.arcpath) arc_name_we, arc_name_ext = os.path.splitext(arc_name) if arc_name in ("aclocal.m4", "configure", "Makefile.in"): print(f"Bumping time of {node_data.arcpath}") node_data.time = patched_time archive_base = f"{self.project}-{self.version}" zip_path = self.dist_path / f"{archive_base}.zip" tgz_path = self.dist_path / f"{archive_base}.tar.gz" txz_path = self.dist_path / f"{archive_base}.tar.xz" logger.info("Creating zip/tgz/txz source archives ...") if self.dry: zip_path.touch() tgz_path.touch() txz_path.touch() else: with Archiver(zip_path=zip_path, tgz_path=tgz_path, txz_path=txz_path) as archiver: print(f"Adding source files of {self.project}...") archive_tree.add_to_archiver(archive_base=archive_base, archiver=archiver) for extra_repo in self.release_info["source"].get("extra-repos", []): extra_repo_root = self.root / extra_repo assert (extra_repo_root / ".git").exists(), f"{extra_repo_root} must be a git repo" extra_repo_commit = self.executer.check_output(["git", "rev-parse", "HEAD"], dry_out=f"gitsha-extra-repo-{extra_repo}", cwd=extra_repo_root).strip() extra_repo_source_collector = SourceCollector(root=extra_repo_root, commit=extra_repo_commit, executer=self.executer, filter=self._external_repo_path_filter) print(f"Collecting sources of {extra_repo} ...") extra_repo_archive_tree = extra_repo_source_collector.get_archive_file_tree() print(f"Adding source files of {extra_repo} ...") extra_repo_archive_tree.add_to_archiver(archive_base=f"{archive_base}/{extra_repo}", archiver=archiver) for file in self.release_info["source"]["checks"]: assert f"{archive_base}/{file}" in archiver.added_files, f"'{archive_base}/{file}' must exist" logger.info("... done") self.artifacts["src-zip"] = zip_path self.artifacts["src-tar-gz"] = tgz_path self.artifacts["src-tar-xz"] = txz_path if not self.dry: with tgz_path.open("r+b") as f: # Zero the embedded timestamp in the gzip'ed tarball f.seek(4, 0) f.write(b"\x00\x00\x00\x00") def create_dmg(self, configuration: str="Release") -> None: dmg_in = self.root / self.release_info["dmg"]["path"] xcode_project = self.root / self.release_info["dmg"]["project"] assert xcode_project.is_dir(), f"{xcode_project} must be a directory" assert (xcode_project / "project.pbxproj").is_file, f"{xcode_project} must contain project.pbxproj" if not self.fast: dmg_in.unlink(missing_ok=True) build_xcconfig = self.release_info["dmg"].get("build-xcconfig") if build_xcconfig: shutil.copy(self.root / build_xcconfig, xcode_project.parent / "build.xcconfig") xcode_scheme = self.release_info["dmg"].get("scheme") xcode_target = self.release_info["dmg"].get("target") assert xcode_scheme or xcode_target, "dmg needs scheme or target" assert not (xcode_scheme and xcode_target), "dmg cannot have both scheme and target set" if xcode_scheme: scheme_or_target = "-scheme" target_like = xcode_scheme else: scheme_or_target = "-target" target_like = xcode_target self.executer.run(["xcodebuild", "ONLY_ACTIVE_ARCH=NO", "-project", xcode_project, scheme_or_target, target_like, "-configuration", configuration]) if self.dry: dmg_in.parent.mkdir(parents=True, exist_ok=True) dmg_in.touch() assert dmg_in.is_file(), f"{self.project}.dmg was not created by xcodebuild" dmg_out = self.dist_path / f"{self.project}-{self.version}.dmg" shutil.copy(dmg_in, dmg_out) self.artifacts["dmg"] = dmg_out @property def git_hash_data(self) -> bytes: return f"{self.commit}\n".encode() def verify_mingw_library(self, triplet: str, path: Path): objdump_output = self.executer.check_output([f"{triplet}-objdump", "-p", str(path)]) libraries = re.findall(r"DLL Name: ([^\n]+)", objdump_output) logger.info("%s (%s) libraries: %r", path, triplet, libraries) illegal_libraries = list(filter(RE_ILLEGAL_MINGW_LIBRARIES.match, libraries)) logger.error("Detected 'illegal' libraries: %r", illegal_libraries) if illegal_libraries: raise Exception(f"{path} links to illegal libraries: {illegal_libraries}") def create_mingw_archives(self) -> None: build_type = "Release" build_parent_dir = self.root / "build-mingw" ARCH_TO_GNU_ARCH = { # "arm64": "aarch64", "x86": "i686", "x64": "x86_64", } ARCH_TO_TRIPLET = { # "arm64": "aarch64-w64-mingw32", "x86": "i686-w64-mingw32", "x64": "x86_64-w64-mingw32", } new_env = dict(os.environ) cmake_prefix_paths = [] mingw_deps_path = self.deps_path / "mingw-deps" if "dependencies" in self.release_info["mingw"]: shutil.rmtree(mingw_deps_path, ignore_errors=True) mingw_deps_path.mkdir() for triplet in ARCH_TO_TRIPLET.values(): (mingw_deps_path / triplet).mkdir() def extract_filter(member: tarfile.TarInfo, path: str, /): if member.name.startswith("SDL"): member.name = "/".join(Path(member.name).parts[1:]) return member for dep in self.release_info.get("dependencies", {}): extract_path = mingw_deps_path / f"extract-{dep}" extract_path.mkdir() with chdir(extract_path): tar_path = self.deps_path / glob.glob(self.release_info["mingw"]["dependencies"][dep]["artifact"], root_dir=self.deps_path)[0] logger.info("Extracting %s to %s", tar_path, mingw_deps_path) assert tar_path.suffix in (".gz", ".xz") with tarfile.open(tar_path, mode=f"r:{tar_path.suffix.strip('.')}") as tarf: tarf.extractall(filter=extract_filter) for arch, triplet in ARCH_TO_TRIPLET.items(): install_cmd = self.release_info["mingw"]["dependencies"][dep]["install-command"] extra_configure_data = { "ARCH": ARCH_TO_GNU_ARCH[arch], "TRIPLET": triplet, "PREFIX": str(mingw_deps_path / triplet), } install_cmd = configure_text(install_cmd, context=self.get_context(extra_configure_data)) self.executer.run(shlex.split(install_cmd), cwd=str(extract_path)) dep_binpath = mingw_deps_path / triplet / "bin" assert dep_binpath.is_dir(), f"{dep_binpath} for PATH should exist" dep_pkgconfig = mingw_deps_path / triplet / "lib/pkgconfig" assert dep_pkgconfig.is_dir(), f"{dep_pkgconfig} for PKG_CONFIG_PATH should exist" new_env["PATH"] = os.pathsep.join([str(dep_binpath), new_env["PATH"]]) new_env["PKG_CONFIG_PATH"] = str(dep_pkgconfig) cmake_prefix_paths.append(mingw_deps_path) new_env["CFLAGS"] = f"-O2 -ffile-prefix-map={self.root}=/src/{self.project}" new_env["CXXFLAGS"] = f"-O2 -ffile-prefix-map={self.root}=/src/{self.project}" assert any(system in self.release_info["mingw"] for system in ("autotools", "cmake")) assert not all(system in self.release_info["mingw"] for system in ("autotools", "cmake")) mingw_archs = set() arc_root = f"{self.project}-{self.version}" archive_file_tree = ArchiveFileTree() if "autotools" in self.release_info["mingw"]: for arch in self.release_info["mingw"]["autotools"]["archs"]: triplet = ARCH_TO_TRIPLET[arch] new_env["CC"] = f"{triplet}-gcc" new_env["CXX"] = f"{triplet}-g++" new_env["RC"] = f"{triplet}-windres" assert arch not in mingw_archs mingw_archs.add(arch) build_path = build_parent_dir / f"build-{triplet}" install_path = build_parent_dir / f"install-{triplet}" shutil.rmtree(install_path, ignore_errors=True) build_path.mkdir(parents=True, exist_ok=True) context = self.get_context({ "ARCH": arch, "DEP_PREFIX": str(mingw_deps_path / triplet), }) extra_args = configure_text_list(text_list=self.release_info["mingw"]["autotools"]["args"], context=context) with self.section_printer.group(f"Configuring MinGW {triplet} (autotools)"): assert "@" not in " ".join(extra_args), f"@ should not be present in extra arguments ({extra_args})" self.executer.run([ self.root / "configure", f"--prefix={install_path}", f"--includedir=${{prefix}}/include", f"--libdir=${{prefix}}/lib", f"--bindir=${{prefix}}/bin", f"--host={triplet}", f"--build=x86_64-none-linux-gnu", "CFLAGS=-O2", "CXXFLAGS=-O2", "LDFLAGS=-Wl,-s", ] + extra_args, cwd=build_path, env=new_env) with self.section_printer.group(f"Build MinGW {triplet} (autotools)"): self.executer.run(["make", f"-j{self.cpu_count}"], cwd=build_path, env=new_env) with self.section_printer.group(f"Install MinGW {triplet} (autotools)"): self.executer.run(["make", "install"], cwd=build_path, env=new_env) self.verify_mingw_library(triplet=ARCH_TO_TRIPLET[arch], path=install_path / "bin" / f"{self.project}.dll") archive_file_tree.add_directory_tree(arc_dir=arc_join(arc_root, triplet), path=install_path, time=self.arc_time) print("Recording arch-dependent extra files for MinGW development archive ...") extra_context = { "TRIPLET": ARCH_TO_TRIPLET[arch], } archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["mingw"]["autotools"].get("files", {}), file_mapping_root=self.root, context=self.get_context(extra_context=extra_context), time=self.arc_time) if "cmake" in self.release_info["mingw"]: assert self.release_info["mingw"]["cmake"]["shared-static"] in ("args", "both") for arch in self.release_info["mingw"]["cmake"]["archs"]: triplet = ARCH_TO_TRIPLET[arch] new_env["CC"] = f"{triplet}-gcc" new_env["CXX"] = f"{triplet}-g++" new_env["RC"] = f"{triplet}-windres" assert arch not in mingw_archs mingw_archs.add(arch) context = self.get_context({ "ARCH": arch, "DEP_PREFIX": str(mingw_deps_path / triplet), }) extra_args = configure_text_list(text_list=self.release_info["mingw"]["cmake"]["args"], context=context) build_path = build_parent_dir / f"build-{triplet}" install_path = build_parent_dir / f"install-{triplet}" shutil.rmtree(install_path, ignore_errors=True) build_path.mkdir(parents=True, exist_ok=True) if self.release_info["mingw"]["cmake"]["shared-static"] == "args": args_for_shared_static = ([], ) elif self.release_info["mingw"]["cmake"]["shared-static"] == "both": args_for_shared_static = (["-DBUILD_SHARED_LIBS=ON"], ["-DBUILD_SHARED_LIBS=OFF"]) for arg_for_shared_static in args_for_shared_static: with self.section_printer.group(f"Configuring MinGW {triplet} (CMake)"): assert "@" not in " ".join(extra_args), f"@ should not be present in extra arguments ({extra_args})" self.executer.run([ f"cmake", f"-S", str(self.root), "-B", str(build_path), f"-DCMAKE_BUILD_TYPE={build_type}", f'''-DCMAKE_C_FLAGS="-ffile-prefix-map={self.root}=/src/{self.project}"''', f'''-DCMAKE_CXX_FLAGS="-ffile-prefix-map={self.root}=/src/{self.project}"''', f"-DCMAKE_PREFIX_PATH={mingw_deps_path / triplet}", f"-DCMAKE_INSTALL_PREFIX={install_path}", f"-DCMAKE_INSTALL_INCLUDEDIR=include", f"-DCMAKE_INSTALL_LIBDIR=lib", f"-DCMAKE_INSTALL_BINDIR=bin", f"-DCMAKE_INSTALL_DATAROOTDIR=share", f"-DCMAKE_TOOLCHAIN_FILE={self.root}/build-scripts/cmake-toolchain-mingw64-{ARCH_TO_GNU_ARCH[arch]}.cmake", f"-G{self.cmake_generator}", ] + extra_args + ([] if self.fast else ["--fresh"]) + arg_for_shared_static, cwd=build_path, env=new_env) with self.section_printer.group(f"Build MinGW {triplet} (CMake)"): self.executer.run(["cmake", "--build", str(build_path), "--verbose", "--config", build_type], cwd=build_path, env=new_env) with self.section_printer.group(f"Install MinGW {triplet} (CMake)"): self.executer.run(["cmake", "--install", str(build_path)], cwd=build_path, env=new_env) self.verify_mingw_library(triplet=ARCH_TO_TRIPLET[arch], path=install_path / "bin" / f"{self.project}.dll") archive_file_tree.add_directory_tree(arc_dir=arc_join(arc_root, triplet), path=install_path, time=self.arc_time) print("Recording arch-dependent extra files for MinGW development archive ...") extra_context = { "TRIPLET": ARCH_TO_TRIPLET[arch], } archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["mingw"]["cmake"].get("files", {}), file_mapping_root=self.root, context=self.get_context(extra_context=extra_context), time=self.arc_time) print("... done") print("Recording extra files for MinGW development archive ...") archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["mingw"].get("files", {}), file_mapping_root=self.root, context=self.get_context(), time=self.arc_time) print("... done") print("Creating zip/tgz/txz development archives ...") zip_path = self.dist_path / f"{self.project}-devel-{self.version}-mingw.zip" tgz_path = self.dist_path / f"{self.project}-devel-{self.version}-mingw.tar.gz" txz_path = self.dist_path / f"{self.project}-devel-{self.version}-mingw.tar.xz" with Archiver(zip_path=zip_path, tgz_path=tgz_path, txz_path=txz_path) as archiver: archive_file_tree.add_to_archiver(archive_base="", archiver=archiver) archiver.add_git_hash(arcdir=arc_root, commit=self.commit, time=self.arc_time) print("... done") self.artifacts["mingw-devel-zip"] = zip_path self.artifacts["mingw-devel-tar-gz"] = tgz_path self.artifacts["mingw-devel-tar-xz"] = txz_path def _detect_android_api(self, android_home: str) -> typing.Optional[AndroidApiVersion]: platform_dirs = list(Path(p) for p in glob.glob(f"{android_home}/platforms/android-*")) re_platform = re.compile("^android-([0-9]+)(?:-ext([0-9]+))?$") platform_versions: list[AndroidApiVersion] = [] for platform_dir in platform_dirs: logger.debug("Found Android Platform SDK: %s", platform_dir) if not (platform_dir / "android.jar").is_file(): logger.debug("Skipping SDK, missing android.jar") continue if m:= re_platform.match(platform_dir.name): platform_versions.append(AndroidApiVersion(name=platform_dir.name, ints=(int(m.group(1)), int(m.group(2) or 0)))) platform_versions.sort(key=lambda v: v.ints) logger.info("Available platform versions: %s", platform_versions) platform_versions = list(filter(lambda v: v.ints >= self._android_api_minimum.ints, platform_versions)) logger.info("Valid platform versions (>=%s): %s", self._android_api_minimum.ints, platform_versions) if not platform_versions: return None android_api = platform_versions[0] logger.info("Selected API version %s", android_api) return android_api def _get_prefab_json_text(self) -> str: return textwrap.dedent(f"""\ {{ "schema_version": 2, "name": "{self.project}", "version": "{self.version}", "dependencies": [] }} """) def _get_prefab_module_json_text(self, library_name: typing.Optional[str], export_libraries: list[str]) -> str: for lib in export_libraries: assert isinstance(lib, str), f"{lib} must be a string" module_json_dict = { "export_libraries": export_libraries, } if library_name: module_json_dict["library_name"] = f"lib{library_name}" return json.dumps(module_json_dict, indent=4) @property def _android_api_minimum(self) -> AndroidApiVersion: value = self.release_info["android"]["api-minimum"] if isinstance(value, int): ints = (value, ) elif isinstance(value, str): ints = tuple(split(".")) else: raise ValueError("Invalid android.api-minimum: must be X or X.Y") match len(ints): case 1: name = f"android-{ints[0]}" case 2: name = f"android-{ints[0]}-ext-{ints[1]}" case _: raise ValueError("Invalid android.api-minimum: must be X or X.Y") return AndroidApiVersion(name=name, ints=ints) @property def _android_api_target(self): return self.release_info["android"]["api-target"] @property def _android_ndk_minimum(self): return self.release_info["android"]["ndk-minimum"] def _get_prefab_abi_json_text(self, abi: str, cpp: bool, shared: bool) -> str: abi_json_dict = { "abi": abi, "api": self._android_api_minimum.ints[0], "ndk": self._android_ndk_minimum, "stl": "c++_shared" if cpp else "none", "static": not shared, } return json.dumps(abi_json_dict, indent=4) def _get_android_manifest_text(self) -> str: return textwrap.dedent(f"""\ """) def create_android_archives(self, android_api: int, android_home: Path, android_ndk_home: Path) -> None: cmake_toolchain_file = Path(android_ndk_home) / "build/cmake/android.toolchain.cmake" if not cmake_toolchain_file.exists(): logger.error("CMake toolchain file does not exist (%s)", cmake_toolchain_file) raise SystemExit(1) aar_path = self.root / "build-android" / f"{self.project}-{self.version}.aar" android_dist_path = self.dist_path / f"{self.project}-devel-{self.version}-android.zip" android_abis = self.release_info["android"]["abis"] java_jars_added = False module_data_added = False android_deps_path = self.deps_path / "android-deps" shutil.rmtree(android_deps_path, ignore_errors=True) for dep, depinfo in self.release_info["android"].get("dependencies", {}).items(): dep_devel_zip = self.deps_path / glob.glob(depinfo["artifact"], root_dir=self.deps_path)[0] dep_extract_path = self.deps_path / f"extract/android/{dep}" shutil.rmtree(dep_extract_path, ignore_errors=True) dep_extract_path.mkdir(parents=True, exist_ok=True) with self.section_printer.group(f"Extracting Android dependency {dep} ({dep_devel_zip})"): with zipfile.ZipFile(dep_devel_zip, "r") as zf: zf.extractall(dep_extract_path) dep_devel_aar = dep_extract_path / glob.glob("*.aar", root_dir=dep_extract_path)[0] self.executer.run([sys.executable, str(dep_devel_aar), "-o", str(android_deps_path)]) for module_name, module_info in self.release_info["android"]["modules"].items(): assert "type" in module_info and module_info["type"] in ("interface", "library"), f"module {module_name} must have a valid type" aar_file_tree = ArchiveFileTree() android_devel_file_tree = ArchiveFileTree() for android_abi in android_abis: extra_link_options = ANDROID_ABI_EXTRA_LINK_OPTIONS.get(android_abi, "") with self.section_printer.group(f"Building for Android {android_api} {android_abi}"): build_dir = self.root / "build-android" / f"{android_abi}-build" install_dir = self.root / "install-android" / f"{android_abi}-install" shutil.rmtree(install_dir, ignore_errors=True) assert not install_dir.is_dir(), f"{install_dir} should not exist prior to build" build_type = "Release" cmake_args = [ "cmake", "-S", str(self.root), "-B", str(build_dir), # NDK 21e does not support -ffile-prefix-map # f'''-DCMAKE_C_FLAGS="-ffile-prefix-map={self.root}=/src/{self.project}"''', # f'''-DCMAKE_CXX_FLAGS="-ffile-prefix-map={self.root}=/src/{self.project}"''', f"-DCMAKE_EXE_LINKER_FLAGS={extra_link_options}", f"-DCMAKE_SHARED_LINKER_FLAGS={extra_link_options}", f"-DCMAKE_TOOLCHAIN_FILE={cmake_toolchain_file}", f"-DCMAKE_PREFIX_PATH={str(android_deps_path)}", f"-DCMAKE_FIND_ROOT_PATH_MODE_PACKAGE=BOTH", f"-DANDROID_HOME={android_home}", f"-DANDROID_PLATFORM={android_api}", f"-DANDROID_ABI={android_abi}", "-DCMAKE_POSITION_INDEPENDENT_CODE=ON", f"-DCMAKE_INSTALL_PREFIX={install_dir}", "-DCMAKE_INSTALL_INCLUDEDIR=include ", "-DCMAKE_INSTALL_LIBDIR=lib", "-DCMAKE_INSTALL_DATAROOTDIR=share", f"-DCMAKE_BUILD_TYPE={build_type}", f"-G{self.cmake_generator}", ] + self.release_info["android"]["cmake"]["args"] + ([] if self.fast else ["--fresh"]) build_args = [ "cmake", "--build", str(build_dir), "--verbose", "--config", build_type, ] install_args = [ "cmake", "--install", str(build_dir), "--config", build_type, ] self.executer.run(cmake_args) self.executer.run(build_args) self.executer.run(install_args) for module_name, module_info in self.release_info["android"]["modules"].items(): arcdir_prefab_module = f"prefab/modules/{module_name}" if module_info["type"] == "library": library = install_dir / module_info["library"] assert library.suffix in (".so", ".a") assert library.is_file(), f"CMake should have built library '{library}' for module {module_name}" arcdir_prefab_libs = f"{arcdir_prefab_module}/libs/android.{android_abi}" aar_file_tree.add_file(NodeInArchive.from_fs(arcpath=f"{arcdir_prefab_libs}/{library.name}", path=library, time=self.arc_time)) aar_file_tree.add_file(NodeInArchive.from_text(arcpath=f"{arcdir_prefab_libs}/abi.json", text=self._get_prefab_abi_json_text(abi=android_abi, cpp=False, shared=library.suffix == ".so"), time=self.arc_time)) if not module_data_added: library_name = None if module_info["type"] == "library": library_name = Path(module_info["library"]).stem.removeprefix("lib") export_libraries = module_info.get("export-libraries", []) aar_file_tree.add_file(NodeInArchive.from_text(arcpath=arc_join(arcdir_prefab_module, "module.json"), text=self._get_prefab_module_json_text(library_name=library_name, export_libraries=export_libraries), time=self.arc_time)) arcdir_prefab_include = f"prefab/modules/{module_name}/include" if "includes" in module_info: aar_file_tree.add_file_mapping(arc_dir=arcdir_prefab_include, file_mapping=module_info["includes"], file_mapping_root=install_dir, context=self.get_context(), time=self.arc_time) else: aar_file_tree.add_file(NodeInArchive.from_text(arcpath=arc_join(arcdir_prefab_include, ".keep"), text="\n", time=self.arc_time)) module_data_added = True if not java_jars_added: java_jars_added = True if "jars" in self.release_info["android"]: classes_jar_path = install_dir / configure_text(text=self.release_info["android"]["jars"]["classes"], context=self.get_context()) sources_jar_path = install_dir / configure_text(text=self.release_info["android"]["jars"]["sources"], context=self.get_context()) doc_jar_path = install_dir / configure_text(text=self.release_info["android"]["jars"]["doc"], context=self.get_context()) assert classes_jar_path.is_file(), f"CMake should have compiled the java sources and archived them into a JAR ({classes_jar_path})" assert sources_jar_path.is_file(), f"CMake should have archived the java sources into a JAR ({sources_jar_path})" assert doc_jar_path.is_file(), f"CMake should have archived javadoc into a JAR ({doc_jar_path})" aar_file_tree.add_file(NodeInArchive.from_fs(arcpath="classes.jar", path=classes_jar_path, time=self.arc_time)) aar_file_tree.add_file(NodeInArchive.from_fs(arcpath="classes-sources.jar", path=sources_jar_path, time=self.arc_time)) aar_file_tree.add_file(NodeInArchive.from_fs(arcpath="classes-doc.jar", path=doc_jar_path, time=self.arc_time)) assert ("jars" in self.release_info["android"] and java_jars_added) or "jars" not in self.release_info["android"], "Must have archived java JAR archives" aar_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["android"]["aar-files"], file_mapping_root=self.root, context=self.get_context(), time=self.arc_time) aar_file_tree.add_file(NodeInArchive.from_text(arcpath="prefab/prefab.json", text=self._get_prefab_json_text(), time=self.arc_time)) aar_file_tree.add_file(NodeInArchive.from_text(arcpath="AndroidManifest.xml", text=self._get_android_manifest_text(), time=self.arc_time)) with Archiver(zip_path=aar_path) as archiver: aar_file_tree.add_to_archiver(archive_base="", archiver=archiver) archiver.add_git_hash(arcdir="", commit=self.commit, time=self.arc_time) android_devel_file_tree.add_file(NodeInArchive.from_fs(arcpath=aar_path.name, path=aar_path)) android_devel_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["android"]["files"], file_mapping_root=self.root, context=self.get_context(), time=self.arc_time) with Archiver(zip_path=android_dist_path) as archiver: android_devel_file_tree.add_to_archiver(archive_base="", archiver=archiver) archiver.add_git_hash(arcdir="", commit=self.commit, time=self.arc_time) self.artifacts[f"android-aar"] = android_dist_path def download_dependencies(self): shutil.rmtree(self.deps_path, ignore_errors=True) self.deps_path.mkdir(parents=True) if self.github: with open(os.environ["GITHUB_OUTPUT"], "a") as f: f.write(f"dep-path={self.deps_path.absolute()}\n") for dep, depinfo in self.release_info.get("dependencies", {}).items(): startswith = depinfo["startswith"] dep_repo = depinfo["repo"] # FIXME: dropped "--exclude-pre-releases" dep_string_data = self.executer.check_output(["gh", "-R", dep_repo, "release", "list", "--exclude-drafts", "--json", "name,createdAt,tagName", "--jq", f'[.[]|select(.name|startswith("{startswith}"))]|max_by(.createdAt)']).strip() dep_data = json.loads(dep_string_data) dep_tag = dep_data["tagName"] dep_version = dep_data["name"] logger.info("Download dependency %s version %s (tag=%s) ", dep, dep_version, dep_tag) self.executer.run(["gh", "-R", dep_repo, "release", "download", dep_tag], cwd=self.deps_path) if self.github: with open(os.environ["GITHUB_OUTPUT"], "a") as f: f.write(f"dep-{dep.lower()}-version={dep_version}\n") def verify_dependencies(self): for dep, depinfo in self.release_info.get("dependencies", {}).items(): if "mingw" in self.release_info: mingw_matches = glob.glob(self.release_info["mingw"]["dependencies"][dep]["artifact"], root_dir=self.deps_path) assert len(mingw_matches) == 1, f"Exactly one archive matches mingw {dep} dependency: {mingw_matches}" if "dmg" in self.release_info: dmg_matches = glob.glob(self.release_info["dmg"]["dependencies"][dep]["artifact"], root_dir=self.deps_path) assert len(dmg_matches) == 1, f"Exactly one archive matches dmg {dep} dependency: {dmg_matches}" if "msvc" in self.release_info: msvc_matches = glob.glob(self.release_info["msvc"]["dependencies"][dep]["artifact"], root_dir=self.deps_path) assert len(msvc_matches) == 1, f"Exactly one archive matches msvc {dep} dependency: {msvc_matches}" if "android" in self.release_info: android_matches = glob.glob(self.release_info["android"]["dependencies"][dep]["artifact"], root_dir=self.deps_path) assert len(android_matches) == 1, f"Exactly one archive matches msvc {dep} dependency: {android_matches}" @staticmethod def _arch_to_vs_platform(arch: str, configuration: str="Release") -> VsArchPlatformConfig: ARCH_TO_VS_PLATFORM = { "x86": VsArchPlatformConfig(arch="x86", platform="Win32", configuration=configuration), "x64": VsArchPlatformConfig(arch="x64", platform="x64", configuration=configuration), "arm64": VsArchPlatformConfig(arch="arm64", platform="ARM64", configuration=configuration), } return ARCH_TO_VS_PLATFORM[arch] def build_msvc(self): with self.section_printer.group("Find Visual Studio"): vs = VisualStudio(executer=self.executer) for arch in self.release_info["msvc"].get("msbuild", {}).get("archs", []): self._build_msvc_msbuild(arch_platform=self._arch_to_vs_platform(arch=arch), vs=vs) if "cmake" in self.release_info["msvc"]: deps_path = self.root / "msvc-deps" shutil.rmtree(deps_path, ignore_errors=True) dep_roots = [] for dep, depinfo in self.release_info["msvc"].get("dependencies", {}).items(): dep_extract_path = deps_path / f"extract-{dep}" msvc_zip = self.deps_path / glob.glob(depinfo["artifact"], root_dir=self.deps_path)[0] with zipfile.ZipFile(msvc_zip, "r") as zf: zf.extractall(dep_extract_path) contents_msvc_zip = glob.glob(str(dep_extract_path / "*")) assert len(contents_msvc_zip) == 1, f"There must be exactly one root item in the root directory of {dep}" dep_roots.append(contents_msvc_zip[0]) for arch in self.release_info["msvc"].get("cmake", {}).get("archs", []): self._build_msvc_cmake(arch_platform=self._arch_to_vs_platform(arch=arch), dep_roots=dep_roots) with self.section_printer.group("Create SDL VC development zip"): self._build_msvc_devel() def _copy_dep_files(self, arch_platform: VsArchPlatformConfig): platform_context = self.get_context(arch_platform.extra_context()) for dep, depinfo in self.release_info["msvc"].get("dependencies", {}).items(): msvc_zip = self.deps_path / glob.glob(depinfo["artifact"], root_dir=self.deps_path)[0] src_globs = [configure_text(instr["src"], context=platform_context) for instr in depinfo["copy"]] with zipfile.ZipFile(msvc_zip, "r") as zf: for member in zf.namelist(): member_path = "/".join(Path(member).parts[1:]) for src_i, src_glob in enumerate(src_globs): if fnmatch.fnmatch(member_path, src_glob): dst = (self.root / configure_text(depinfo["copy"][src_i]["dst"], context=platform_context)).resolve() / Path(member_path).name zip_data = zf.read(member) if dst.exists(): identical = False if dst.is_file(): orig_bytes = dst.read_bytes() if orig_bytes == zip_data: identical = True if not identical: logger.warning("Extracting dependency %s, will cause %s to be overwritten", dep, dst) if not self.overwrite: raise RuntimeError("Run with --overwrite to allow overwriting") logger.debug("Extracting %s -> %s", member, dst) dst.parent.mkdir(exist_ok=True, parents=True) dst.write_bytes(zip_data) def _build_msvc_msbuild(self, arch_platform: VsArchPlatformConfig, vs: VisualStudio): self._copy_dep_files(arch_platform) prebuilt_paths = set(self.root / full_prebuilt_path for prebuilt_path in self.release_info["msvc"]["msbuild"].get("prebuilt", []) for full_prebuilt_path in glob.glob(configure_text(prebuilt_path, context=platform_context), root_dir=self.root)) msbuild_paths = set(self.root / configure_text(f, context=platform_context) for file_mapping in (self.release_info["msvc"]["msbuild"]["files-lib"], self.release_info["msvc"]["msbuild"]["files-devel"]) for files_list in file_mapping.values() for f in files_list) assert prebuilt_paths.issubset(msbuild_paths), f"msvc.msbuild.prebuilt must be a subset of (msvc.msbuild.files-lib, msvc.msbuild.files-devel)" built_paths = msbuild_paths.difference(prebuilt_paths) logger.info("MSbuild builds these files, to be included in the package: %s", built_paths) if not self.fast: for b in built_paths: b.unlink(missing_ok=True) rel_projects: list[str] = self.release_info["msvc"]["msbuild"]["projects"] projects = list(self.root / p for p in rel_projects) directory_build_props_src_relpath = self.release_info["msvc"]["msbuild"].get("directory-build-props") for project in projects: dir_b_props = project.parent / "Directory.Build.props" dir_b_props.unlink(missing_ok = True) if directory_build_props_src_relpath: src = self.root / directory_build_props_src_relpath logger.debug("Copying %s -> %s", src, dir_b_props) shutil.copy(src=src, dst=dir_b_props) with self.section_printer.group(f"Build {arch_platform.arch} VS binary"): vs.build(arch_platform=arch_platform, projects=projects) if self.dry: for b in built_paths: b.parent.mkdir(parents=True, exist_ok=True) b.touch() for b in built_paths: assert b.is_file(), f"{b} has not been created" b.parent.mkdir(parents=True, exist_ok=True) b.touch() zip_path = self.dist_path / f"{self.project}-{self.version}-win32-{arch_platform.arch}.zip" zip_path.unlink(missing_ok=True) logger.info("Collecting files...") archive_file_tree = ArchiveFileTree() archive_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["msvc"]["msbuild"]["files-lib"], file_mapping_root=self.root, context=platform_context, time=self.arc_time) archive_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["msvc"]["files-lib"], file_mapping_root=self.root, context=platform_context, time=self.arc_time) logger.info("Writing to %s", zip_path) with Archiver(zip_path=zip_path) as archiver: arc_root = f"" archive_file_tree.add_to_archiver(archive_base=arc_root, archiver=archiver) archiver.add_git_hash(arcdir=arc_root, commit=self.commit, time=self.arc_time) self.artifacts[f"VC-{arch_platform.arch}"] = zip_path for p in built_paths: assert p.is_file(), f"{p} should exist" def _arch_platform_to_build_path(self, arch_platform: VsArchPlatformConfig) -> Path: return self.root / f"build-vs-{arch_platform.arch}" def _arch_platform_to_install_path(self, arch_platform: VsArchPlatformConfig) -> Path: return self._arch_platform_to_build_path(arch_platform) / "prefix" def _build_msvc_cmake(self, arch_platform: VsArchPlatformConfig, dep_roots: list[Path]): build_path = self._arch_platform_to_build_path(arch_platform) install_path = self._arch_platform_to_install_path(arch_platform) platform_context = self.get_context(extra_context=arch_platform.extra_context()) build_type = "Release" extra_context = { "ARCH": arch_platform.arch, "PLATFORM": arch_platform.platform, } self._copy_dep_files(arch_platform) built_paths = set(install_path / configure_text(f, context=platform_context) for file_mapping in (self.release_info["msvc"]["cmake"]["files-lib"], self.release_info["msvc"]["cmake"]["files-devel"]) for files_list in file_mapping.values() for f in files_list) logger.info("CMake builds these files, to be included in the package: %s", built_paths) if not self.fast: for b in built_paths: b.unlink(missing_ok=True) shutil.rmtree(install_path, ignore_errors=True) build_path.mkdir(parents=True, exist_ok=True) with self.section_printer.group(f"Configure VC CMake project for {arch_platform.arch}"): self.executer.run([ "cmake", "-S", str(self.root), "-B", str(build_path), "-A", arch_platform.platform, "-DCMAKE_INSTALL_BINDIR=bin", "-DCMAKE_INSTALL_DATAROOTDIR=share", "-DCMAKE_INSTALL_INCLUDEDIR=include", "-DCMAKE_INSTALL_LIBDIR=lib", f"-DCMAKE_BUILD_TYPE={build_type}", f"-DCMAKE_INSTALL_PREFIX={install_path}", # MSVC debug information format flags are selected by an abstraction "-DCMAKE_POLICY_DEFAULT_CMP0141=NEW", # MSVC debug information format "-DCMAKE_MSVC_DEBUG_INFORMATION_FORMAT=ProgramDatabase", # Linker flags for executables "-DCMAKE_EXE_LINKER_FLAGS=-INCREMENTAL:NO -DEBUG -OPT:REF -OPT:ICF", # Linker flag for shared libraries "-DCMAKE_SHARED_LINKER_FLAGS=-INCREMENTAL:NO -DEBUG -OPT:REF -OPT:ICF", # MSVC runtime library flags are selected by an abstraction "-DCMAKE_POLICY_DEFAULT_CMP0091=NEW", # Use statically linked runtime (-MT) (ideally, should be "MultiThreaded$<$:Debug>") "-DCMAKE_MSVC_RUNTIME_LIBRARY=MultiThreaded", f"-DCMAKE_PREFIX_PATH={';'.join(str(s) for s in dep_roots)}", ] + self.release_info["msvc"]["cmake"]["args"] + ([] if self.fast else ["--fresh"])) with self.section_printer.group(f"Build VC CMake project for {arch_platform.arch}"): self.executer.run(["cmake", "--build", str(build_path), "--verbose", "--config", build_type]) with self.section_printer.group(f"Install VC CMake project for {arch_platform.arch}"): self.executer.run(["cmake", "--install", str(build_path), "--config", build_type]) if self.dry: for b in built_paths: b.parent.mkdir(parents=True, exist_ok=True) b.touch() zip_path = self.dist_path / f"{self.project}-{self.version}-win32-{arch_platform.arch}.zip" zip_path.unlink(missing_ok=True) logger.info("Collecting files...") archive_file_tree = ArchiveFileTree() archive_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["msvc"]["cmake"]["files-lib"], file_mapping_root=install_path, context=platform_context, time=self.arc_time) archive_file_tree.add_file_mapping(arc_dir="", file_mapping=self.release_info["msvc"]["files-lib"], file_mapping_root=self.root, context=self.get_context(extra_context=extra_context), time=self.arc_time) logger.info("Creating %s", zip_path) with Archiver(zip_path=zip_path) as archiver: arc_root = f"" archive_file_tree.add_to_archiver(archive_base=arc_root, archiver=archiver) archiver.add_git_hash(arcdir=arc_root, commit=self.commit, time=self.arc_time) for p in built_paths: assert p.is_file(), f"{p} should exist" def _build_msvc_devel(self) -> None: zip_path = self.dist_path / f"{self.project}-devel-{self.version}-VC.zip" arc_root = f"{self.project}-{self.version}" def copy_files_devel(ctx): archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["msvc"]["files-devel"], file_mapping_root=self.root, context=ctx, time=self.arc_time) logger.info("Collecting files...") archive_file_tree = ArchiveFileTree() if "msbuild" in self.release_info["msvc"]: for arch in self.release_info["msvc"]["msbuild"]["archs"]: arch_platform = self._arch_to_vs_platform(arch=arch) platform_context = self.get_context(arch_platform.extra_context()) archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["msvc"]["msbuild"]["files-devel"], file_mapping_root=self.root, context=platform_context, time=self.arc_time) copy_files_devel(ctx=platform_context) if "cmake" in self.release_info["msvc"]: for arch in self.release_info["msvc"]["cmake"]["archs"]: arch_platform = self._arch_to_vs_platform(arch=arch) platform_context = self.get_context(arch_platform.extra_context()) archive_file_tree.add_file_mapping(arc_dir=arc_root, file_mapping=self.release_info["msvc"]["cmake"]["files-devel"], file_mapping_root=self._arch_platform_to_install_path(arch_platform), context=platform_context, time=self.arc_time) copy_files_devel(ctx=platform_context) with Archiver(zip_path=zip_path) as archiver: archive_file_tree.add_to_archiver(archive_base="", archiver=archiver) archiver.add_git_hash(arcdir=arc_root, commit=self.commit, time=self.arc_time) self.artifacts["VC-devel"] = zip_path @classmethod def extract_sdl_version(cls, root: Path, release_info: dict) -> str: with open(root / release_info["version"]["file"], "r") as f: text = f.read() major = next(re.finditer(release_info["version"]["re_major"], text, flags=re.M)).group(1) minor = next(re.finditer(release_info["version"]["re_minor"], text, flags=re.M)).group(1) micro = next(re.finditer(release_info["version"]["re_micro"], text, flags=re.M)).group(1) return f"{major}.{minor}.{micro}" def main(argv=None) -> int: if sys.version_info < (3, 11): logger.error("This script needs at least python 3.11") return 1 parser = argparse.ArgumentParser(allow_abbrev=False, description="Create SDL release artifacts") parser.add_argument("--root", metavar="DIR", type=Path, default=Path(__file__).absolute().parents[1], help="Root of project") parser.add_argument("--release-info", metavar="JSON", dest="path_release_info", type=Path, default=Path(__file__).absolute().parent / "release-info.json", help="Path of release-info.json") parser.add_argument("--dependency-folder", metavar="FOLDER", dest="deps_path", type=Path, default="deps", help="Directory containing pre-built archives of dependencies (will be removed when downloading archives)") parser.add_argument("--out", "-o", metavar="DIR", dest="dist_path", type=Path, default="dist", help="Output directory") parser.add_argument("--github", action="store_true", help="Script is running on a GitHub runner") parser.add_argument("--commit", default="HEAD", help="Git commit/tag of which a release should be created") parser.add_argument("--actions", choices=["download", "source", "android", "mingw", "msvc", "dmg"], required=True, nargs="+", dest="actions", help="What to do?") parser.set_defaults(loglevel=logging.INFO) parser.add_argument('--vs-year', dest="vs_year", help="Visual Studio year") parser.add_argument('--android-api', dest="android_api", help="Android API version") parser.add_argument('--android-home', dest="android_home", default=os.environ.get("ANDROID_HOME"), help="Android Home folder") parser.add_argument('--android-ndk-home', dest="android_ndk_home", default=os.environ.get("ANDROID_NDK_HOME"), help="Android NDK Home folder") parser.add_argument('--cmake-generator', dest="cmake_generator", default="Ninja", help="CMake Generator") parser.add_argument('--debug', action='store_const', const=logging.DEBUG, dest="loglevel", help="Print script debug information") parser.add_argument('--dry-run', action='store_true', dest="dry", help="Don't execute anything") parser.add_argument('--force', action='store_true', dest="force", help="Ignore a non-clean git tree") parser.add_argument('--overwrite', action='store_true', dest="overwrite", help="Allow potentially overwriting other projects") parser.add_argument('--fast', action='store_true', dest="fast", help="Don't do a rebuild") args = parser.parse_args(argv) logging.basicConfig(level=args.loglevel, format='[%(levelname)s] %(message)s') args.deps_path = args.deps_path.absolute() args.dist_path = args.dist_path.absolute() args.root = args.root.absolute() args.dist_path = args.dist_path.absolute() if args.dry: args.dist_path = args.dist_path / "dry" if args.github: section_printer: SectionPrinter = GitHubSectionPrinter() else: section_printer = SectionPrinter() if args.github and "GITHUB_OUTPUT" not in os.environ: os.environ["GITHUB_OUTPUT"] = "/tmp/github_output.txt" executer = Executer(root=args.root, dry=args.dry) root_git_hash_path = args.root / GIT_HASH_FILENAME root_is_maybe_archive = root_git_hash_path.is_file() if root_is_maybe_archive: logger.warning("%s detected: Building from archive", GIT_HASH_FILENAME) archive_commit = root_git_hash_path.read_text().strip() if args.commit != archive_commit: logger.warning("Commit argument is %s, but archive commit is %s. Using %s.", args.commit, archive_commit, archive_commit) args.commit = archive_commit revision = (args.root / REVISION_TXT).read_text().strip() else: args.commit = executer.check_output(["git", "rev-parse", args.commit], dry_out="e5812a9fd2cda317b503325a702ba3c1c37861d9").strip() revision = executer.check_output(["git", "describe", "--always", "--tags", "--long", args.commit], dry_out="preview-3.1.3-96-g9512f2144").strip() logger.info("Using commit %s", args.commit) try: with args.path_release_info.open() as f: release_info = json.load(f) except FileNotFoundError: logger.error(f"Could not find {args.path_release_info}") releaser = Releaser( release_info=release_info, commit=args.commit, revision=revision, root=args.root, dist_path=args.dist_path, executer=executer, section_printer=section_printer, cmake_generator=args.cmake_generator, deps_path=args.deps_path, overwrite=args.overwrite, github=args.github, fast=args.fast, ) if root_is_maybe_archive: logger.warning("Building from archive. Skipping clean git tree check.") else: porcelain_status = executer.check_output(["git", "status", "--ignored", "--porcelain"], dry_out="\n").strip() if porcelain_status: print(porcelain_status) logger.warning("The tree is dirty! Do not publish any generated artifacts!") if not args.force: raise Exception("The git repo contains modified and/or non-committed files. Run with --force to ignore.") if args.fast: logger.warning("Doing fast build! Do not publish generated artifacts!") with section_printer.group("Arguments"): print(f"project = {releaser.project}") print(f"version = {releaser.version}") print(f"revision = {revision}") print(f"commit = {args.commit}") print(f"out = {args.dist_path}") print(f"actions = {args.actions}") print(f"dry = {args.dry}") print(f"force = {args.force}") print(f"overwrite = {args.overwrite}") print(f"cmake_generator = {args.cmake_generator}") releaser.prepare() if "download" in args.actions: releaser.download_dependencies() if set(args.actions).intersection({"msvc", "mingw", "android"}): print("Verifying presence of dependencies (run 'download' action to download) ...") releaser.verify_dependencies() print("... done") if "source" in args.actions: if root_is_maybe_archive: raise Exception("Cannot build source archive from source archive") with section_printer.group("Create source archives"): releaser.create_source_archives() if "dmg" in args.actions: if platform.system() != "Darwin" and not args.dry: parser.error("framework artifact(s) can only be built on Darwin") releaser.create_dmg() if "msvc" in args.actions: if platform.system() != "Windows" and not args.dry: parser.error("msvc artifact(s) can only be built on Windows") releaser.build_msvc() if "mingw" in args.actions: releaser.create_mingw_archives() if "android" in args.actions: if args.android_home is None or not Path(args.android_home).is_dir(): parser.error("Invalid $ANDROID_HOME or --android-home: must be a directory containing the Android SDK") if args.android_ndk_home is None or not Path(args.android_ndk_home).is_dir(): parser.error("Invalid $ANDROID_NDK_HOME or --android-ndk-home: must be a directory containing the Android NDK") if args.android_api is None: with section_printer.group("Detect Android APIS"): args.android_api = releaser._detect_android_api(android_home=args.android_home) else: try: android_api_ints = tuple(int(v) for v in args.android_api.split(".")) match len(android_api_ints): case 1: android_api_name = f"android-{android_api_ints[0]}" case 2: android_api_name = f"android-{android_api_ints[0]}-ext-{android_api_ints[1]}" case _: raise ValueError except ValueError: logger.error("Invalid --android-api, must be a 'X' or 'X.Y' version") args.android_api = AndroidApiVersion(ints=android_api_ints, name=android_api_name) if args.android_api is None: parser.error("Invalid --android-api, and/or could not be detected") android_api_path = Path(args.android_home) / f"platforms/{args.android_api.name}" if not android_api_path.is_dir(): logger.warning(f"Android API directory does not exist ({android_api_path})") with section_printer.group("Android arguments"): print(f"android_home = {args.android_home}") print(f"android_ndk_home = {args.android_ndk_home}") print(f"android_api = {args.android_api}") releaser.create_android_archives( android_api=args.android_api.ints[0], android_home=args.android_home, android_ndk_home=args.android_ndk_home, ) with section_printer.group("Summary"): print(f"artifacts = {releaser.artifacts}") if args.github: with open(os.environ["GITHUB_OUTPUT"], "a") as f: f.write(f"project={releaser.project}\n") f.write(f"version={releaser.version}\n") for k, v in releaser.artifacts.items(): f.write(f"{k}={v.name}\n") return 0 if __name__ == "__main__": raise SystemExit(main()) sdl12-compat-1.2.74/build-scripts/create-release.py0000775000000000000000000000272115077503722016777 0ustar00#!/usr/bin/env python3 import argparse from pathlib import Path import json import logging import re import subprocess ROOT = Path(__file__).resolve().parents[1] def determine_remote() -> str: text = (ROOT / "build-scripts/release-info.json").read_text() release_info = json.loads(text) if "remote" in release_info: return release_info["remote"] project_with_version = release_info["name"] project, _ = re.subn("([^a-zA-Z_])", "", project_with_version) return f"libsdl-org/{project}" def main(): default_remote = determine_remote() parser = argparse.ArgumentParser(allow_abbrev=False) parser.add_argument("--ref", required=True, help=f"Name of branch or tag containing release.yml") parser.add_argument("--remote", "-R", default=default_remote, help=f"Remote repo (default={default_remote})") parser.add_argument("--commit", help=f"Input 'commit' of release.yml (default is the hash of the ref)") args = parser.parse_args() if args.commit is None: args.commit = subprocess.check_output(["git", "rev-parse", args.ref], cwd=ROOT, text=True).strip() print(f"Running release.yml workflow:") print(f" remote = {args.remote}") print(f" ref = {args.ref}") print(f" commit = {args.commit}") subprocess.check_call(["gh", "-R", args.remote, "workflow", "run", "release.yml", "--ref", args.ref, "-f", f"commit={args.commit}"], cwd=ROOT) if __name__ == "__main__": raise SystemExit(main()) sdl12-compat-1.2.74/build-scripts/pkg-support/msvc/INSTALL.md0000664000000000000000000000072215077503722020433 0ustar00 # Using this package This package contains sdl12-compat built for Visual Studio. To use this package, edit your project properties: - Add the include directory to "VC++ Directories" -> "Include Directories" - Add the lib/_arch_ directory to "VC++ Directories" -> "Library Directories" - Add SDL.lib and SDLmain.lib to Linker -> Input -> "Additional Dependencies" - Copy lib/_arch_/SDL.dll, lib/_arch_/SDL2.dll, and lib/_arch_/SDL3.dll to your project directory. sdl12-compat-1.2.74/build-scripts/pkg-support/msvc/README.md0000664000000000000000000000130715077503722020262 0ustar00 Simple DirectMedia Layer (SDL for short) is a cross-platform library designed to make it easy to write multi-media software, such as games and emulators. You can find the latest release and additional information at: https://www.libsdl.org/ This code is a compatibility layer; it provides a binary and source compatible API for programs written against SDL 1.2, but it uses SDL 2.0 behind the scenes. If you are writing new code, please target SDL 3.0 directly and do not use this layer. Installation instructions are available in [INSTALL.md](INSTALL.md). This library is distributed under the terms of the zlib license, available in [LICENSE.txt](LICENSE.txt). Enjoy! Sam Lantinga (slouken@libsdl.org) sdl12-compat-1.2.74/build-scripts/pkg-support/msvc/x64/INSTALL.md.in0000664000000000000000000000026515077503722021463 0ustar00 # Using this package This package contains @<@PROJECT_NAME@>@ built for x64 Windows. To use this package, simply replace an existing 64-bit SDL.dll with the ones included here. sdl12-compat-1.2.74/build-scripts/pkg-support/msvc/x86/INSTALL.md.in0000664000000000000000000000026515077503722021467 0ustar00 # Using this package This package contains @<@PROJECT_NAME@>@ built for x86 Windows. To use this package, simply replace an existing 32-bit SDL.dll with the ones included here. sdl12-compat-1.2.74/build-scripts/release-info.json0000664000000000000000000000375515077717063017022 0ustar00{ "name": "sdl12-compat", "remote": "libsdl-org/sdl12-compat", "dependencies": { "sdl2-compat": { "startswith": "2.", "repo": "libsdl-org/sdl2-compat" } }, "version": { "file": "include/SDL/SDL_version.h", "re_major": "^#define SDL_MAJOR_VERSION\\s+([0-9]+)$", "re_minor": "^#define SDL_MINOR_VERSION\\s+([0-9]+)$", "re_micro": "^#define SDL_PATCHLEVEL\\s+([0-9]+)$" }, "source": { "checks": [ "src/SDL12_compat.c", "include/SDL/SDL.h", "test/testsprite.c" ] }, "msvc": { "cmake": { "archs": [ "x86", "x64" ], "args": [ "-DSDL12COMPAT_VENDOR_INFO=libsdl.org", "-DSDL12COMPAT_INSTALL_SDL2=ON", "-DSDL12COMPAT_INSTALL_SDL3=ON", "-DSDL12TESTS=OFF", "-DSDL12DEVEL=ON", "-DSTATICDEVEL=OFF" ], "files-lib": { "": [ "bin/SDL.dll" ] }, "files-devel": { "lib/@<@ARCH@>@": [ "bin/SDL.dll", "lib/SDL.lib", "lib/SDLmain.lib" ] } }, "files-lib": { "": [ "build-scripts/pkg-support/msvc/@<@ARCH@>@/INSTALL.md.in:INSTALL.md", "LICENSE.txt", "build-scripts/pkg-support/msvc/README.md", "@<@ARCH@>@/SDL2.dll", "@<@ARCH@>@/SDL3.dll" ] }, "files-devel": { "": [ "build-scripts/pkg-support/msvc/INSTALL.md", "LICENSE.txt", "build-scripts/pkg-support/msvc/README.md" ], "include": [ "include/SDL/*" ], "lib/@<@ARCH@>@": [ "@<@ARCH@>@/SDL2.dll", "@<@ARCH@>@/SDL3.dll" ] }, "dependencies": { "sdl2-compat": { "artifact": "sdl2-compat-devel-2.??.??-VC.zip", "copy": [ { "src": "lib/@<@ARCH@>@/SDL3.dll", "dst": "@<@ARCH@>@" }, { "src": "lib/@<@ARCH@>@/SDL2.dll", "dst": "@<@ARCH@>@" } ] } } } } sdl12-compat-1.2.74/build-scripts/test-versioning.sh0000775000000000000000000000576715077503722017255 0ustar00#!/bin/sh # Copyright 2022 Collabora Ltd. # SPDX-License-Identifier: Zlib set -eu cd `dirname $0`/.. ref_major=$(sed -ne 's/^#define SDL_MAJOR_VERSION *//p' include/SDL/SDL_version.h) ref_minor=$(sed -ne 's/^#define SDL_MINOR_VERSION *//p' include/SDL/SDL_version.h) ref_micro=$(sed -ne 's/^#define SDL_PATCHLEVEL *//p' include/SDL/SDL_version.h) ref_version="${ref_major}.${ref_minor}.${ref_micro}" tests=0 failed=0 ok () { tests=$(( tests + 1 )) echo "ok - $*" } not_ok () { tests=$(( tests + 1 )) echo "not ok - $*" failed=1 } version=$(sed -Ene 's/^project\(sdl[0-9]+_compat VERSION ([0-9.]*) LANGUAGES C\)$/\1/p' CMakeLists.txt) if [ "$ref_version" = "$version" ]; then ok "CMakeLists.txt $version" else not_ok "CMakeLists.txt $version disagrees with SDL_version.h $ref_version" fi tuple=$(sed -ne 's/^ *FILEVERSION *//p' src/version.rc | tr -d '\r') ref_tuple="${ref_major},${ref_minor},${ref_micro},0" if [ "$ref_tuple" = "$tuple" ]; then ok "version.rc FILEVERSION $tuple" else not_ok "version.rc FILEVERSION $tuple disagrees with SDL_version.h $ref_tuple" fi tuple=$(sed -ne 's/^ *PRODUCTVERSION *//p' src/version.rc | tr -d '\r') if [ "$ref_tuple" = "$tuple" ]; then ok "version.rc PRODUCTVERSION $tuple" else not_ok "version.rc PRODUCTVERSION $tuple disagrees with SDL_version.h $ref_tuple" fi tuple=$(sed -Ene 's/^ *VALUE "FileVersion", "([0-9, ]*)\\0"\r?$/\1/p' src/version.rc | tr -d '\r') ref_tuple="${ref_major}, ${ref_minor}, ${ref_micro}, 0" if [ "$ref_tuple" = "$tuple" ]; then ok "version.rc FileVersion $tuple" else not_ok "version.rc FileVersion $tuple disagrees with SDL_version.h $ref_tuple" fi tuple=$(sed -Ene 's/^ *VALUE "ProductVersion", "([0-9, ]*)\\0"\r?$/\1/p' src/version.rc | tr -d '\r') if [ "$ref_tuple" = "$tuple" ]; then ok "version.rc ProductVersion $tuple" else not_ok "version.rc ProductVersion $tuple disagrees with SDL_version.h $ref_tuple" fi micro=$(sed -Ene 's/^#define SDL12_COMPAT_VERSION ([0-9]+)$/\1/p' src/SDL12_compat.c) if [ "$ref_micro" = "$micro" ]; then ok "SDL12_compat.c SDL12_COMPAT_VERSION $micro" else not_ok "SDL12_compat.c SDL12_COMPAT_VERSION $micro disagrees with SDL_version.h $ref_micro" fi so_version="1.2.$ref_micro" compat_version="1.0" dylib_version="12.$ref_micro" ref_dylib_versions="$compat_version $dylib_version" dylib_versions=$(sed -Ene 's/^LDFLAGS\+= -Wl,-compatibility_version,([0-9.]+) -Wl,-current_version,([0-9.]+)$/\1 \2/p' src/Makefile.darwin) if [ "$ref_dylib_versions" = "$dylib_versions" ]; then ok "Makefile.darwin LDFLAGS $dylib_versions" else not_ok "Makefile.darwin LDFLAGS $dylib_versions disagrees with reference $ref_dylib_versions" fi ref_so_version="$so_version" so_version=$(sed -Ene 's/^SHLIB = libSDL-1.2.so.([0-9.]+)$/\1/p' src/Makefile.linux) if [ "$ref_so_version" = "$so_version" ]; then ok "Makefile.linux SHLIB $so_version" else not_ok "Makefile.linux SHLIB $so_version disagrees with reference $ref_so_version" fi echo "1..$tests" exit "$failed" sdl12-compat-1.2.74/build-scripts/update-version.sh0000775000000000000000000000241615077503722017046 0ustar00#!/bin/sh cd `dirname $0`/.. if [ -z $1 ]; then echo "USAGE: $0 " 1>&2 exit 1 fi NEWVERSION="$1" echo "Updating version to '1.2.$NEWVERSION' ..." perl -w -pi -e 's/(VERSION 1\.2\.)\d+/${1}'$NEWVERSION'/;' CMakeLists.txt perl -w -pi -e 's/(DYLIB_CURRENT_VERSION 12\.)\d+/${1}'$NEWVERSION'/;' CMakeLists.txt perl -w -pi -e 's/(\-current_version,12\.)\d+/${1}'$NEWVERSION'/;' src/Makefile.darwin perl -w -pi -e 's/(libSDL\-1\.2\.so\.1\.2\.)\d+/${1}'$NEWVERSION'/;' src/Makefile.linux perl -w -pi -e 's/(VERSION = 1\.2\.)\d+/${1}'$NEWVERSION'/;' src/Makefile.os2 perl -w -pi -e 's/(VERSION = 1\.2\.)\d+/${1}'$NEWVERSION'/;' src/Makefile.w32 perl -w -pi -e 's/(\#define SDL12_COMPAT_VERSION )\d+/${1}'$NEWVERSION'/;' src/SDL12_compat.c perl -w -pi -e 's/(\#define SDL_PATCHLEVEL )\d+/${1}'$NEWVERSION'/;' include/SDL/SDL_version.h perl -w -pi -e 's/(FILEVERSION 1,2,)\d+/${1}'$NEWVERSION'/;' src/version.rc perl -w -pi -e 's/(PRODUCTVERSION 1,2,)\d+/${1}'$NEWVERSION'/;' src/version.rc perl -w -pi -e 's/(VALUE "FileVersion", "1, 2, )\d+/${1}'$NEWVERSION'/;' src/version.rc perl -w -pi -e 's/(VALUE "ProductVersion", "1, 2, )\d+/${1}'$NEWVERSION'/;' src/version.rc echo "All done." echo "Run 'git diff' and make sure this looks correct before 'git commit'." exit 0 sdl12-compat-1.2.74/cmake/cmake_uninstall.cmake.in0000664000000000000000000000124415077213763016617 0ustar00if (NOT EXISTS "@CMAKE_BINARY_DIR@/install_manifest.txt") message(FATAL_ERROR "Cannot find install manifest: \"@CMAKE_BINARY_DIR@/install_manifest.txt\"") endif() file(READ "@CMAKE_BINARY_DIR@/install_manifest.txt" files) string(REGEX REPLACE "\n" ";" files "${files}") foreach(file ${files}) message(STATUS "Uninstalling \"$ENV{DESTDIR}${file}\"") execute_process( COMMAND @CMAKE_COMMAND@ -E remove "$ENV{DESTDIR}${file}" OUTPUT_VARIABLE rm_out RESULT_VARIABLE rm_retval ) if(NOT ${rm_retval} EQUAL 0) message(FATAL_ERROR "Problem when removing \"$ENV{DESTDIR}${file}\"") endif (NOT ${rm_retval} EQUAL 0) endforeach() sdl12-compat-1.2.74/cmake/modules/FindSDL2.cmake0000664000000000000000000003343314016247262016014 0ustar00# Distributed under the OSI-approved BSD 3-Clause License. See accompanying # file Copyright.txt or https://cmake.org/licensing for details. # Copyright 2019 Amine Ben Hassouna # Copyright 2000-2019 Kitware, Inc. and Contributors # All rights reserved. # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # * Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # * Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # * Neither the name of Kitware, Inc. nor the names of Contributors # may be used to endorse or promote products derived from this # software without specific prior written permission. # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS # "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT # LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR # A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT # HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, # SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT # LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE # OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. #[=======================================================================[.rst: FindSDL2 -------- Locate SDL2 library This module defines the following 'IMPORTED' targets: :: SDL2::Core The SDL2 library, if found. Libraries should link to SDL2::Core SDL2::Main The SDL2main library, if found. Applications should link to SDL2::Main instead of SDL2::Core This module will set the following variables in your project: :: SDL2_LIBRARIES, the name of the library to link against SDL2_INCLUDE_DIRS, where to find SDL.h SDL2_FOUND, if false, do not try to link to SDL2 SDL2MAIN_FOUND, if false, do not try to link to SDL2main SDL2_VERSION_STRING, human-readable string containing the version of SDL2 This module responds to the following cache variables: :: SDL2_PATH Set a custom SDL2 Library path (default: empty) SDL2_NO_DEFAULT_PATH Disable search SDL2 Library in default path. If SDL2_PATH (default: ON) Else (default: OFF) SDL2_INCLUDE_DIR SDL2 headers path. SDL2_LIBRARY SDL2 Library (.dll, .so, .a, etc) path. SDL2MAIN_LIBRAY SDL2main Library (.a) path. SDL2_BUILDING_LIBRARY This flag is useful only when linking to SDL2_LIBRARIES insead of SDL2::Main. It is required only when building a library that links to SDL2_LIBRARIES, because only applications need main() (No need to also link to SDL2main). If this flag is defined, then no SDL2main will be added to SDL2_LIBRARIES and no SDL2::Main target will be created. Don't forget to include SDLmain.h and SDLmain.m in your project for the OS X framework based version. (Other versions link to -lSDL2main which this module will try to find on your behalf.) Also for OS X, this module will automatically add the -framework Cocoa on your behalf. Additional Note: If you see an empty SDL2_LIBRARY in your project configuration, it means CMake did not find your SDL2 library (SDL2.dll, libsdl2.so, SDL2.framework, etc). Set SDL2_LIBRARY to point to your SDL2 library, and configure again. Similarly, if you see an empty SDL2MAIN_LIBRARY, you should set this value as appropriate. These values are used to generate the final SDL2_LIBRARIES variable and the SDL2::Core and SDL2::Main targets, but when these values are unset, SDL2_LIBRARIES, SDL2::Core and SDL2::Main does not get created. $SDL2DIR is an environment variable that would correspond to the ./configure --prefix=$SDL2DIR used in building SDL2. l.e.galup 9-20-02 Created by Amine Ben Hassouna: Adapt FindSDL.cmake to SDL2 (FindSDL2.cmake). Add cache variables for more flexibility: SDL2_PATH, SDL2_NO_DEFAULT_PATH (for details, see doc above). Mark 'Threads' as a required dependency for non-OSX systems. Modernize the FindSDL2.cmake module by creating specific targets: SDL2::Core and SDL2::Main (for details, see doc above). Original FindSDL.cmake module: Modified by Eric Wing. Added code to assist with automated building by using environmental variables and providing a more controlled/consistent search behavior. Added new modifications to recognize OS X frameworks and additional Unix paths (FreeBSD, etc). Also corrected the header search path to follow "proper" SDL guidelines. Added a search for SDLmain which is needed by some platforms. Added a search for threads which is needed by some platforms. Added needed compile switches for MinGW. On OSX, this will prefer the Framework version (if found) over others. People will have to manually change the cache value of SDL2_LIBRARY to override this selection or set the SDL2_PATH variable or the CMake environment CMAKE_INCLUDE_PATH to modify the search paths. Note that the header path has changed from SDL/SDL.h to just SDL.h This needed to change because "proper" SDL convention is #include "SDL.h", not . This is done for portability reasons because not all systems place things in SDL/ (see FreeBSD). #]=======================================================================] # Define options for searching SDL2 Library in a custom path set(SDL2_PATH "" CACHE STRING "Custom SDL2 Library path") set(_SDL2_NO_DEFAULT_PATH OFF) if(SDL2_PATH) set(_SDL2_NO_DEFAULT_PATH ON) endif() set(SDL2_NO_DEFAULT_PATH ${_SDL2_NO_DEFAULT_PATH} CACHE BOOL "Disable search SDL2 Library in default path") unset(_SDL2_NO_DEFAULT_PATH) set(SDL2_NO_DEFAULT_PATH_CMD) if(SDL2_NO_DEFAULT_PATH) set(SDL2_NO_DEFAULT_PATH_CMD NO_DEFAULT_PATH) endif() # Search for the SDL2 include directory find_path(SDL2_INCLUDE_DIR SDL.h HINTS ENV SDL2DIR ${SDL2_NO_DEFAULT_PATH_CMD} PATH_SUFFIXES SDL2 # path suffixes to search inside ENV{SDL2DIR} include/SDL2 include PATHS ${SDL2_PATH} DOC "Where the SDL2 headers can be found" ) set(SDL2_INCLUDE_DIRS "${SDL2_INCLUDE_DIR}") if(CMAKE_SIZEOF_VOID_P EQUAL 8) set(VC_LIB_PATH_SUFFIX lib/x64) else() set(VC_LIB_PATH_SUFFIX lib/x86) endif() # SDL-2.0 is the name used by FreeBSD ports... # don't confuse it for the version number. find_library(SDL2_LIBRARY NAMES SDL2 SDL-2.0 HINTS ENV SDL2DIR ${SDL2_NO_DEFAULT_PATH_CMD} PATH_SUFFIXES lib ${VC_LIB_PATH_SUFFIX} PATHS ${SDL2_PATH} DOC "Where the SDL2 Library can be found" ) set(SDL2_LIBRARIES "${SDL2_LIBRARY}") if(NOT SDL2_BUILDING_LIBRARY) if(NOT SDL2_INCLUDE_DIR MATCHES ".framework") # Non-OS X framework versions expect you to also dynamically link to # SDL2main. This is mainly for Windows and OS X. Other (Unix) platforms # seem to provide SDL2main for compatibility even though they don't # necessarily need it. if(SDL2_PATH) set(SDL2MAIN_LIBRARY_PATHS "${SDL2_PATH}") endif() if(NOT SDL2_NO_DEFAULT_PATH) set(SDL2MAIN_LIBRARY_PATHS /sw /opt/local /opt/csw /opt "${SDL2MAIN_LIBRARY_PATHS}" ) endif() find_library(SDL2MAIN_LIBRARY NAMES SDL2main HINTS ENV SDL2DIR ${SDL2_NO_DEFAULT_PATH_CMD} PATH_SUFFIXES lib ${VC_LIB_PATH_SUFFIX} PATHS ${SDL2MAIN_LIBRARY_PATHS} DOC "Where the SDL2main library can be found" ) unset(SDL2MAIN_LIBRARY_PATHS) endif() endif() # SDL2 may require threads on your system. # The Apple build may not need an explicit flag because one of the # frameworks may already provide it. # But for non-OSX systems, I will use the CMake Threads package. if(NOT APPLE) find_package(Threads QUIET) if(NOT Threads_FOUND) set(SDL2_THREADS_NOT_FOUND "Could NOT find Threads (Threads is required by SDL2).") if(SDL2_FIND_REQUIRED) message(FATAL_ERROR ${SDL2_THREADS_NOT_FOUND}) else() if(NOT SDL2_FIND_QUIETLY) message(STATUS ${SDL2_THREADS_NOT_FOUND}) endif() return() endif() unset(SDL2_THREADS_NOT_FOUND) endif() endif() # MinGW needs an additional link flag, -mwindows # It's total link flags should look like -lmingw32 -lSDL2main -lSDL2 -mwindows if(MINGW) set(MINGW32_LIBRARY mingw32 "-mwindows" CACHE STRING "link flags for MinGW") endif() if(SDL2_LIBRARY) # For SDL2main if(SDL2MAIN_LIBRARY AND NOT SDL2_BUILDING_LIBRARY) list(FIND SDL2_LIBRARIES "${SDL2MAIN_LIBRARY}" _SDL2_MAIN_INDEX) if(_SDL2_MAIN_INDEX EQUAL -1) set(SDL2_LIBRARIES "${SDL2MAIN_LIBRARY}" ${SDL2_LIBRARIES}) endif() unset(_SDL2_MAIN_INDEX) endif() # For OS X, SDL2 uses Cocoa as a backend so it must link to Cocoa. # CMake doesn't display the -framework Cocoa string in the UI even # though it actually is there if I modify a pre-used variable. # I think it has something to do with the CACHE STRING. # So I use a temporary variable until the end so I can set the # "real" variable in one-shot. if(APPLE) set(SDL2_LIBRARIES ${SDL2_LIBRARIES} -framework Cocoa) endif() # For threads, as mentioned Apple doesn't need this. # In fact, there seems to be a problem if I used the Threads package # and try using this line, so I'm just skipping it entirely for OS X. if(NOT APPLE) set(SDL2_LIBRARIES ${SDL2_LIBRARIES} ${CMAKE_THREAD_LIBS_INIT}) endif() # For MinGW library if(MINGW) set(SDL2_LIBRARIES ${MINGW32_LIBRARY} ${SDL2_LIBRARIES}) endif() endif() # Read SDL2 version if(SDL2_INCLUDE_DIR AND EXISTS "${SDL2_INCLUDE_DIR}/SDL_version.h") file(STRINGS "${SDL2_INCLUDE_DIR}/SDL_version.h" SDL2_VERSION_MAJOR_LINE REGEX "^#define[ \t]+SDL_MAJOR_VERSION[ \t]+[0-9]+$") file(STRINGS "${SDL2_INCLUDE_DIR}/SDL_version.h" SDL2_VERSION_MINOR_LINE REGEX "^#define[ \t]+SDL_MINOR_VERSION[ \t]+[0-9]+$") file(STRINGS "${SDL2_INCLUDE_DIR}/SDL_version.h" SDL2_VERSION_PATCH_LINE REGEX "^#define[ \t]+SDL_PATCHLEVEL[ \t]+[0-9]+$") string(REGEX REPLACE "^#define[ \t]+SDL_MAJOR_VERSION[ \t]+([0-9]+)$" "\\1" SDL2_VERSION_MAJOR "${SDL2_VERSION_MAJOR_LINE}") string(REGEX REPLACE "^#define[ \t]+SDL_MINOR_VERSION[ \t]+([0-9]+)$" "\\1" SDL2_VERSION_MINOR "${SDL2_VERSION_MINOR_LINE}") string(REGEX REPLACE "^#define[ \t]+SDL_PATCHLEVEL[ \t]+([0-9]+)$" "\\1" SDL2_VERSION_PATCH "${SDL2_VERSION_PATCH_LINE}") set(SDL2_VERSION_STRING ${SDL2_VERSION_MAJOR}.${SDL2_VERSION_MINOR}.${SDL2_VERSION_PATCH}) unset(SDL2_VERSION_MAJOR_LINE) unset(SDL2_VERSION_MINOR_LINE) unset(SDL2_VERSION_PATCH_LINE) unset(SDL2_VERSION_MAJOR) unset(SDL2_VERSION_MINOR) unset(SDL2_VERSION_PATCH) endif() include(FindPackageHandleStandardArgs) FIND_PACKAGE_HANDLE_STANDARD_ARGS(SDL2 REQUIRED_VARS SDL2_LIBRARY SDL2_INCLUDE_DIR VERSION_VAR SDL2_VERSION_STRING) if(SDL2MAIN_LIBRARY) set(FPHSA_NAME_MISMATCHED 1) FIND_PACKAGE_HANDLE_STANDARD_ARGS(SDL2main REQUIRED_VARS SDL2MAIN_LIBRARY SDL2_INCLUDE_DIR VERSION_VAR SDL2_VERSION_STRING) endif() mark_as_advanced(SDL2_PATH SDL2_NO_DEFAULT_PATH SDL2_LIBRARY SDL2MAIN_LIBRARY SDL2_INCLUDE_DIR SDL2_BUILDING_LIBRARY) # SDL2:: targets (SDL2::Core and SDL2::Main) if(SDL2_FOUND) # SDL2::Core target if(SDL2_LIBRARY AND NOT TARGET SDL2::Core) add_library(SDL2::Core UNKNOWN IMPORTED) set_target_properties(SDL2::Core PROPERTIES IMPORTED_LOCATION "${SDL2_LIBRARY}" INTERFACE_INCLUDE_DIRECTORIES "${SDL2_INCLUDE_DIR}") if(APPLE) # For OS X, SDL2 uses Cocoa as a backend so it must link to Cocoa. # For more details, please see above. set_property(TARGET SDL2::Core APPEND PROPERTY INTERFACE_LINK_OPTIONS -framework Cocoa) else() # For threads, as mentioned Apple doesn't need this. # For more details, please see above. set_property(TARGET SDL2::Core APPEND PROPERTY INTERFACE_LINK_LIBRARIES Threads::Threads) endif() endif() # SDL2::Main target # Applications should link to SDL2::Main instead of SDL2::Core # For more details, please see above. if(NOT SDL2_BUILDING_LIBRARY AND NOT TARGET SDL2::Main) if(SDL2_INCLUDE_DIR MATCHES ".framework" OR NOT SDL2MAIN_LIBRARY) add_library(SDL2::Main INTERFACE IMPORTED) set_property(TARGET SDL2::Main PROPERTY INTERFACE_LINK_LIBRARIES SDL2::Core) elseif(SDL2MAIN_LIBRARY) # MinGW requires that the mingw32 library is specified before the # libSDL2main.a static library when linking. # The SDL2::MainInternal target is used internally to make sure that # CMake respects this condition. add_library(SDL2::MainInternal UNKNOWN IMPORTED) set_property(TARGET SDL2::MainInternal PROPERTY IMPORTED_LOCATION "${SDL2MAIN_LIBRARY}") set_property(TARGET SDL2::MainInternal PROPERTY INTERFACE_LINK_LIBRARIES SDL2::Core) add_library(SDL2::Main INTERFACE IMPORTED) if(MINGW) # MinGW needs an additional link flag '-mwindows' and link to mingw32 set_property(TARGET SDL2::Main PROPERTY INTERFACE_LINK_LIBRARIES "mingw32" "-mwindows") endif() set_property(TARGET SDL2::Main APPEND PROPERTY INTERFACE_LINK_LIBRARIES SDL2::MainInternal) endif() endif() endif() sdl12-compat-1.2.74/include/SDL/SDL.h0000664000000000000000000000413615125533266013617 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_H #define _SDL_H #include "SDL_main.h" #include "SDL_stdinc.h" #include "SDL_audio.h" #include "SDL_cdrom.h" #include "SDL_cpuinfo.h" #include "SDL_endian.h" #include "SDL_error.h" #include "SDL_events.h" #include "SDL_loadso.h" #include "SDL_mutex.h" #include "SDL_rwops.h" #include "SDL_thread.h" #include "SDL_timer.h" #include "SDL_video.h" #include "SDL_version.h" #include "begin_code.h" #define SDL_INIT_TIMER 0x00000001 #define SDL_INIT_AUDIO 0x00000010 #define SDL_INIT_VIDEO 0x00000020 #define SDL_INIT_CDROM 0x00000100 #define SDL_INIT_JOYSTICK 0x00000200 #define SDL_INIT_NOPARACHUTE 0x00100000 #define SDL_INIT_EVENTTHREAD 0x01000000 #define SDL_INIT_EVERYTHING 0x0000FFFF extern DECLSPEC int SDLCALL SDL_Init(Uint32 flags); extern DECLSPEC int SDLCALL SDL_InitSubSystem(Uint32 flags); extern DECLSPEC void SDLCALL SDL_QuitSubSystem(Uint32 flags); extern DECLSPEC Uint32 SDLCALL SDL_WasInit(Uint32 flags); extern DECLSPEC void SDLCALL SDL_Quit(void); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_active.h0000664000000000000000000000261615125533266015153 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_active_h #define _SDL_active_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" #define SDL_APPMOUSEFOCUS 0x01 #define SDL_APPINPUTFOCUS 0x02 #define SDL_APPACTIVE 0x04 extern DECLSPEC Uint8 SDLCALL SDL_GetAppState(void); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_audio.h0000664000000000000000000000723715125533266015005 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_audio_h #define _SDL_audio_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_endian.h" #include "SDL_mutex.h" #include "SDL_thread.h" #include "SDL_rwops.h" #include "begin_code.h" typedef struct SDL_AudioSpec { int freq; Uint16 format; Uint8 channels; Uint8 silence; Uint16 samples; Uint16 padding; Uint32 size; void (SDLCALL *callback)(void *userdata, Uint8 *stream, int len); void *userdata; } SDL_AudioSpec; #define AUDIO_U8 0x0008 #define AUDIO_S8 0x8008 #define AUDIO_U16LSB 0x0010 #define AUDIO_S16LSB 0x8010 #define AUDIO_U16MSB 0x1010 #define AUDIO_S16MSB 0x9010 #define AUDIO_U16 AUDIO_U16LSB #define AUDIO_S16 AUDIO_S16LSB #if SDL_BYTEORDER == SDL_LIL_ENDIAN #define AUDIO_U16SYS AUDIO_U16LSB #define AUDIO_S16SYS AUDIO_S16LSB #else #define AUDIO_U16SYS AUDIO_U16MSB #define AUDIO_S16SYS AUDIO_S16MSB #endif typedef struct SDL_AudioCVT { int needed; Uint16 src_format; Uint16 dst_format; double rate_incr; Uint8 *buf; int len; int len_cvt; int len_mult; double len_ratio; void (SDLCALL *filters[10])(struct SDL_AudioCVT *cvt, Uint16 format); int filter_index; } SDL_AudioCVT; typedef enum SDL_audiostatus { SDL_AUDIO_STOPPED, SDL_AUDIO_PLAYING, SDL_AUDIO_PAUSED } SDL_audiostatus; #define SDL_MIX_MAXVOLUME 128 extern DECLSPEC int SDLCALL SDL_AudioInit(const char *driver_name); extern DECLSPEC void SDLCALL SDL_AudioQuit(void); extern DECLSPEC char * SDLCALL SDL_AudioDriverName(char *namebuf, int maxlen); extern DECLSPEC int SDLCALL SDL_OpenAudio(SDL_AudioSpec *desired, SDL_AudioSpec *obtained); extern DECLSPEC void SDLCALL SDL_PauseAudio(int pause_on); extern DECLSPEC void SDLCALL SDL_CloseAudio(void); extern DECLSPEC SDL_audiostatus SDLCALL SDL_GetAudioStatus(void); extern DECLSPEC void SDLCALL SDL_LockAudio(void); extern DECLSPEC void SDLCALL SDL_UnlockAudio(void); extern DECLSPEC SDL_AudioSpec * SDLCALL SDL_LoadWAV_RW(SDL_RWops *src, int freesrc, SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); extern DECLSPEC void SDLCALL SDL_FreeWAV(Uint8 *audio_buf); extern DECLSPEC int SDLCALL SDL_BuildAudioCVT(SDL_AudioCVT *cvt, Uint16 src_format, Uint8 src_channels, int src_rate, Uint16 dst_format, Uint8 dst_channels, int dst_rate); extern DECLSPEC int SDLCALL SDL_ConvertAudio(SDL_AudioCVT *cvt); extern DECLSPEC void SDLCALL SDL_MixAudio(Uint8 *dst, const Uint8 *src, Uint32 len, int volume); #define SDL_LoadWAV(file, spec, audio_buf, audio_len) SDL_LoadWAV_RW(SDL_RWFromFile(file, "rb"),1, spec,audio_buf,audio_len) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_byteorder.h0000664000000000000000000000227415125533266015677 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* This is just a compatibility header in real 1.2, too. */ #include "SDL_endian.h" sdl12-compat-1.2.74/include/SDL/SDL_cdrom.h0000664000000000000000000000536715125533266015012 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_cdrom_h #define _SDL_cdrom_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" #define SDL_MAX_TRACKS 99 typedef enum CDstatus { CD_TRAYEMPTY, CD_STOPPED, CD_PLAYING, CD_PAUSED, CD_ERROR = -1 } CDstatus; typedef struct SDL_CDtrack { Uint8 id; Uint8 type; Uint16 unused; Uint32 length; Uint32 offset; } SDL_CDtrack; typedef struct SDL_CD { int id; CDstatus status; int numtracks; int cur_track; int cur_frame; SDL_CDtrack track[SDL_MAX_TRACKS+1]; } SDL_CD; #define SDL_AUDIO_TRACK 0x00 #define SDL_DATA_TRACK 0x04 #define CD_INDRIVE(status) (status > CD_TRAYEMPTY) #define CD_FPS 75 #define FRAMES_TO_MSF(f, M,S,F) { \ int value = f; \ *(F) = value % CD_FPS; \ value /= CD_FPS; \ *(S) = value % 60; \ value /= 60; \ *(M) = value; \ } #define MSF_TO_FRAMES(M, S, F) ((M) * 60 * CD_FPS + (S) * CD_FPS + (F)) extern DECLSPEC int SDLCALL SDL_CDNumDrives(void); extern DECLSPEC const char * SDLCALL SDL_CDName(int drive); extern DECLSPEC SDL_CD * SDLCALL SDL_CDOpen(int drive); extern DECLSPEC CDstatus SDLCALL SDL_CDStatus(SDL_CD *cdrom); extern DECLSPEC int SDLCALL SDL_CDPlayTracks(SDL_CD *cdrom, int start_track, int start_frame, int ntracks, int nframes); extern DECLSPEC int SDLCALL SDL_CDPlay(SDL_CD *cdrom, int start, int length); extern DECLSPEC int SDLCALL SDL_CDPause(SDL_CD *cdrom); extern DECLSPEC int SDLCALL SDL_CDResume(SDL_CD *cdrom); extern DECLSPEC int SDLCALL SDL_CDStop(SDL_CD *cdrom); extern DECLSPEC int SDLCALL SDL_CDEject(SDL_CD *cdrom); extern DECLSPEC void SDLCALL SDL_CDClose(SDL_CD *cdrom); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_config.h0000664000000000000000000001256515125533266015151 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* This is all kinda dicey. Just pretend we have most of these no matter what. Hopefully most apps don't actually rely on this. :/ These defines would need to be correct (and usually generated by a configure script) if these headers were to be used to build the real SDL 1.2, but they are only intended for building apps against sdl12-compat. */ #ifndef _SDL_config_h #define _SDL_config_h #include "SDL_platform.h" /* Make sure that this isn't included by Visual C++ */ #if defined(_MSC_VER) && (_MSC_VER < 1600) typedef __int8 int8_t; typedef unsigned __int8 uint8_t; typedef __int16 int16_t; typedef unsigned __int16 uint16_t; typedef __int32 int32_t; typedef unsigned __int32 uint32_t; typedef __int64 int64_t; typedef unsigned __int64 uint64_t; #else #include #define HAVE_STDINT_H 1 #endif #define SDL_HAS_64BIT_TYPE 1 #include #define HAVE_STDARG_H 1 #define HAVE_STDDEF_H 1 /* for now, let's try and say everything that we care about that isn't Windows has these C runtime functions available. We're trying to avoid a configure stage, though. Send patches if your platform lacks something. */ #ifndef _WIN32 #define HAVE_LIBC 1 #define HAVE_SYS_TYPES_H 1 #define HAVE_STDIO_H 1 #define STDC_HEADERS 1 #define HAVE_STDLIB_H 1 #define HAVE_MEMORY_H 1 #define HAVE_STRING_H 1 #define HAVE_STRINGS_H 1 #define HAVE_INTTYPES_H 1 #define HAVE_CTYPE_H 1 #define HAVE_MATH_H 1 #endif #if defined(__linux__) || defined(__sun) #define HAVE_ALLOCA_H 1 #endif #if defined(__unix__) || defined(__APPLE__) #define HAVE_ICONV_H 1 #define HAVE_SIGNAL_H 1 #endif #if defined(__powerpc__) #define HAVE_ALTIVEC_H 1 #endif /* SDL 1.2 never defines these for Windows to force SDL's internal implementation. */ #ifndef _WIN32 #define HAVE_GETENV 1 #define HAVE_PUTENV 1 #define HAVE_UNSETENV 1 #endif /* for now, let's try and say everything that we care about that isn't Windows has these C runtime functions available. We're trying to avoid a configure stage, though. Send patches if your platform lacks something. */ #ifndef _WIN32 #define HAVE_MALLOC 1 #define HAVE_CALLOC 1 #define HAVE_REALLOC 1 #define HAVE_FREE 1 #define HAVE_ALLOCA 1 #define HAVE_QSORT 1 #define HAVE_ABS 1 #define HAVE_MEMSET 1 #define HAVE_MEMCPY 1 #define HAVE_MEMMOVE 1 #define HAVE_MEMCMP 1 #define HAVE_STRLEN 1 #define HAVE_STRDUP 1 #define HAVE_STRCHR 1 #define HAVE_STRRCHR 1 #define HAVE_STRSTR 1 #define HAVE_STRTOL 1 #define HAVE_STRTOUL 1 #define HAVE_STRTOLL 1 #define HAVE_STRTOULL 1 #define HAVE_STRTOD 1 #define HAVE_STRCMP 1 #define HAVE_STRNCMP 1 #define HAVE_STRCASECMP 1 #define HAVE_STRNCASECMP 1 #define HAVE_SSCANF 1 #ifndef __WATCOMC__ /* apparently Watcom C's snprintf is not to be trusted... */ #define HAVE_SNPRINTF 1 #define HAVE_VSNPRINTF 1 #endif #endif #if defined(__GLIBC__) /* glibc certainly includes this, send patches if your OS does too */ #define HAVE_MALLOC_H 1 #endif /* things that aren't necessarily in Linux, some are MSVC C runtime, some are BSD. Send patches. */ #if 0 #define HAVE_BCOPY 1 #define HAVE_ATOI 1 #define HAVE_ATOF 1 #define HAVE_STRLCAT 1 #define HAVE__STRREV 1 #define HAVE__STRUPR 1 #define HAVE__STRLWR 1 #define HAVE_INDEX 1 #define HAVE_RINDEX 1 #define HAVE_ITOA 1 #define HAVE__LTOA 1 #define HAVE__UITOA 1 #define HAVE__ULTOA 1 #define HAVE__I64TOA 1 #define HAVE__UI64TOA 1 #define HAVE__STRTOI64 1 #define HAVE__STRTOUI64 1 #define HAVE__STRICMP 1 #define HAVE__STRNICMP 1 #define HAVE_GETAUXVAL 1 #define HAVE_ELF_AUX_INFO 1 #define HAVE_NANOSLEEP 1 #define HAVE_CLOCK_GETTIME 1 #define HAVE_GETPAGESIZE 1 #define HAVE_MPROTECT 1 #define HAVE_SEM_TIMEDWAIT 1 #endif #if defined(__unix__) || defined(__APPLE__) #define HAVE_ICONV 1 #define HAVE_SIGACTION 1 #define HAVE_SA_SIGACTION 1 #define HAVE_SETJMP 1 #endif #if defined(__APPLE__) || defined(__FreeBSD__) || defined(__OpenBSD__) /* macos and BSDs have this. */ #define HAVE_STRLCPY 1 #endif /* Don't define most of the SDL backends, under the assumption checking for these against the headers won't work anyhow. The exception is the X11 backend; you need its define to know if you can use its syswm interface. */ # if defined(__unix__) && !defined(__APPLE__) && defined(__has_include) # if __has_include() # define SDL_VIDEO_DRIVER_X11 1 # endif # endif #endif /* _SDL_config_h */ sdl12-compat-1.2.74/include/SDL/SDL_copying.h0000664000000000000000000000240015125533266015337 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* this is just an empty header in SDL 1.2 that shows the copyright, which was LGPL 2.1; in sdl12-compat, the library and headers are zlib-licensed. */ sdl12-compat-1.2.74/include/SDL/SDL_cpuinfo.h0000664000000000000000000000322215125533266015335 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_cpuinfo_h #define _SDL_cpuinfo_h #include "SDL_stdinc.h" #include "begin_code.h" extern DECLSPEC SDL_bool SDLCALL SDL_HasRDTSC(void); extern DECLSPEC SDL_bool SDLCALL SDL_HasMMX(void); extern DECLSPEC SDL_bool SDLCALL SDL_HasMMXExt(void); extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNow(void); extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNowExt(void); extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE(void); extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE2(void); extern DECLSPEC SDL_bool SDLCALL SDL_HasAltiVec(void); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_endian.h0000664000000000000000000002027115125533266015133 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_endian_h #define _SDL_endian_h #include "SDL_stdinc.h" #if defined(_MSC_VER) && (_MSC_VER >= 1400) #include #endif /* These are all lifted out of SDL2's zlib-licensed headers. */ #define SDL_LIL_ENDIAN 1234 #define SDL_BIG_ENDIAN 4321 #ifndef SDL_BYTEORDER /* Not defined in SDL_config.h? */ #ifdef __linux__ #include #define SDL_BYTEORDER __BYTE_ORDER #elif defined(__sun) && defined(__SVR4) /* Solaris */ #include #if defined(_LITTLE_ENDIAN) #define SDL_BYTEORDER SDL_LIL_ENDIAN #elif defined(_BIG_ENDIAN) #define SDL_BYTEORDER SDL_BIG_ENDIAN #else #error Unsupported endianness #endif #elif defined(__OpenBSD__) || defined(__DragonFly__) #include #define SDL_BYTEORDER BYTE_ORDER #elif defined(__FreeBSD__) || defined(__NetBSD__) #include #define SDL_BYTEORDER BYTE_ORDER /* predefs from newer gcc and clang versions: */ #elif defined(__ORDER_LITTLE_ENDIAN__) && defined(__ORDER_BIG_ENDIAN__) && defined(__BYTE_ORDER__) #if (__BYTE_ORDER__ == __ORDER_LITTLE_ENDIAN__) #define SDL_BYTEORDER SDL_LIL_ENDIAN #elif (__BYTE_ORDER__ == __ORDER_BIG_ENDIAN__) #define SDL_BYTEORDER SDL_BIG_ENDIAN #else #error Unsupported endianness #endif /**/ #else #if defined(__hppa__) || \ defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \ (defined(__MIPS__) && defined(__MIPSEB__)) || \ defined(__ppc__) || defined(__POWERPC__) || defined(__powerpc__) || defined(__PPC__) || \ defined(__sparc__) || defined(__sparc) #define SDL_BYTEORDER SDL_BIG_ENDIAN #else #define SDL_BYTEORDER SDL_LIL_ENDIAN #endif #endif /* __linux__ */ #endif /* !SDL_BYTEORDER */ #include "begin_code.h" /* various modern compilers may have builtin swap */ #if defined (__has_builtin) #define _SDL_HAS_BUILTIN(x) __has_builtin(x) #else #define _SDL_HAS_BUILTIN(x) 0 #endif #if defined(__GNUC__) || defined(__clang__) # define HAS_BUILTIN_BSWAP16 (_SDL_HAS_BUILTIN(__builtin_bswap16)) || \ (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 8)) # define HAS_BUILTIN_BSWAP32 (_SDL_HAS_BUILTIN(__builtin_bswap32)) || \ (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 3)) # define HAS_BUILTIN_BSWAP64 (_SDL_HAS_BUILTIN(__builtin_bswap64)) || \ (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 3)) /* this one is broken */ # define HAS_BROKEN_BSWAP (__GNUC__ == 2 && __GNUC_MINOR__ <= 95) #else # define HAS_BUILTIN_BSWAP16 0 # define HAS_BUILTIN_BSWAP32 0 # define HAS_BUILTIN_BSWAP64 0 # define HAS_BROKEN_BSWAP 0 #endif #if HAS_BUILTIN_BSWAP16 #define SDL_Swap16(x) __builtin_bswap16(x) #elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_ushort) #define SDL_Swap16(x) _byteswap_ushort(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP static __inline__ Uint16 SDL_Swap16(Uint16 x) { __asm__("xchgb %b0,%h0": "=q"(x):"0"(x)); return x; } #elif defined(__x86_64__) static __inline__ Uint16 SDL_Swap16(Uint16 x) { __asm__("xchgb %b0,%h0": "=Q"(x):"0"(x)); return x; } #elif (defined(__powerpc__) || defined(__ppc__)) static __inline__ Uint16 SDL_Swap16(Uint16 x) { int result; __asm__("rlwimi %0,%2,8,16,23": "=&r"(result):"0"(x >> 8), "r"(x)); return (Uint16)result; } #elif (defined(__m68k__) && !defined(__mcoldfire__)) static __inline__ Uint16 SDL_Swap16(Uint16 x) { __asm__("rorw #8,%0": "=d"(x): "0"(x):"cc"); return x; } #elif defined(__WATCOMC__) && defined(__386__) extern __inline Uint16 SDL_Swap16(Uint16); #pragma aux SDL_Swap16 = \ "xchg al, ah" \ parm [ax] \ modify [ax]; #else static __inline__ Uint16 SDL_Swap16(Uint16 x) { return SDL_static_cast(Uint16, ((x << 8) | (x >> 8))); } #endif #if HAS_BUILTIN_BSWAP32 #define SDL_Swap32(x) __builtin_bswap32(x) #elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_ulong) #define SDL_Swap32(x) _byteswap_ulong(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP static __inline__ Uint32 SDL_Swap32(Uint32 x) { __asm__("bswap %0": "=r"(x):"0"(x)); return x; } #elif defined(__x86_64__) static __inline__ Uint32 SDL_Swap32(Uint32 x) { __asm__("bswapl %0": "=r"(x):"0"(x)); return x; } #elif (defined(__powerpc__) || defined(__ppc__)) static __inline__ Uint32 SDL_Swap32(Uint32 x) { Uint32 result; __asm__("rlwimi %0,%2,24,16,23": "=&r"(result): "0" (x>>24), "r"(x)); __asm__("rlwimi %0,%2,8,8,15" : "=&r"(result): "0" (result), "r"(x)); __asm__("rlwimi %0,%2,24,0,7" : "=&r"(result): "0" (result), "r"(x)); return result; } #elif (defined(__m68k__) && !defined(__mcoldfire__)) static __inline__ Uint32 SDL_Swap32(Uint32 x) { __asm__("rorw #8,%0\n\tswap %0\n\trorw #8,%0": "=d"(x): "0"(x):"cc"); return x; } #elif defined(__WATCOMC__) && defined(__386__) extern __inline Uint32 SDL_Swap32(Uint32); #pragma aux SDL_Swap32 = \ "bswap eax" \ parm [eax] \ modify [eax]; #else static __inline__ Uint32 SDL_Swap32(Uint32 x) { return SDL_static_cast(Uint32, ((x << 24) | ((x << 8) & 0x00FF0000) | ((x >> 8) & 0x0000FF00) | (x >> 24))); } #endif #if HAS_BUILTIN_BSWAP64 #define SDL_Swap64(x) __builtin_bswap64(x) #elif (defined(_MSC_VER) && (_MSC_VER >= 1400)) && !defined(__ICL) #pragma intrinsic(_byteswap_uint64) #define SDL_Swap64(x) _byteswap_uint64(x) #elif defined(__i386__) && !HAS_BROKEN_BSWAP static __inline__ Uint64 SDL_Swap64(Uint64 x) { union { struct { Uint32 a, b; } s; Uint64 u; } v; v.u = x; __asm__("bswapl %0 ; bswapl %1 ; xchgl %0,%1" : "=r"(v.s.a), "=r"(v.s.b) : "0" (v.s.a), "1"(v.s.b)); return v.u; } #elif defined(__x86_64__) static __inline__ Uint64 SDL_Swap64(Uint64 x) { __asm__("bswapq %0": "=r"(x):"0"(x)); return x; } #elif defined(__WATCOMC__) && defined(__386__) extern __inline Uint64 SDL_Swap64(Uint64); #pragma aux SDL_Swap64 = \ "bswap eax" \ "bswap edx" \ "xchg eax,edx" \ parm [eax edx] \ modify [eax edx]; #else static __inline__ Uint64 SDL_Swap64(Uint64 x) { Uint32 hi, lo; /* Separate into high and low 32-bit values and swap them */ lo = SDL_static_cast(Uint32, x & 0xFFFFFFFF); x >>= 32; hi = SDL_static_cast(Uint32, x & 0xFFFFFFFF); x = SDL_Swap32(lo); x <<= 32; x |= SDL_Swap32(hi); return (x); } #endif /* remove extra macros */ #undef HAS_BROKEN_BSWAP #undef HAS_BUILTIN_BSWAP16 #undef HAS_BUILTIN_BSWAP32 #undef HAS_BUILTIN_BSWAP64 #undef _SDL_HAS_BUILTIN /** * \name Swap to native * Byteswap item from the specified endianness to the native endianness. */ /* @{ */ #if SDL_BYTEORDER == SDL_LIL_ENDIAN #define SDL_SwapLE16(X) (X) #define SDL_SwapLE32(X) (X) #define SDL_SwapLE64(X) (X) #define SDL_SwapBE16(X) SDL_Swap16(X) #define SDL_SwapBE32(X) SDL_Swap32(X) #define SDL_SwapBE64(X) SDL_Swap64(X) #else #define SDL_SwapLE16(X) SDL_Swap16(X) #define SDL_SwapLE32(X) SDL_Swap32(X) #define SDL_SwapLE64(X) SDL_Swap64(X) #define SDL_SwapBE16(X) (X) #define SDL_SwapBE32(X) (X) #define SDL_SwapBE64(X) (X) #endif /* @} *//* Swap to native */ #include "close_code.h" #endif /* _SDL_endian_h */ sdl12-compat-1.2.74/include/SDL/SDL_error.h0000664000000000000000000000330615125533266015026 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_error_h #define _SDL_error_h #include "SDL_stdinc.h" #include "begin_code.h" typedef enum SDL_errorcode { SDL_ENOMEM, SDL_EFREAD, SDL_EFWRITE, SDL_EFSEEK, SDL_UNSUPPORTED, SDL_LASTERROR } SDL_errorcode; extern DECLSPEC void SDLCALL SDL_SetError(const char *fmt, ...); extern DECLSPEC char * SDLCALL SDL_GetError(void); extern DECLSPEC void SDLCALL SDL_ClearError(void); extern DECLSPEC void SDLCALL SDL_Error(SDL_errorcode code); #define SDL_OutOfMemory() SDL_Error(SDL_ENOMEM) #define SDL_Unsupported() SDL_Error(SDL_UNSUPPORTED) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_events.h0000664000000000000000000001412615125533266015203 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_events_h #define _SDL_events_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_active.h" #include "SDL_keyboard.h" #include "SDL_mouse.h" #include "SDL_joystick.h" #include "SDL_quit.h" #include "begin_code.h" typedef enum SDL_EventType { SDL_NOEVENT, SDL_ACTIVEEVENT, SDL_KEYDOWN, SDL_KEYUP, SDL_MOUSEMOTION, SDL_MOUSEBUTTONDOWN, SDL_MOUSEBUTTONUP, SDL_JOYAXISMOTION, SDL_JOYBALLMOTION, SDL_JOYHATMOTION, SDL_JOYBUTTONDOWN, SDL_JOYBUTTONUP, SDL_QUIT, SDL_SYSWMEVENT, SDL_EVENT_RESERVEDA, SDL_EVENT_RESERVEDB, SDL_VIDEORESIZE, SDL_VIDEOEXPOSE, SDL_EVENT_RESERVED2, SDL_EVENT_RESERVED3, SDL_EVENT_RESERVED4, SDL_EVENT_RESERVED5, SDL_EVENT_RESERVED6, SDL_EVENT_RESERVED7, SDL_USEREVENT = 24, SDL_NUMEVENTS = 32 } SDL_EventType; #define SDL_EVENTMASK(X) (1<<(X)) #define SDL_ALLEVENTS 0xFFFFFFFF typedef enum SDL_EventMask { SDL_ACTIVEEVENTMASK = SDL_EVENTMASK(SDL_ACTIVEEVENT), SDL_KEYDOWNMASK = SDL_EVENTMASK(SDL_KEYDOWN), SDL_KEYUPMASK = SDL_EVENTMASK(SDL_KEYUP), SDL_KEYEVENTMASK = SDL_EVENTMASK(SDL_KEYDOWN)|SDL_EVENTMASK(SDL_KEYUP), SDL_MOUSEMOTIONMASK = SDL_EVENTMASK(SDL_MOUSEMOTION), SDL_MOUSEBUTTONDOWNMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN), SDL_MOUSEBUTTONUPMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONUP), SDL_MOUSEEVENTMASK = SDL_EVENTMASK(SDL_MOUSEMOTION)|SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN)|SDL_EVENTMASK(SDL_MOUSEBUTTONUP), SDL_JOYAXISMOTIONMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION), SDL_JOYBALLMOTIONMASK = SDL_EVENTMASK(SDL_JOYBALLMOTION), SDL_JOYHATMOTIONMASK = SDL_EVENTMASK(SDL_JOYHATMOTION), SDL_JOYBUTTONDOWNMASK = SDL_EVENTMASK(SDL_JOYBUTTONDOWN), SDL_JOYBUTTONUPMASK = SDL_EVENTMASK(SDL_JOYBUTTONUP), SDL_JOYEVENTMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION)|SDL_EVENTMASK(SDL_JOYBALLMOTION)|SDL_EVENTMASK(SDL_JOYHATMOTION)|SDL_EVENTMASK(SDL_JOYBUTTONDOWN)|SDL_EVENTMASK(SDL_JOYBUTTONUP), SDL_VIDEORESIZEMASK = SDL_EVENTMASK(SDL_VIDEORESIZE), SDL_VIDEOEXPOSEMASK = SDL_EVENTMASK(SDL_VIDEOEXPOSE), SDL_QUITMASK = SDL_EVENTMASK(SDL_QUIT), SDL_SYSWMEVENTMASK = SDL_EVENTMASK(SDL_SYSWMEVENT) } SDL_EventMask; typedef struct SDL_ActiveEvent { Uint8 type; Uint8 gain; Uint8 state; } SDL_ActiveEvent; typedef struct SDL_KeyboardEvent { Uint8 type; Uint8 which; Uint8 state; SDL_keysym keysym; } SDL_KeyboardEvent; typedef struct SDL_MouseMotionEvent { Uint8 type; Uint8 which; Uint8 state; Uint16 x; Uint16 y; Sint16 xrel; Sint16 yrel; } SDL_MouseMotionEvent; typedef struct SDL_MouseButtonEvent { Uint8 type; Uint8 which; Uint8 button; Uint8 state; Uint16 x; Uint16 y; } SDL_MouseButtonEvent; typedef struct SDL_JoyAxisEvent { Uint8 type; Uint8 which; Uint8 axis; Sint16 value; } SDL_JoyAxisEvent; typedef struct SDL_JoyBallEvent { Uint8 type; Uint8 which; Uint8 ball; Sint16 xrel; Sint16 yrel; } SDL_JoyBallEvent; typedef struct SDL_JoyHatEvent { Uint8 type; Uint8 which; Uint8 hat; Uint8 value; } SDL_JoyHatEvent; typedef struct SDL_JoyButtonEvent { Uint8 type; Uint8 which; Uint8 button; Uint8 state; } SDL_JoyButtonEvent; typedef struct SDL_ResizeEvent { Uint8 type; int w; int h; } SDL_ResizeEvent; typedef struct SDL_ExposeEvent { Uint8 type; } SDL_ExposeEvent; typedef struct SDL_QuitEvent { Uint8 type; } SDL_QuitEvent; typedef struct SDL_UserEvent { Uint8 type; int code; void *data1; void *data2; } SDL_UserEvent; struct SDL_SysWMmsg; typedef struct SDL_SysWMmsg SDL_SysWMmsg; typedef struct SDL_SysWMEvent { Uint8 type; struct SDL_SysWMmsg *msg; } SDL_SysWMEvent; typedef union SDL_Event { Uint8 type; SDL_ActiveEvent active; SDL_KeyboardEvent key; SDL_MouseMotionEvent motion; SDL_MouseButtonEvent button; SDL_JoyAxisEvent jaxis; SDL_JoyBallEvent jball; SDL_JoyHatEvent jhat; SDL_JoyButtonEvent jbutton; SDL_ResizeEvent resize; SDL_ExposeEvent expose; SDL_QuitEvent quit; SDL_UserEvent user; SDL_SysWMEvent syswm; } SDL_Event; typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); typedef enum SDL_eventaction { SDL_ADDEVENT, SDL_PEEKEVENT, SDL_GETEVENT } SDL_eventaction; extern DECLSPEC void SDLCALL SDL_PumpEvents(void); extern DECLSPEC int SDLCALL SDL_PeepEvents(SDL_Event *events, int numevents, SDL_eventaction action, Uint32 mask); extern DECLSPEC int SDLCALL SDL_PollEvent(SDL_Event *event); extern DECLSPEC int SDLCALL SDL_WaitEvent(SDL_Event *event); extern DECLSPEC int SDLCALL SDL_PushEvent(SDL_Event *event); extern DECLSPEC void SDLCALL SDL_SetEventFilter(SDL_EventFilter filter); extern DECLSPEC SDL_EventFilter SDLCALL SDL_GetEventFilter(void); extern DECLSPEC Uint8 SDLCALL SDL_EventState(Uint8 type, int state); #define SDL_RELEASED 0 #define SDL_PRESSED 1 #define SDL_QUERY -1 #define SDL_IGNORE 0 #define SDL_DISABLE 0 #define SDL_ENABLE 1 #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_getenv.h0000664000000000000000000000232715125533266015167 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* this is a compatibility header, even in 1.2, that just forwards to SDL_stdinc.h */ #include "SDL_stdinc.h" sdl12-compat-1.2.74/include/SDL/SDL_joystick.h0000664000000000000000000000531115125533266015532 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_joystick_h #define _SDL_joystick_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" #define SDL_HAT_CENTERED 0x00 #define SDL_HAT_UP 0x01 #define SDL_HAT_RIGHT 0x02 #define SDL_HAT_DOWN 0x04 #define SDL_HAT_LEFT 0x08 #define SDL_HAT_RIGHTUP 0x03 #define SDL_HAT_RIGHTDOWN 0x06 #define SDL_HAT_LEFTUP 0x09 #define SDL_HAT_LEFTDOWN 0x0C typedef struct _SDL_Joystick SDL_Joystick; extern DECLSPEC int SDLCALL SDL_NumJoysticks(void); extern DECLSPEC const char * SDLCALL SDL_JoystickName(int device_index); extern DECLSPEC SDL_Joystick * SDLCALL SDL_JoystickOpen(int device_index); extern DECLSPEC int SDLCALL SDL_JoystickOpened(int device_index); extern DECLSPEC int SDLCALL SDL_JoystickIndex(SDL_Joystick *joystick); extern DECLSPEC int SDLCALL SDL_JoystickNumAxes(SDL_Joystick *joystick); extern DECLSPEC int SDLCALL SDL_JoystickNumBalls(SDL_Joystick *joystick); extern DECLSPEC int SDLCALL SDL_JoystickNumHats(SDL_Joystick *joystick); extern DECLSPEC int SDLCALL SDL_JoystickNumButtons(SDL_Joystick *joystick); extern DECLSPEC void SDLCALL SDL_JoystickUpdate(void); extern DECLSPEC int SDLCALL SDL_JoystickEventState(int state); extern DECLSPEC Sint16 SDLCALL SDL_JoystickGetAxis(SDL_Joystick *joystick, int axis); extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetHat(SDL_Joystick *joystick, int hat); extern DECLSPEC int SDLCALL SDL_JoystickGetBall(SDL_Joystick *joystick, int ball, int *dx, int *dy); extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetButton(SDL_Joystick *joystick, int button); extern DECLSPEC void SDLCALL SDL_JoystickClose(SDL_Joystick *joystick); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_keyboard.h0000664000000000000000000000367515125533266015506 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_keyboard_h #define _SDL_keyboard_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_keysym.h" #include "begin_code.h" typedef struct SDL_keysym { Uint8 scancode; SDLKey sym; SDLMod mod; Uint16 unicode; } SDL_keysym; #define SDL_ALL_HOTKEYS 0xFFFFFFFF #define SDL_DEFAULT_REPEAT_DELAY 500 #define SDL_DEFAULT_REPEAT_INTERVAL 30 extern DECLSPEC Uint8 * SDLCALL SDL_GetKeyState(int *numkeys); extern DECLSPEC SDLMod SDLCALL SDL_GetModState(void); extern DECLSPEC void SDLCALL SDL_SetModState(SDLMod modstate); extern DECLSPEC char * SDLCALL SDL_GetKeyName(SDLKey key); extern DECLSPEC int SDLCALL SDL_EnableKeyRepeat(int delay, int interval); extern DECLSPEC void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval); extern DECLSPEC int SDLCALL SDL_EnableUNICODE(int enable); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_keysym.h0000664000000000000000000001551515125533266015223 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_keysym_h #define _SDL_keysym_h typedef enum SDLKey { SDLK_UNKNOWN = 0, SDLK_FIRST = 0, SDLK_BACKSPACE = 8, SDLK_TAB = 9, SDLK_CLEAR = 12, SDLK_RETURN = 13, SDLK_PAUSE = 19, SDLK_ESCAPE = 27, SDLK_SPACE = 32, SDLK_EXCLAIM = 33, SDLK_QUOTEDBL = 34, SDLK_HASH = 35, SDLK_DOLLAR = 36, SDLK_AMPERSAND = 38, SDLK_QUOTE = 39, SDLK_LEFTPAREN = 40, SDLK_RIGHTPAREN = 41, SDLK_ASTERISK = 42, SDLK_PLUS = 43, SDLK_COMMA = 44, SDLK_MINUS = 45, SDLK_PERIOD = 46, SDLK_SLASH = 47, SDLK_0 = 48, SDLK_1 = 49, SDLK_2 = 50, SDLK_3 = 51, SDLK_4 = 52, SDLK_5 = 53, SDLK_6 = 54, SDLK_7 = 55, SDLK_8 = 56, SDLK_9 = 57, SDLK_COLON = 58, SDLK_SEMICOLON = 59, SDLK_LESS = 60, SDLK_EQUALS = 61, SDLK_GREATER = 62, SDLK_QUESTION = 63, SDLK_AT = 64, SDLK_LEFTBRACKET = 91, SDLK_BACKSLASH = 92, SDLK_RIGHTBRACKET = 93, SDLK_CARET = 94, SDLK_UNDERSCORE = 95, SDLK_BACKQUOTE = 96, SDLK_a = 97, SDLK_b = 98, SDLK_c = 99, SDLK_d = 100, SDLK_e = 101, SDLK_f = 102, SDLK_g = 103, SDLK_h = 104, SDLK_i = 105, SDLK_j = 106, SDLK_k = 107, SDLK_l = 108, SDLK_m = 109, SDLK_n = 110, SDLK_o = 111, SDLK_p = 112, SDLK_q = 113, SDLK_r = 114, SDLK_s = 115, SDLK_t = 116, SDLK_u = 117, SDLK_v = 118, SDLK_w = 119, SDLK_x = 120, SDLK_y = 121, SDLK_z = 122, SDLK_DELETE = 127, SDLK_WORLD_0 = 160, SDLK_WORLD_1 = 161, SDLK_WORLD_2 = 162, SDLK_WORLD_3 = 163, SDLK_WORLD_4 = 164, SDLK_WORLD_5 = 165, SDLK_WORLD_6 = 166, SDLK_WORLD_7 = 167, SDLK_WORLD_8 = 168, SDLK_WORLD_9 = 169, SDLK_WORLD_10 = 170, SDLK_WORLD_11 = 171, SDLK_WORLD_12 = 172, SDLK_WORLD_13 = 173, SDLK_WORLD_14 = 174, SDLK_WORLD_15 = 175, SDLK_WORLD_16 = 176, SDLK_WORLD_17 = 177, SDLK_WORLD_18 = 178, SDLK_WORLD_19 = 179, SDLK_WORLD_20 = 180, SDLK_WORLD_21 = 181, SDLK_WORLD_22 = 182, SDLK_WORLD_23 = 183, SDLK_WORLD_24 = 184, SDLK_WORLD_25 = 185, SDLK_WORLD_26 = 186, SDLK_WORLD_27 = 187, SDLK_WORLD_28 = 188, SDLK_WORLD_29 = 189, SDLK_WORLD_30 = 190, SDLK_WORLD_31 = 191, SDLK_WORLD_32 = 192, SDLK_WORLD_33 = 193, SDLK_WORLD_34 = 194, SDLK_WORLD_35 = 195, SDLK_WORLD_36 = 196, SDLK_WORLD_37 = 197, SDLK_WORLD_38 = 198, SDLK_WORLD_39 = 199, SDLK_WORLD_40 = 200, SDLK_WORLD_41 = 201, SDLK_WORLD_42 = 202, SDLK_WORLD_43 = 203, SDLK_WORLD_44 = 204, SDLK_WORLD_45 = 205, SDLK_WORLD_46 = 206, SDLK_WORLD_47 = 207, SDLK_WORLD_48 = 208, SDLK_WORLD_49 = 209, SDLK_WORLD_50 = 210, SDLK_WORLD_51 = 211, SDLK_WORLD_52 = 212, SDLK_WORLD_53 = 213, SDLK_WORLD_54 = 214, SDLK_WORLD_55 = 215, SDLK_WORLD_56 = 216, SDLK_WORLD_57 = 217, SDLK_WORLD_58 = 218, SDLK_WORLD_59 = 219, SDLK_WORLD_60 = 220, SDLK_WORLD_61 = 221, SDLK_WORLD_62 = 222, SDLK_WORLD_63 = 223, SDLK_WORLD_64 = 224, SDLK_WORLD_65 = 225, SDLK_WORLD_66 = 226, SDLK_WORLD_67 = 227, SDLK_WORLD_68 = 228, SDLK_WORLD_69 = 229, SDLK_WORLD_70 = 230, SDLK_WORLD_71 = 231, SDLK_WORLD_72 = 232, SDLK_WORLD_73 = 233, SDLK_WORLD_74 = 234, SDLK_WORLD_75 = 235, SDLK_WORLD_76 = 236, SDLK_WORLD_77 = 237, SDLK_WORLD_78 = 238, SDLK_WORLD_79 = 239, SDLK_WORLD_80 = 240, SDLK_WORLD_81 = 241, SDLK_WORLD_82 = 242, SDLK_WORLD_83 = 243, SDLK_WORLD_84 = 244, SDLK_WORLD_85 = 245, SDLK_WORLD_86 = 246, SDLK_WORLD_87 = 247, SDLK_WORLD_88 = 248, SDLK_WORLD_89 = 249, SDLK_WORLD_90 = 250, SDLK_WORLD_91 = 251, SDLK_WORLD_92 = 252, SDLK_WORLD_93 = 253, SDLK_WORLD_94 = 254, SDLK_WORLD_95 = 255, SDLK_KP0 = 256, SDLK_KP1 = 257, SDLK_KP2 = 258, SDLK_KP3 = 259, SDLK_KP4 = 260, SDLK_KP5 = 261, SDLK_KP6 = 262, SDLK_KP7 = 263, SDLK_KP8 = 264, SDLK_KP9 = 265, SDLK_KP_PERIOD = 266, SDLK_KP_DIVIDE = 267, SDLK_KP_MULTIPLY = 268, SDLK_KP_MINUS = 269, SDLK_KP_PLUS = 270, SDLK_KP_ENTER = 271, SDLK_KP_EQUALS = 272, SDLK_UP = 273, SDLK_DOWN = 274, SDLK_RIGHT = 275, SDLK_LEFT = 276, SDLK_INSERT = 277, SDLK_HOME = 278, SDLK_END = 279, SDLK_PAGEUP = 280, SDLK_PAGEDOWN = 281, SDLK_F1 = 282, SDLK_F2 = 283, SDLK_F3 = 284, SDLK_F4 = 285, SDLK_F5 = 286, SDLK_F6 = 287, SDLK_F7 = 288, SDLK_F8 = 289, SDLK_F9 = 290, SDLK_F10 = 291, SDLK_F11 = 292, SDLK_F12 = 293, SDLK_F13 = 294, SDLK_F14 = 295, SDLK_F15 = 296, SDLK_NUMLOCK = 300, SDLK_CAPSLOCK = 301, SDLK_SCROLLOCK = 302, SDLK_RSHIFT = 303, SDLK_LSHIFT = 304, SDLK_RCTRL = 305, SDLK_LCTRL = 306, SDLK_RALT = 307, SDLK_LALT = 308, SDLK_RMETA = 309, SDLK_LMETA = 310, SDLK_LSUPER = 311, SDLK_RSUPER = 312, SDLK_MODE = 313, SDLK_COMPOSE = 314, SDLK_HELP = 315, SDLK_PRINT = 316, SDLK_SYSREQ = 317, SDLK_BREAK = 318, SDLK_MENU = 319, SDLK_POWER = 320, SDLK_EURO = 321, SDLK_UNDO = 322, SDLK_LAST } SDLKey; typedef enum SDLMod { KMOD_NONE = 0x0000, KMOD_LSHIFT= 0x0001, KMOD_RSHIFT= 0x0002, KMOD_LCTRL = 0x0040, KMOD_RCTRL = 0x0080, KMOD_LALT = 0x0100, KMOD_RALT = 0x0200, KMOD_LMETA = 0x0400, KMOD_RMETA = 0x0800, KMOD_NUM = 0x1000, KMOD_CAPS = 0x2000, KMOD_MODE = 0x4000, KMOD_RESERVED = 0x8000 } SDLMod; #define KMOD_CTRL (KMOD_LCTRL|KMOD_RCTRL) #define KMOD_SHIFT (KMOD_LSHIFT|KMOD_RSHIFT) #define KMOD_ALT (KMOD_LALT|KMOD_RALT) #define KMOD_META (KMOD_LMETA|KMOD_RMETA) #endif sdl12-compat-1.2.74/include/SDL/SDL_loadso.h0000664000000000000000000000272015125533266015155 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_loadso_h #define _SDL_loadso_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" extern DECLSPEC void * SDLCALL SDL_LoadObject(const char *sofile); extern DECLSPEC void * SDLCALL SDL_LoadFunction(void *handle, const char *name); extern DECLSPEC void SDLCALL SDL_UnloadObject(void *handle); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_main.h0000664000000000000000000000307615125533266014625 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_main_h #define _SDL_main_h #include "SDL_stdinc.h" #include "begin_code.h" #if defined(__WIN32__) || defined(__MACOSX__) #define main SDL_main extern int SDL_main(int argc, char *argv[]); #endif #ifdef __WIN32__ extern DECLSPEC void SDLCALL SDL_SetModuleHandle(void *hInst); extern DECLSPEC int SDLCALL SDL_RegisterApp(char *name, Uint32 style, void *hInst); extern DECLSPEC void SDLCALL SDL_UnregisterApp(void); #endif #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_mouse.h0000664000000000000000000000477315125533266015036 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_mouse_h #define _SDL_mouse_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_video.h" #include "begin_code.h" typedef struct WMcursor WMcursor; typedef struct SDL_Cursor { SDL_Rect area; Sint16 hot_x, hot_y; Uint8 *data; Uint8 *mask; Uint8 *save[2]; WMcursor *wm_cursor; } SDL_Cursor; extern DECLSPEC Uint8 SDLCALL SDL_GetMouseState(int *x, int *y); extern DECLSPEC Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y); extern DECLSPEC void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y); extern DECLSPEC SDL_Cursor * SDLCALL SDL_CreateCursor(Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y); extern DECLSPEC void SDLCALL SDL_SetCursor(SDL_Cursor *cursor); extern DECLSPEC SDL_Cursor * SDLCALL SDL_GetCursor(void); extern DECLSPEC void SDLCALL SDL_FreeCursor(SDL_Cursor *cursor); extern DECLSPEC int SDLCALL SDL_ShowCursor(int toggle); #define SDL_BUTTON(X) (1 << ((X)-1)) #define SDL_BUTTON_LEFT 1 #define SDL_BUTTON_MIDDLE 2 #define SDL_BUTTON_RIGHT 3 #define SDL_BUTTON_WHEELUP 4 #define SDL_BUTTON_WHEELDOWN 5 #define SDL_BUTTON_X1 6 #define SDL_BUTTON_X2 7 #define SDL_BUTTON_LMASK SDL_BUTTON(SDL_BUTTON_LEFT) #define SDL_BUTTON_MMASK SDL_BUTTON(SDL_BUTTON_MIDDLE) #define SDL_BUTTON_RMASK SDL_BUTTON(SDL_BUTTON_RIGHT) #define SDL_BUTTON_X1MASK SDL_BUTTON(SDL_BUTTON_X1) #define SDL_BUTTON_X2MASK SDL_BUTTON(SDL_BUTTON_X2) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_mutex.h0000664000000000000000000000513715125533266015043 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_mutex_h #define _SDL_mutex_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" typedef struct SDL_mutex SDL_mutex; typedef struct SDL_semaphore SDL_sem; typedef struct SDL_cond SDL_cond; extern DECLSPEC SDL_mutex * SDLCALL SDL_CreateMutex(void); extern DECLSPEC int SDLCALL SDL_mutexP(SDL_mutex *mutex); /* lock */ extern DECLSPEC int SDLCALL SDL_mutexV(SDL_mutex *mutex); /* unlock */ extern DECLSPEC void SDLCALL SDL_DestroyMutex(SDL_mutex *mutex); extern DECLSPEC SDL_sem * SDLCALL SDL_CreateSemaphore(Uint32 initial_value); extern DECLSPEC int SDLCALL SDL_SemPost(SDL_sem *sem); extern DECLSPEC int SDLCALL SDL_SemWait(SDL_sem *sem); extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 ms); extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem *sem); extern DECLSPEC Uint32 SDLCALL SDL_SemValue(SDL_sem *sem); extern DECLSPEC void SDLCALL SDL_DestroySemaphore(SDL_sem *sem); extern DECLSPEC SDL_cond * SDLCALL SDL_CreateCond(void); extern DECLSPEC int SDLCALL SDL_CondSignal(SDL_cond *cond); extern DECLSPEC int SDLCALL SDL_CondBroadcast(SDL_cond *cond); extern DECLSPEC int SDLCALL SDL_CondWait(SDL_cond *cond, SDL_mutex *mut); extern DECLSPEC int SDLCALL SDL_CondWaitTimeout(SDL_cond *cond, SDL_mutex *mutex, Uint32 ms); extern DECLSPEC void SDLCALL SDL_DestroyCond(SDL_cond *cond); #define SDL_MUTEX_TIMEDOUT 1 #define SDL_MUTEX_MAXWAIT (~(Uint32)0) #define SDL_LockMutex(m) SDL_mutexP(m) #define SDL_UnlockMutex(m) SDL_mutexV(m) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_name.h0000664000000000000000000000241415125533266014614 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDLname_h_ #define _SDLname_h_ #define SDL_NAME(X) SDL_##X #if defined(__STDC__) || defined(__cplusplus) #define NeedFunctionPrototypes 1 #endif #endif sdl12-compat-1.2.74/include/SDL/SDL_opengl.h0000664000000000000000000133526115125533266015172 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* This file is a verbatim copy of SDL 1.2's, except for the MacOS Classic include fixes being removed. */ /* This is a simple file to encapsulate the OpenGL API headers */ #include "SDL_config.h" #ifdef __WIN32__ #ifndef WIN32_LEAN_AND_MEAN #define WIN32_LEAN_AND_MEAN #endif #ifndef NOMINMAX #define NOMINMAX /* Don't define min() and max() */ #endif #include #endif #ifndef NO_SDL_GLEXT #define __glext_h_ /* Don't let gl.h include glext.h */ #define __gl_glext_h_ /* Don't let gl.h include glext.h */ #endif #if defined(__MACOSX__) #include /* Header File For The OpenGL Library */ #ifndef NO_SDL_GLU #include /* Header File For The GLU Library */ #endif #else #include /* Header File For The OpenGL Library */ #ifndef NO_SDL_GLU #include /* Header File For The GLU Library */ #endif #endif #ifndef NO_SDL_GLEXT #undef __glext_h_ #undef __gl_glext_h_ #endif /** glext.h * This is included here because glext.h is not available on some systems. * If you don't want this version included, simply define "NO_SDL_GLEXT" */ #ifndef NO_SDL_GLEXT #if !(defined(__glext_h_) || defined(__gl_glext_h_)) && !defined(GL_GLEXT_LEGACY) #define __glext_h_ #define __gl_glext_h_ #ifdef __cplusplus extern "C" { #endif /* ** Copyright (c) 2007 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the ** "Materials"), to deal in the Materials without restriction, including ** without limitation the rights to use, copy, modify, merge, publish, ** distribute, sublicense, and/or sell copies of the Materials, and to ** permit persons to whom the Materials are furnished to do so, subject to ** the following conditions: ** ** The above copyright notice and this permission notice shall be included ** in all copies or substantial portions of the Materials. ** ** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, ** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF ** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. ** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY ** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, ** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE ** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. */ #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) #define WIN32_LEAN_AND_MEAN 1 #include #endif #ifndef APIENTRY #define APIENTRY #endif #ifndef APIENTRYP #define APIENTRYP APIENTRY * #endif #ifndef GLAPI #define GLAPI extern #endif /*************************************************************/ /* Header file version number, required by OpenGL ABI for Linux */ /* glext.h last updated 2008/03/24 */ /* Current version at http://www.opengl.org/registry/ */ #define GL_GLEXT_VERSION 40 #ifndef GL_VERSION_1_2 #define GL_UNSIGNED_BYTE_3_3_2 0x8032 #define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 #define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 #define GL_UNSIGNED_INT_8_8_8_8 0x8035 #define GL_UNSIGNED_INT_10_10_10_2 0x8036 #define GL_RESCALE_NORMAL 0x803A #define GL_TEXTURE_BINDING_3D 0x806A #define GL_PACK_SKIP_IMAGES 0x806B #define GL_PACK_IMAGE_HEIGHT 0x806C #define GL_UNPACK_SKIP_IMAGES 0x806D #define GL_UNPACK_IMAGE_HEIGHT 0x806E #define GL_TEXTURE_3D 0x806F #define GL_PROXY_TEXTURE_3D 0x8070 #define GL_TEXTURE_DEPTH 0x8071 #define GL_TEXTURE_WRAP_R 0x8072 #define GL_MAX_3D_TEXTURE_SIZE 0x8073 #define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 #define GL_UNSIGNED_SHORT_5_6_5 0x8363 #define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 #define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 #define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 #define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 #define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 #define GL_BGR 0x80E0 #define GL_BGRA 0x80E1 #define GL_MAX_ELEMENTS_VERTICES 0x80E8 #define GL_MAX_ELEMENTS_INDICES 0x80E9 #define GL_CLAMP_TO_EDGE 0x812F #define GL_TEXTURE_MIN_LOD 0x813A #define GL_TEXTURE_MAX_LOD 0x813B #define GL_TEXTURE_BASE_LEVEL 0x813C #define GL_TEXTURE_MAX_LEVEL 0x813D #define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 #define GL_SINGLE_COLOR 0x81F9 #define GL_SEPARATE_SPECULAR_COLOR 0x81FA #define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 #define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 #define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 #define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 #define GL_ALIASED_POINT_SIZE_RANGE 0x846D #define GL_ALIASED_LINE_WIDTH_RANGE 0x846E #endif #ifndef GL_ARB_imaging #define GL_CONSTANT_COLOR 0x8001 #define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 #define GL_CONSTANT_ALPHA 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 #define GL_BLEND_COLOR 0x8005 #define GL_FUNC_ADD 0x8006 #define GL_MIN 0x8007 #define GL_MAX 0x8008 #define GL_BLEND_EQUATION 0x8009 #define GL_FUNC_SUBTRACT 0x800A #define GL_FUNC_REVERSE_SUBTRACT 0x800B #define GL_CONVOLUTION_1D 0x8010 #define GL_CONVOLUTION_2D 0x8011 #define GL_SEPARABLE_2D 0x8012 #define GL_CONVOLUTION_BORDER_MODE 0x8013 #define GL_CONVOLUTION_FILTER_SCALE 0x8014 #define GL_CONVOLUTION_FILTER_BIAS 0x8015 #define GL_REDUCE 0x8016 #define GL_CONVOLUTION_FORMAT 0x8017 #define GL_CONVOLUTION_WIDTH 0x8018 #define GL_CONVOLUTION_HEIGHT 0x8019 #define GL_MAX_CONVOLUTION_WIDTH 0x801A #define GL_MAX_CONVOLUTION_HEIGHT 0x801B #define GL_POST_CONVOLUTION_RED_SCALE 0x801C #define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D #define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E #define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F #define GL_POST_CONVOLUTION_RED_BIAS 0x8020 #define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 #define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 #define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 #define GL_HISTOGRAM 0x8024 #define GL_PROXY_HISTOGRAM 0x8025 #define GL_HISTOGRAM_WIDTH 0x8026 #define GL_HISTOGRAM_FORMAT 0x8027 #define GL_HISTOGRAM_RED_SIZE 0x8028 #define GL_HISTOGRAM_GREEN_SIZE 0x8029 #define GL_HISTOGRAM_BLUE_SIZE 0x802A #define GL_HISTOGRAM_ALPHA_SIZE 0x802B #define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C #define GL_HISTOGRAM_SINK 0x802D #define GL_MINMAX 0x802E #define GL_MINMAX_FORMAT 0x802F #define GL_MINMAX_SINK 0x8030 #define GL_TABLE_TOO_LARGE 0x8031 #define GL_COLOR_MATRIX 0x80B1 #define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 #define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 #define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 #define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 #define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 #define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 #define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 #define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 #define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA #define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB #define GL_COLOR_TABLE 0x80D0 #define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 #define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 #define GL_PROXY_COLOR_TABLE 0x80D3 #define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 #define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 #define GL_COLOR_TABLE_SCALE 0x80D6 #define GL_COLOR_TABLE_BIAS 0x80D7 #define GL_COLOR_TABLE_FORMAT 0x80D8 #define GL_COLOR_TABLE_WIDTH 0x80D9 #define GL_COLOR_TABLE_RED_SIZE 0x80DA #define GL_COLOR_TABLE_GREEN_SIZE 0x80DB #define GL_COLOR_TABLE_BLUE_SIZE 0x80DC #define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD #define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE #define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF #define GL_CONSTANT_BORDER 0x8151 #define GL_REPLICATE_BORDER 0x8153 #define GL_CONVOLUTION_BORDER_COLOR 0x8154 #endif #ifndef GL_VERSION_1_3 #define GL_TEXTURE0 0x84C0 #define GL_TEXTURE1 0x84C1 #define GL_TEXTURE2 0x84C2 #define GL_TEXTURE3 0x84C3 #define GL_TEXTURE4 0x84C4 #define GL_TEXTURE5 0x84C5 #define GL_TEXTURE6 0x84C6 #define GL_TEXTURE7 0x84C7 #define GL_TEXTURE8 0x84C8 #define GL_TEXTURE9 0x84C9 #define GL_TEXTURE10 0x84CA #define GL_TEXTURE11 0x84CB #define GL_TEXTURE12 0x84CC #define GL_TEXTURE13 0x84CD #define GL_TEXTURE14 0x84CE #define GL_TEXTURE15 0x84CF #define GL_TEXTURE16 0x84D0 #define GL_TEXTURE17 0x84D1 #define GL_TEXTURE18 0x84D2 #define GL_TEXTURE19 0x84D3 #define GL_TEXTURE20 0x84D4 #define GL_TEXTURE21 0x84D5 #define GL_TEXTURE22 0x84D6 #define GL_TEXTURE23 0x84D7 #define GL_TEXTURE24 0x84D8 #define GL_TEXTURE25 0x84D9 #define GL_TEXTURE26 0x84DA #define GL_TEXTURE27 0x84DB #define GL_TEXTURE28 0x84DC #define GL_TEXTURE29 0x84DD #define GL_TEXTURE30 0x84DE #define GL_TEXTURE31 0x84DF #define GL_ACTIVE_TEXTURE 0x84E0 #define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 #define GL_MAX_TEXTURE_UNITS 0x84E2 #define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 #define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 #define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 #define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 #define GL_MULTISAMPLE 0x809D #define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E #define GL_SAMPLE_ALPHA_TO_ONE 0x809F #define GL_SAMPLE_COVERAGE 0x80A0 #define GL_SAMPLE_BUFFERS 0x80A8 #define GL_SAMPLES 0x80A9 #define GL_SAMPLE_COVERAGE_VALUE 0x80AA #define GL_SAMPLE_COVERAGE_INVERT 0x80AB #define GL_MULTISAMPLE_BIT 0x20000000 #define GL_NORMAL_MAP 0x8511 #define GL_REFLECTION_MAP 0x8512 #define GL_TEXTURE_CUBE_MAP 0x8513 #define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A #define GL_PROXY_TEXTURE_CUBE_MAP 0x851B #define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C #define GL_COMPRESSED_ALPHA 0x84E9 #define GL_COMPRESSED_LUMINANCE 0x84EA #define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB #define GL_COMPRESSED_INTENSITY 0x84EC #define GL_COMPRESSED_RGB 0x84ED #define GL_COMPRESSED_RGBA 0x84EE #define GL_TEXTURE_COMPRESSION_HINT 0x84EF #define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 #define GL_TEXTURE_COMPRESSED 0x86A1 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 #define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 #define GL_CLAMP_TO_BORDER 0x812D #define GL_COMBINE 0x8570 #define GL_COMBINE_RGB 0x8571 #define GL_COMBINE_ALPHA 0x8572 #define GL_SOURCE0_RGB 0x8580 #define GL_SOURCE1_RGB 0x8581 #define GL_SOURCE2_RGB 0x8582 #define GL_SOURCE0_ALPHA 0x8588 #define GL_SOURCE1_ALPHA 0x8589 #define GL_SOURCE2_ALPHA 0x858A #define GL_OPERAND0_RGB 0x8590 #define GL_OPERAND1_RGB 0x8591 #define GL_OPERAND2_RGB 0x8592 #define GL_OPERAND0_ALPHA 0x8598 #define GL_OPERAND1_ALPHA 0x8599 #define GL_OPERAND2_ALPHA 0x859A #define GL_RGB_SCALE 0x8573 #define GL_ADD_SIGNED 0x8574 #define GL_INTERPOLATE 0x8575 #define GL_SUBTRACT 0x84E7 #define GL_CONSTANT 0x8576 #define GL_PRIMARY_COLOR 0x8577 #define GL_PREVIOUS 0x8578 #define GL_DOT3_RGB 0x86AE #define GL_DOT3_RGBA 0x86AF #endif #ifndef GL_VERSION_1_4 #define GL_BLEND_DST_RGB 0x80C8 #define GL_BLEND_SRC_RGB 0x80C9 #define GL_BLEND_DST_ALPHA 0x80CA #define GL_BLEND_SRC_ALPHA 0x80CB #define GL_POINT_SIZE_MIN 0x8126 #define GL_POINT_SIZE_MAX 0x8127 #define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 #define GL_POINT_DISTANCE_ATTENUATION 0x8129 #define GL_GENERATE_MIPMAP 0x8191 #define GL_GENERATE_MIPMAP_HINT 0x8192 #define GL_DEPTH_COMPONENT16 0x81A5 #define GL_DEPTH_COMPONENT24 0x81A6 #define GL_DEPTH_COMPONENT32 0x81A7 #define GL_MIRRORED_REPEAT 0x8370 #define GL_FOG_COORDINATE_SOURCE 0x8450 #define GL_FOG_COORDINATE 0x8451 #define GL_FRAGMENT_DEPTH 0x8452 #define GL_CURRENT_FOG_COORDINATE 0x8453 #define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 #define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 #define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 #define GL_FOG_COORDINATE_ARRAY 0x8457 #define GL_COLOR_SUM 0x8458 #define GL_CURRENT_SECONDARY_COLOR 0x8459 #define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A #define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B #define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C #define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D #define GL_SECONDARY_COLOR_ARRAY 0x845E #define GL_MAX_TEXTURE_LOD_BIAS 0x84FD #define GL_TEXTURE_FILTER_CONTROL 0x8500 #define GL_TEXTURE_LOD_BIAS 0x8501 #define GL_INCR_WRAP 0x8507 #define GL_DECR_WRAP 0x8508 #define GL_TEXTURE_DEPTH_SIZE 0x884A #define GL_DEPTH_TEXTURE_MODE 0x884B #define GL_TEXTURE_COMPARE_MODE 0x884C #define GL_TEXTURE_COMPARE_FUNC 0x884D #define GL_COMPARE_R_TO_TEXTURE 0x884E #endif #ifndef GL_VERSION_1_5 #define GL_BUFFER_SIZE 0x8764 #define GL_BUFFER_USAGE 0x8765 #define GL_QUERY_COUNTER_BITS 0x8864 #define GL_CURRENT_QUERY 0x8865 #define GL_QUERY_RESULT 0x8866 #define GL_QUERY_RESULT_AVAILABLE 0x8867 #define GL_ARRAY_BUFFER 0x8892 #define GL_ELEMENT_ARRAY_BUFFER 0x8893 #define GL_ARRAY_BUFFER_BINDING 0x8894 #define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 #define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 #define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 #define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 #define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 #define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A #define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B #define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C #define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D #define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E #define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F #define GL_READ_ONLY 0x88B8 #define GL_WRITE_ONLY 0x88B9 #define GL_READ_WRITE 0x88BA #define GL_BUFFER_ACCESS 0x88BB #define GL_BUFFER_MAPPED 0x88BC #define GL_BUFFER_MAP_POINTER 0x88BD #define GL_STREAM_DRAW 0x88E0 #define GL_STREAM_READ 0x88E1 #define GL_STREAM_COPY 0x88E2 #define GL_STATIC_DRAW 0x88E4 #define GL_STATIC_READ 0x88E5 #define GL_STATIC_COPY 0x88E6 #define GL_DYNAMIC_DRAW 0x88E8 #define GL_DYNAMIC_READ 0x88E9 #define GL_DYNAMIC_COPY 0x88EA #define GL_SAMPLES_PASSED 0x8914 #define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE #define GL_FOG_COORD GL_FOG_COORDINATE #define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE #define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE #define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE #define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER #define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY #define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING #define GL_SRC0_RGB GL_SOURCE0_RGB #define GL_SRC1_RGB GL_SOURCE1_RGB #define GL_SRC2_RGB GL_SOURCE2_RGB #define GL_SRC0_ALPHA GL_SOURCE0_ALPHA #define GL_SRC1_ALPHA GL_SOURCE1_ALPHA #define GL_SRC2_ALPHA GL_SOURCE2_ALPHA #endif #ifndef GL_VERSION_2_0 #define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION #define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 #define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 #define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 #define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 #define GL_CURRENT_VERTEX_ATTRIB 0x8626 #define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 #define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 #define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 #define GL_STENCIL_BACK_FUNC 0x8800 #define GL_STENCIL_BACK_FAIL 0x8801 #define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 #define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 #define GL_MAX_DRAW_BUFFERS 0x8824 #define GL_DRAW_BUFFER0 0x8825 #define GL_DRAW_BUFFER1 0x8826 #define GL_DRAW_BUFFER2 0x8827 #define GL_DRAW_BUFFER3 0x8828 #define GL_DRAW_BUFFER4 0x8829 #define GL_DRAW_BUFFER5 0x882A #define GL_DRAW_BUFFER6 0x882B #define GL_DRAW_BUFFER7 0x882C #define GL_DRAW_BUFFER8 0x882D #define GL_DRAW_BUFFER9 0x882E #define GL_DRAW_BUFFER10 0x882F #define GL_DRAW_BUFFER11 0x8830 #define GL_DRAW_BUFFER12 0x8831 #define GL_DRAW_BUFFER13 0x8832 #define GL_DRAW_BUFFER14 0x8833 #define GL_DRAW_BUFFER15 0x8834 #define GL_BLEND_EQUATION_ALPHA 0x883D #define GL_POINT_SPRITE 0x8861 #define GL_COORD_REPLACE 0x8862 #define GL_MAX_VERTEX_ATTRIBS 0x8869 #define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A #define GL_MAX_TEXTURE_COORDS 0x8871 #define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 #define GL_FRAGMENT_SHADER 0x8B30 #define GL_VERTEX_SHADER 0x8B31 #define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 #define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A #define GL_MAX_VARYING_FLOATS 0x8B4B #define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C #define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D #define GL_SHADER_TYPE 0x8B4F #define GL_FLOAT_VEC2 0x8B50 #define GL_FLOAT_VEC3 0x8B51 #define GL_FLOAT_VEC4 0x8B52 #define GL_INT_VEC2 0x8B53 #define GL_INT_VEC3 0x8B54 #define GL_INT_VEC4 0x8B55 #define GL_BOOL 0x8B56 #define GL_BOOL_VEC2 0x8B57 #define GL_BOOL_VEC3 0x8B58 #define GL_BOOL_VEC4 0x8B59 #define GL_FLOAT_MAT2 0x8B5A #define GL_FLOAT_MAT3 0x8B5B #define GL_FLOAT_MAT4 0x8B5C #define GL_SAMPLER_1D 0x8B5D #define GL_SAMPLER_2D 0x8B5E #define GL_SAMPLER_3D 0x8B5F #define GL_SAMPLER_CUBE 0x8B60 #define GL_SAMPLER_1D_SHADOW 0x8B61 #define GL_SAMPLER_2D_SHADOW 0x8B62 #define GL_DELETE_STATUS 0x8B80 #define GL_COMPILE_STATUS 0x8B81 #define GL_LINK_STATUS 0x8B82 #define GL_VALIDATE_STATUS 0x8B83 #define GL_INFO_LOG_LENGTH 0x8B84 #define GL_ATTACHED_SHADERS 0x8B85 #define GL_ACTIVE_UNIFORMS 0x8B86 #define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 #define GL_SHADER_SOURCE_LENGTH 0x8B88 #define GL_ACTIVE_ATTRIBUTES 0x8B89 #define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B #define GL_SHADING_LANGUAGE_VERSION 0x8B8C #define GL_CURRENT_PROGRAM 0x8B8D #define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 #define GL_LOWER_LEFT 0x8CA1 #define GL_UPPER_LEFT 0x8CA2 #define GL_STENCIL_BACK_REF 0x8CA3 #define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 #define GL_STENCIL_BACK_WRITEMASK 0x8CA5 #endif #ifndef GL_VERSION_2_1 #define GL_CURRENT_RASTER_SECONDARY_COLOR 0x845F #define GL_PIXEL_PACK_BUFFER 0x88EB #define GL_PIXEL_UNPACK_BUFFER 0x88EC #define GL_PIXEL_PACK_BUFFER_BINDING 0x88ED #define GL_PIXEL_UNPACK_BUFFER_BINDING 0x88EF #define GL_FLOAT_MAT2x3 0x8B65 #define GL_FLOAT_MAT2x4 0x8B66 #define GL_FLOAT_MAT3x2 0x8B67 #define GL_FLOAT_MAT3x4 0x8B68 #define GL_FLOAT_MAT4x2 0x8B69 #define GL_FLOAT_MAT4x3 0x8B6A #define GL_SRGB 0x8C40 #define GL_SRGB8 0x8C41 #define GL_SRGB_ALPHA 0x8C42 #define GL_SRGB8_ALPHA8 0x8C43 #define GL_SLUMINANCE_ALPHA 0x8C44 #define GL_SLUMINANCE8_ALPHA8 0x8C45 #define GL_SLUMINANCE 0x8C46 #define GL_SLUMINANCE8 0x8C47 #define GL_COMPRESSED_SRGB 0x8C48 #define GL_COMPRESSED_SRGB_ALPHA 0x8C49 #define GL_COMPRESSED_SLUMINANCE 0x8C4A #define GL_COMPRESSED_SLUMINANCE_ALPHA 0x8C4B #endif #ifndef GL_ARB_multitexture #define GL_TEXTURE0_ARB 0x84C0 #define GL_TEXTURE1_ARB 0x84C1 #define GL_TEXTURE2_ARB 0x84C2 #define GL_TEXTURE3_ARB 0x84C3 #define GL_TEXTURE4_ARB 0x84C4 #define GL_TEXTURE5_ARB 0x84C5 #define GL_TEXTURE6_ARB 0x84C6 #define GL_TEXTURE7_ARB 0x84C7 #define GL_TEXTURE8_ARB 0x84C8 #define GL_TEXTURE9_ARB 0x84C9 #define GL_TEXTURE10_ARB 0x84CA #define GL_TEXTURE11_ARB 0x84CB #define GL_TEXTURE12_ARB 0x84CC #define GL_TEXTURE13_ARB 0x84CD #define GL_TEXTURE14_ARB 0x84CE #define GL_TEXTURE15_ARB 0x84CF #define GL_TEXTURE16_ARB 0x84D0 #define GL_TEXTURE17_ARB 0x84D1 #define GL_TEXTURE18_ARB 0x84D2 #define GL_TEXTURE19_ARB 0x84D3 #define GL_TEXTURE20_ARB 0x84D4 #define GL_TEXTURE21_ARB 0x84D5 #define GL_TEXTURE22_ARB 0x84D6 #define GL_TEXTURE23_ARB 0x84D7 #define GL_TEXTURE24_ARB 0x84D8 #define GL_TEXTURE25_ARB 0x84D9 #define GL_TEXTURE26_ARB 0x84DA #define GL_TEXTURE27_ARB 0x84DB #define GL_TEXTURE28_ARB 0x84DC #define GL_TEXTURE29_ARB 0x84DD #define GL_TEXTURE30_ARB 0x84DE #define GL_TEXTURE31_ARB 0x84DF #define GL_ACTIVE_TEXTURE_ARB 0x84E0 #define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 #define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 #endif #ifndef GL_ARB_transpose_matrix #define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 #define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 #define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 #define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 #endif #ifndef GL_ARB_multisample #define GL_MULTISAMPLE_ARB 0x809D #define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E #define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F #define GL_SAMPLE_COVERAGE_ARB 0x80A0 #define GL_SAMPLE_BUFFERS_ARB 0x80A8 #define GL_SAMPLES_ARB 0x80A9 #define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA #define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB #define GL_MULTISAMPLE_BIT_ARB 0x20000000 #endif #ifndef GL_ARB_texture_env_add #endif #ifndef GL_ARB_texture_cube_map #define GL_NORMAL_MAP_ARB 0x8511 #define GL_REFLECTION_MAP_ARB 0x8512 #define GL_TEXTURE_CUBE_MAP_ARB 0x8513 #define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A #define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B #define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C #endif #ifndef GL_ARB_texture_compression #define GL_COMPRESSED_ALPHA_ARB 0x84E9 #define GL_COMPRESSED_LUMINANCE_ARB 0x84EA #define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB #define GL_COMPRESSED_INTENSITY_ARB 0x84EC #define GL_COMPRESSED_RGB_ARB 0x84ED #define GL_COMPRESSED_RGBA_ARB 0x84EE #define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF #define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 #define GL_TEXTURE_COMPRESSED_ARB 0x86A1 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 #define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 #endif #ifndef GL_ARB_texture_border_clamp #define GL_CLAMP_TO_BORDER_ARB 0x812D #endif #ifndef GL_ARB_point_parameters #define GL_POINT_SIZE_MIN_ARB 0x8126 #define GL_POINT_SIZE_MAX_ARB 0x8127 #define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 #define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 #endif #ifndef GL_ARB_vertex_blend #define GL_MAX_VERTEX_UNITS_ARB 0x86A4 #define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 #define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 #define GL_VERTEX_BLEND_ARB 0x86A7 #define GL_CURRENT_WEIGHT_ARB 0x86A8 #define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 #define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA #define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB #define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC #define GL_WEIGHT_ARRAY_ARB 0x86AD #define GL_MODELVIEW0_ARB 0x1700 #define GL_MODELVIEW1_ARB 0x850A #define GL_MODELVIEW2_ARB 0x8722 #define GL_MODELVIEW3_ARB 0x8723 #define GL_MODELVIEW4_ARB 0x8724 #define GL_MODELVIEW5_ARB 0x8725 #define GL_MODELVIEW6_ARB 0x8726 #define GL_MODELVIEW7_ARB 0x8727 #define GL_MODELVIEW8_ARB 0x8728 #define GL_MODELVIEW9_ARB 0x8729 #define GL_MODELVIEW10_ARB 0x872A #define GL_MODELVIEW11_ARB 0x872B #define GL_MODELVIEW12_ARB 0x872C #define GL_MODELVIEW13_ARB 0x872D #define GL_MODELVIEW14_ARB 0x872E #define GL_MODELVIEW15_ARB 0x872F #define GL_MODELVIEW16_ARB 0x8730 #define GL_MODELVIEW17_ARB 0x8731 #define GL_MODELVIEW18_ARB 0x8732 #define GL_MODELVIEW19_ARB 0x8733 #define GL_MODELVIEW20_ARB 0x8734 #define GL_MODELVIEW21_ARB 0x8735 #define GL_MODELVIEW22_ARB 0x8736 #define GL_MODELVIEW23_ARB 0x8737 #define GL_MODELVIEW24_ARB 0x8738 #define GL_MODELVIEW25_ARB 0x8739 #define GL_MODELVIEW26_ARB 0x873A #define GL_MODELVIEW27_ARB 0x873B #define GL_MODELVIEW28_ARB 0x873C #define GL_MODELVIEW29_ARB 0x873D #define GL_MODELVIEW30_ARB 0x873E #define GL_MODELVIEW31_ARB 0x873F #endif #ifndef GL_ARB_matrix_palette #define GL_MATRIX_PALETTE_ARB 0x8840 #define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 #define GL_MAX_PALETTE_MATRICES_ARB 0x8842 #define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 #define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 #define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 #define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 #define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 #define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 #define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 #endif #ifndef GL_ARB_texture_env_combine #define GL_COMBINE_ARB 0x8570 #define GL_COMBINE_RGB_ARB 0x8571 #define GL_COMBINE_ALPHA_ARB 0x8572 #define GL_SOURCE0_RGB_ARB 0x8580 #define GL_SOURCE1_RGB_ARB 0x8581 #define GL_SOURCE2_RGB_ARB 0x8582 #define GL_SOURCE0_ALPHA_ARB 0x8588 #define GL_SOURCE1_ALPHA_ARB 0x8589 #define GL_SOURCE2_ALPHA_ARB 0x858A #define GL_OPERAND0_RGB_ARB 0x8590 #define GL_OPERAND1_RGB_ARB 0x8591 #define GL_OPERAND2_RGB_ARB 0x8592 #define GL_OPERAND0_ALPHA_ARB 0x8598 #define GL_OPERAND1_ALPHA_ARB 0x8599 #define GL_OPERAND2_ALPHA_ARB 0x859A #define GL_RGB_SCALE_ARB 0x8573 #define GL_ADD_SIGNED_ARB 0x8574 #define GL_INTERPOLATE_ARB 0x8575 #define GL_SUBTRACT_ARB 0x84E7 #define GL_CONSTANT_ARB 0x8576 #define GL_PRIMARY_COLOR_ARB 0x8577 #define GL_PREVIOUS_ARB 0x8578 #endif #ifndef GL_ARB_texture_env_crossbar #endif #ifndef GL_ARB_texture_env_dot3 #define GL_DOT3_RGB_ARB 0x86AE #define GL_DOT3_RGBA_ARB 0x86AF #endif #ifndef GL_ARB_texture_mirrored_repeat #define GL_MIRRORED_REPEAT_ARB 0x8370 #endif #ifndef GL_ARB_depth_texture #define GL_DEPTH_COMPONENT16_ARB 0x81A5 #define GL_DEPTH_COMPONENT24_ARB 0x81A6 #define GL_DEPTH_COMPONENT32_ARB 0x81A7 #define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A #define GL_DEPTH_TEXTURE_MODE_ARB 0x884B #endif #ifndef GL_ARB_shadow #define GL_TEXTURE_COMPARE_MODE_ARB 0x884C #define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D #define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E #endif #ifndef GL_ARB_shadow_ambient #define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF #endif #ifndef GL_ARB_window_pos #endif #ifndef GL_ARB_vertex_program #define GL_COLOR_SUM_ARB 0x8458 #define GL_VERTEX_PROGRAM_ARB 0x8620 #define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 #define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 #define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 #define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 #define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 #define GL_PROGRAM_LENGTH_ARB 0x8627 #define GL_PROGRAM_STRING_ARB 0x8628 #define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E #define GL_MAX_PROGRAM_MATRICES_ARB 0x862F #define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 #define GL_CURRENT_MATRIX_ARB 0x8641 #define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 #define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 #define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 #define GL_PROGRAM_ERROR_POSITION_ARB 0x864B #define GL_PROGRAM_BINDING_ARB 0x8677 #define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 #define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A #define GL_PROGRAM_ERROR_STRING_ARB 0x8874 #define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 #define GL_PROGRAM_FORMAT_ARB 0x8876 #define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 #define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 #define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 #define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 #define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 #define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 #define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 #define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 #define GL_PROGRAM_PARAMETERS_ARB 0x88A8 #define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 #define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA #define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB #define GL_PROGRAM_ATTRIBS_ARB 0x88AC #define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD #define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE #define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF #define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 #define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 #define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 #define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 #define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 #define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 #define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 #define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 #define GL_MATRIX0_ARB 0x88C0 #define GL_MATRIX1_ARB 0x88C1 #define GL_MATRIX2_ARB 0x88C2 #define GL_MATRIX3_ARB 0x88C3 #define GL_MATRIX4_ARB 0x88C4 #define GL_MATRIX5_ARB 0x88C5 #define GL_MATRIX6_ARB 0x88C6 #define GL_MATRIX7_ARB 0x88C7 #define GL_MATRIX8_ARB 0x88C8 #define GL_MATRIX9_ARB 0x88C9 #define GL_MATRIX10_ARB 0x88CA #define GL_MATRIX11_ARB 0x88CB #define GL_MATRIX12_ARB 0x88CC #define GL_MATRIX13_ARB 0x88CD #define GL_MATRIX14_ARB 0x88CE #define GL_MATRIX15_ARB 0x88CF #define GL_MATRIX16_ARB 0x88D0 #define GL_MATRIX17_ARB 0x88D1 #define GL_MATRIX18_ARB 0x88D2 #define GL_MATRIX19_ARB 0x88D3 #define GL_MATRIX20_ARB 0x88D4 #define GL_MATRIX21_ARB 0x88D5 #define GL_MATRIX22_ARB 0x88D6 #define GL_MATRIX23_ARB 0x88D7 #define GL_MATRIX24_ARB 0x88D8 #define GL_MATRIX25_ARB 0x88D9 #define GL_MATRIX26_ARB 0x88DA #define GL_MATRIX27_ARB 0x88DB #define GL_MATRIX28_ARB 0x88DC #define GL_MATRIX29_ARB 0x88DD #define GL_MATRIX30_ARB 0x88DE #define GL_MATRIX31_ARB 0x88DF #endif #ifndef GL_ARB_fragment_program #define GL_FRAGMENT_PROGRAM_ARB 0x8804 #define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 #define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 #define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 #define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 #define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 #define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A #define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B #define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C #define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D #define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E #define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F #define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 #define GL_MAX_TEXTURE_COORDS_ARB 0x8871 #define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 #endif #ifndef GL_ARB_vertex_buffer_object #define GL_BUFFER_SIZE_ARB 0x8764 #define GL_BUFFER_USAGE_ARB 0x8765 #define GL_ARRAY_BUFFER_ARB 0x8892 #define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 #define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 #define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 #define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 #define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 #define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 #define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 #define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A #define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B #define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C #define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D #define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E #define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F #define GL_READ_ONLY_ARB 0x88B8 #define GL_WRITE_ONLY_ARB 0x88B9 #define GL_READ_WRITE_ARB 0x88BA #define GL_BUFFER_ACCESS_ARB 0x88BB #define GL_BUFFER_MAPPED_ARB 0x88BC #define GL_BUFFER_MAP_POINTER_ARB 0x88BD #define GL_STREAM_DRAW_ARB 0x88E0 #define GL_STREAM_READ_ARB 0x88E1 #define GL_STREAM_COPY_ARB 0x88E2 #define GL_STATIC_DRAW_ARB 0x88E4 #define GL_STATIC_READ_ARB 0x88E5 #define GL_STATIC_COPY_ARB 0x88E6 #define GL_DYNAMIC_DRAW_ARB 0x88E8 #define GL_DYNAMIC_READ_ARB 0x88E9 #define GL_DYNAMIC_COPY_ARB 0x88EA #endif #ifndef GL_ARB_occlusion_query #define GL_QUERY_COUNTER_BITS_ARB 0x8864 #define GL_CURRENT_QUERY_ARB 0x8865 #define GL_QUERY_RESULT_ARB 0x8866 #define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 #define GL_SAMPLES_PASSED_ARB 0x8914 #endif #ifndef GL_ARB_shader_objects #define GL_PROGRAM_OBJECT_ARB 0x8B40 #define GL_SHADER_OBJECT_ARB 0x8B48 #define GL_OBJECT_TYPE_ARB 0x8B4E #define GL_OBJECT_SUBTYPE_ARB 0x8B4F #define GL_FLOAT_VEC2_ARB 0x8B50 #define GL_FLOAT_VEC3_ARB 0x8B51 #define GL_FLOAT_VEC4_ARB 0x8B52 #define GL_INT_VEC2_ARB 0x8B53 #define GL_INT_VEC3_ARB 0x8B54 #define GL_INT_VEC4_ARB 0x8B55 #define GL_BOOL_ARB 0x8B56 #define GL_BOOL_VEC2_ARB 0x8B57 #define GL_BOOL_VEC3_ARB 0x8B58 #define GL_BOOL_VEC4_ARB 0x8B59 #define GL_FLOAT_MAT2_ARB 0x8B5A #define GL_FLOAT_MAT3_ARB 0x8B5B #define GL_FLOAT_MAT4_ARB 0x8B5C #define GL_SAMPLER_1D_ARB 0x8B5D #define GL_SAMPLER_2D_ARB 0x8B5E #define GL_SAMPLER_3D_ARB 0x8B5F #define GL_SAMPLER_CUBE_ARB 0x8B60 #define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 #define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 #define GL_SAMPLER_2D_RECT_ARB 0x8B63 #define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 #define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 #define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 #define GL_OBJECT_LINK_STATUS_ARB 0x8B82 #define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 #define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 #define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 #define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 #define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 #define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 #endif #ifndef GL_ARB_vertex_shader #define GL_VERTEX_SHADER_ARB 0x8B31 #define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A #define GL_MAX_VARYING_FLOATS_ARB 0x8B4B #define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C #define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D #define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 #define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A #endif #ifndef GL_ARB_fragment_shader #define GL_FRAGMENT_SHADER_ARB 0x8B30 #define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B #endif #ifndef GL_ARB_shading_language_100 #define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C #endif #ifndef GL_ARB_texture_non_power_of_two #endif #ifndef GL_ARB_point_sprite #define GL_POINT_SPRITE_ARB 0x8861 #define GL_COORD_REPLACE_ARB 0x8862 #endif #ifndef GL_ARB_fragment_program_shadow #endif #ifndef GL_ARB_draw_buffers #define GL_MAX_DRAW_BUFFERS_ARB 0x8824 #define GL_DRAW_BUFFER0_ARB 0x8825 #define GL_DRAW_BUFFER1_ARB 0x8826 #define GL_DRAW_BUFFER2_ARB 0x8827 #define GL_DRAW_BUFFER3_ARB 0x8828 #define GL_DRAW_BUFFER4_ARB 0x8829 #define GL_DRAW_BUFFER5_ARB 0x882A #define GL_DRAW_BUFFER6_ARB 0x882B #define GL_DRAW_BUFFER7_ARB 0x882C #define GL_DRAW_BUFFER8_ARB 0x882D #define GL_DRAW_BUFFER9_ARB 0x882E #define GL_DRAW_BUFFER10_ARB 0x882F #define GL_DRAW_BUFFER11_ARB 0x8830 #define GL_DRAW_BUFFER12_ARB 0x8831 #define GL_DRAW_BUFFER13_ARB 0x8832 #define GL_DRAW_BUFFER14_ARB 0x8833 #define GL_DRAW_BUFFER15_ARB 0x8834 #endif #ifndef GL_ARB_texture_rectangle #define GL_TEXTURE_RECTANGLE_ARB 0x84F5 #define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 #define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 #define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 #endif #ifndef GL_ARB_color_buffer_float #define GL_RGBA_FLOAT_MODE_ARB 0x8820 #define GL_CLAMP_VERTEX_COLOR_ARB 0x891A #define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B #define GL_CLAMP_READ_COLOR_ARB 0x891C #define GL_FIXED_ONLY_ARB 0x891D #endif #ifndef GL_ARB_half_float_pixel #define GL_HALF_FLOAT_ARB 0x140B #endif #ifndef GL_ARB_texture_float #define GL_TEXTURE_RED_TYPE_ARB 0x8C10 #define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 #define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 #define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 #define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 #define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 #define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 #define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 #define GL_RGBA32F_ARB 0x8814 #define GL_RGB32F_ARB 0x8815 #define GL_ALPHA32F_ARB 0x8816 #define GL_INTENSITY32F_ARB 0x8817 #define GL_LUMINANCE32F_ARB 0x8818 #define GL_LUMINANCE_ALPHA32F_ARB 0x8819 #define GL_RGBA16F_ARB 0x881A #define GL_RGB16F_ARB 0x881B #define GL_ALPHA16F_ARB 0x881C #define GL_INTENSITY16F_ARB 0x881D #define GL_LUMINANCE16F_ARB 0x881E #define GL_LUMINANCE_ALPHA16F_ARB 0x881F #endif #ifndef GL_ARB_pixel_buffer_object #define GL_PIXEL_PACK_BUFFER_ARB 0x88EB #define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC #define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED #define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF #endif #ifndef GL_EXT_abgr #define GL_ABGR_EXT 0x8000 #endif #ifndef GL_EXT_blend_color #define GL_CONSTANT_COLOR_EXT 0x8001 #define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 #define GL_CONSTANT_ALPHA_EXT 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 #define GL_BLEND_COLOR_EXT 0x8005 #endif #ifndef GL_EXT_polygon_offset #define GL_POLYGON_OFFSET_EXT 0x8037 #define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 #define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 #endif #ifndef GL_EXT_texture #define GL_ALPHA4_EXT 0x803B #define GL_ALPHA8_EXT 0x803C #define GL_ALPHA12_EXT 0x803D #define GL_ALPHA16_EXT 0x803E #define GL_LUMINANCE4_EXT 0x803F #define GL_LUMINANCE8_EXT 0x8040 #define GL_LUMINANCE12_EXT 0x8041 #define GL_LUMINANCE16_EXT 0x8042 #define GL_LUMINANCE4_ALPHA4_EXT 0x8043 #define GL_LUMINANCE6_ALPHA2_EXT 0x8044 #define GL_LUMINANCE8_ALPHA8_EXT 0x8045 #define GL_LUMINANCE12_ALPHA4_EXT 0x8046 #define GL_LUMINANCE12_ALPHA12_EXT 0x8047 #define GL_LUMINANCE16_ALPHA16_EXT 0x8048 #define GL_INTENSITY_EXT 0x8049 #define GL_INTENSITY4_EXT 0x804A #define GL_INTENSITY8_EXT 0x804B #define GL_INTENSITY12_EXT 0x804C #define GL_INTENSITY16_EXT 0x804D #define GL_RGB2_EXT 0x804E #define GL_RGB4_EXT 0x804F #define GL_RGB5_EXT 0x8050 #define GL_RGB8_EXT 0x8051 #define GL_RGB10_EXT 0x8052 #define GL_RGB12_EXT 0x8053 #define GL_RGB16_EXT 0x8054 #define GL_RGBA2_EXT 0x8055 #define GL_RGBA4_EXT 0x8056 #define GL_RGB5_A1_EXT 0x8057 #define GL_RGBA8_EXT 0x8058 #define GL_RGB10_A2_EXT 0x8059 #define GL_RGBA12_EXT 0x805A #define GL_RGBA16_EXT 0x805B #define GL_TEXTURE_RED_SIZE_EXT 0x805C #define GL_TEXTURE_GREEN_SIZE_EXT 0x805D #define GL_TEXTURE_BLUE_SIZE_EXT 0x805E #define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F #define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 #define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 #define GL_REPLACE_EXT 0x8062 #define GL_PROXY_TEXTURE_1D_EXT 0x8063 #define GL_PROXY_TEXTURE_2D_EXT 0x8064 #define GL_TEXTURE_TOO_LARGE_EXT 0x8065 #endif #ifndef GL_EXT_texture3D #define GL_PACK_SKIP_IMAGES_EXT 0x806B #define GL_PACK_IMAGE_HEIGHT_EXT 0x806C #define GL_UNPACK_SKIP_IMAGES_EXT 0x806D #define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E #define GL_TEXTURE_3D_EXT 0x806F #define GL_PROXY_TEXTURE_3D_EXT 0x8070 #define GL_TEXTURE_DEPTH_EXT 0x8071 #define GL_TEXTURE_WRAP_R_EXT 0x8072 #define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 #endif #ifndef GL_SGIS_texture_filter4 #define GL_FILTER4_SGIS 0x8146 #define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 #endif #ifndef GL_EXT_subtexture #endif #ifndef GL_EXT_copy_texture #endif #ifndef GL_EXT_histogram #define GL_HISTOGRAM_EXT 0x8024 #define GL_PROXY_HISTOGRAM_EXT 0x8025 #define GL_HISTOGRAM_WIDTH_EXT 0x8026 #define GL_HISTOGRAM_FORMAT_EXT 0x8027 #define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 #define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 #define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A #define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B #define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C #define GL_HISTOGRAM_SINK_EXT 0x802D #define GL_MINMAX_EXT 0x802E #define GL_MINMAX_FORMAT_EXT 0x802F #define GL_MINMAX_SINK_EXT 0x8030 #define GL_TABLE_TOO_LARGE_EXT 0x8031 #endif #ifndef GL_EXT_convolution #define GL_CONVOLUTION_1D_EXT 0x8010 #define GL_CONVOLUTION_2D_EXT 0x8011 #define GL_SEPARABLE_2D_EXT 0x8012 #define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 #define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 #define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 #define GL_REDUCE_EXT 0x8016 #define GL_CONVOLUTION_FORMAT_EXT 0x8017 #define GL_CONVOLUTION_WIDTH_EXT 0x8018 #define GL_CONVOLUTION_HEIGHT_EXT 0x8019 #define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A #define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B #define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C #define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D #define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E #define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F #define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 #define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 #define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 #define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 #endif #ifndef GL_SGI_color_matrix #define GL_COLOR_MATRIX_SGI 0x80B1 #define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 #define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 #define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 #define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 #define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 #define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 #define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 #define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 #define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA #define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB #endif #ifndef GL_SGI_color_table #define GL_COLOR_TABLE_SGI 0x80D0 #define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 #define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 #define GL_PROXY_COLOR_TABLE_SGI 0x80D3 #define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 #define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 #define GL_COLOR_TABLE_SCALE_SGI 0x80D6 #define GL_COLOR_TABLE_BIAS_SGI 0x80D7 #define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 #define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 #define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA #define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB #define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC #define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD #define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE #define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF #endif #ifndef GL_SGIS_pixel_texture #define GL_PIXEL_TEXTURE_SGIS 0x8353 #define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 #define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 #define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 #endif #ifndef GL_SGIX_pixel_texture #define GL_PIXEL_TEX_GEN_SGIX 0x8139 #define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B #endif #ifndef GL_SGIS_texture4D #define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 #define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 #define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 #define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 #define GL_TEXTURE_4D_SGIS 0x8134 #define GL_PROXY_TEXTURE_4D_SGIS 0x8135 #define GL_TEXTURE_4DSIZE_SGIS 0x8136 #define GL_TEXTURE_WRAP_Q_SGIS 0x8137 #define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 #define GL_TEXTURE_4D_BINDING_SGIS 0x814F #endif #ifndef GL_SGI_texture_color_table #define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC #define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD #endif #ifndef GL_EXT_cmyka #define GL_CMYK_EXT 0x800C #define GL_CMYKA_EXT 0x800D #define GL_PACK_CMYK_HINT_EXT 0x800E #define GL_UNPACK_CMYK_HINT_EXT 0x800F #endif #ifndef GL_EXT_texture_object #define GL_TEXTURE_PRIORITY_EXT 0x8066 #define GL_TEXTURE_RESIDENT_EXT 0x8067 #define GL_TEXTURE_1D_BINDING_EXT 0x8068 #define GL_TEXTURE_2D_BINDING_EXT 0x8069 #define GL_TEXTURE_3D_BINDING_EXT 0x806A #endif #ifndef GL_SGIS_detail_texture #define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 #define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 #define GL_LINEAR_DETAIL_SGIS 0x8097 #define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 #define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 #define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A #define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B #define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C #endif #ifndef GL_SGIS_sharpen_texture #define GL_LINEAR_SHARPEN_SGIS 0x80AD #define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE #define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF #define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 #endif #ifndef GL_EXT_packed_pixels #define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 #define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 #define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 #define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 #define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 #endif #ifndef GL_SGIS_texture_lod #define GL_TEXTURE_MIN_LOD_SGIS 0x813A #define GL_TEXTURE_MAX_LOD_SGIS 0x813B #define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C #define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D #endif #ifndef GL_SGIS_multisample #define GL_MULTISAMPLE_SGIS 0x809D #define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E #define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F #define GL_SAMPLE_MASK_SGIS 0x80A0 #define GL_1PASS_SGIS 0x80A1 #define GL_2PASS_0_SGIS 0x80A2 #define GL_2PASS_1_SGIS 0x80A3 #define GL_4PASS_0_SGIS 0x80A4 #define GL_4PASS_1_SGIS 0x80A5 #define GL_4PASS_2_SGIS 0x80A6 #define GL_4PASS_3_SGIS 0x80A7 #define GL_SAMPLE_BUFFERS_SGIS 0x80A8 #define GL_SAMPLES_SGIS 0x80A9 #define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA #define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB #define GL_SAMPLE_PATTERN_SGIS 0x80AC #endif #ifndef GL_EXT_rescale_normal #define GL_RESCALE_NORMAL_EXT 0x803A #endif #ifndef GL_EXT_vertex_array #define GL_VERTEX_ARRAY_EXT 0x8074 #define GL_NORMAL_ARRAY_EXT 0x8075 #define GL_COLOR_ARRAY_EXT 0x8076 #define GL_INDEX_ARRAY_EXT 0x8077 #define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 #define GL_EDGE_FLAG_ARRAY_EXT 0x8079 #define GL_VERTEX_ARRAY_SIZE_EXT 0x807A #define GL_VERTEX_ARRAY_TYPE_EXT 0x807B #define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C #define GL_VERTEX_ARRAY_COUNT_EXT 0x807D #define GL_NORMAL_ARRAY_TYPE_EXT 0x807E #define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F #define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 #define GL_COLOR_ARRAY_SIZE_EXT 0x8081 #define GL_COLOR_ARRAY_TYPE_EXT 0x8082 #define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 #define GL_COLOR_ARRAY_COUNT_EXT 0x8084 #define GL_INDEX_ARRAY_TYPE_EXT 0x8085 #define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 #define GL_INDEX_ARRAY_COUNT_EXT 0x8087 #define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 #define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 #define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A #define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B #define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C #define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D #define GL_VERTEX_ARRAY_POINTER_EXT 0x808E #define GL_NORMAL_ARRAY_POINTER_EXT 0x808F #define GL_COLOR_ARRAY_POINTER_EXT 0x8090 #define GL_INDEX_ARRAY_POINTER_EXT 0x8091 #define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 #define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 #endif #ifndef GL_EXT_misc_attribute #endif #ifndef GL_SGIS_generate_mipmap #define GL_GENERATE_MIPMAP_SGIS 0x8191 #define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 #endif #ifndef GL_SGIX_clipmap #define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 #define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 #define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 #define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 #define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 #define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 #define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 #define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 #define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 #define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D #define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E #define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F #endif #ifndef GL_SGIX_shadow #define GL_TEXTURE_COMPARE_SGIX 0x819A #define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B #define GL_TEXTURE_LEQUAL_R_SGIX 0x819C #define GL_TEXTURE_GEQUAL_R_SGIX 0x819D #endif #ifndef GL_SGIS_texture_edge_clamp #define GL_CLAMP_TO_EDGE_SGIS 0x812F #endif #ifndef GL_SGIS_texture_border_clamp #define GL_CLAMP_TO_BORDER_SGIS 0x812D #endif #ifndef GL_EXT_blend_minmax #define GL_FUNC_ADD_EXT 0x8006 #define GL_MIN_EXT 0x8007 #define GL_MAX_EXT 0x8008 #define GL_BLEND_EQUATION_EXT 0x8009 #endif #ifndef GL_EXT_blend_subtract #define GL_FUNC_SUBTRACT_EXT 0x800A #define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B #endif #ifndef GL_EXT_blend_logic_op #endif #ifndef GL_SGIX_interlace #define GL_INTERLACE_SGIX 0x8094 #endif #ifndef GL_SGIX_pixel_tiles #define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E #define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F #define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 #define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 #define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 #define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 #define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 #define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 #endif #ifndef GL_SGIS_texture_select #define GL_DUAL_ALPHA4_SGIS 0x8110 #define GL_DUAL_ALPHA8_SGIS 0x8111 #define GL_DUAL_ALPHA12_SGIS 0x8112 #define GL_DUAL_ALPHA16_SGIS 0x8113 #define GL_DUAL_LUMINANCE4_SGIS 0x8114 #define GL_DUAL_LUMINANCE8_SGIS 0x8115 #define GL_DUAL_LUMINANCE12_SGIS 0x8116 #define GL_DUAL_LUMINANCE16_SGIS 0x8117 #define GL_DUAL_INTENSITY4_SGIS 0x8118 #define GL_DUAL_INTENSITY8_SGIS 0x8119 #define GL_DUAL_INTENSITY12_SGIS 0x811A #define GL_DUAL_INTENSITY16_SGIS 0x811B #define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C #define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D #define GL_QUAD_ALPHA4_SGIS 0x811E #define GL_QUAD_ALPHA8_SGIS 0x811F #define GL_QUAD_LUMINANCE4_SGIS 0x8120 #define GL_QUAD_LUMINANCE8_SGIS 0x8121 #define GL_QUAD_INTENSITY4_SGIS 0x8122 #define GL_QUAD_INTENSITY8_SGIS 0x8123 #define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 #define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 #endif #ifndef GL_SGIX_sprite #define GL_SPRITE_SGIX 0x8148 #define GL_SPRITE_MODE_SGIX 0x8149 #define GL_SPRITE_AXIS_SGIX 0x814A #define GL_SPRITE_TRANSLATION_SGIX 0x814B #define GL_SPRITE_AXIAL_SGIX 0x814C #define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D #define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E #endif #ifndef GL_SGIX_texture_multi_buffer #define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E #endif #ifndef GL_EXT_point_parameters #define GL_POINT_SIZE_MIN_EXT 0x8126 #define GL_POINT_SIZE_MAX_EXT 0x8127 #define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 #define GL_DISTANCE_ATTENUATION_EXT 0x8129 #endif #ifndef GL_SGIS_point_parameters #define GL_POINT_SIZE_MIN_SGIS 0x8126 #define GL_POINT_SIZE_MAX_SGIS 0x8127 #define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 #define GL_DISTANCE_ATTENUATION_SGIS 0x8129 #endif #ifndef GL_SGIX_instruments #define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 #define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 #endif #ifndef GL_SGIX_texture_scale_bias #define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 #define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A #define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B #define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C #endif #ifndef GL_SGIX_framezoom #define GL_FRAMEZOOM_SGIX 0x818B #define GL_FRAMEZOOM_FACTOR_SGIX 0x818C #define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D #endif #ifndef GL_SGIX_tag_sample_buffer #endif #ifndef GL_FfdMaskSGIX #define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 #define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 #endif #ifndef GL_SGIX_polynomial_ffd #define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 #define GL_TEXTURE_DEFORMATION_SGIX 0x8195 #define GL_DEFORMATIONS_MASK_SGIX 0x8196 #define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 #endif #ifndef GL_SGIX_reference_plane #define GL_REFERENCE_PLANE_SGIX 0x817D #define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E #endif #ifndef GL_SGIX_flush_raster #endif #ifndef GL_SGIX_depth_texture #define GL_DEPTH_COMPONENT16_SGIX 0x81A5 #define GL_DEPTH_COMPONENT24_SGIX 0x81A6 #define GL_DEPTH_COMPONENT32_SGIX 0x81A7 #endif #ifndef GL_SGIS_fog_function #define GL_FOG_FUNC_SGIS 0x812A #define GL_FOG_FUNC_POINTS_SGIS 0x812B #define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C #endif #ifndef GL_SGIX_fog_offset #define GL_FOG_OFFSET_SGIX 0x8198 #define GL_FOG_OFFSET_VALUE_SGIX 0x8199 #endif #ifndef GL_HP_image_transform #define GL_IMAGE_SCALE_X_HP 0x8155 #define GL_IMAGE_SCALE_Y_HP 0x8156 #define GL_IMAGE_TRANSLATE_X_HP 0x8157 #define GL_IMAGE_TRANSLATE_Y_HP 0x8158 #define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 #define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A #define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B #define GL_IMAGE_MAG_FILTER_HP 0x815C #define GL_IMAGE_MIN_FILTER_HP 0x815D #define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E #define GL_CUBIC_HP 0x815F #define GL_AVERAGE_HP 0x8160 #define GL_IMAGE_TRANSFORM_2D_HP 0x8161 #define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 #define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 #endif #ifndef GL_HP_convolution_border_modes #define GL_IGNORE_BORDER_HP 0x8150 #define GL_CONSTANT_BORDER_HP 0x8151 #define GL_REPLICATE_BORDER_HP 0x8153 #define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 #endif #ifndef GL_INGR_palette_buffer #endif #ifndef GL_SGIX_texture_add_env #define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE #endif #ifndef GL_EXT_color_subtable #endif #ifndef GL_PGI_vertex_hints #define GL_VERTEX_DATA_HINT_PGI 0x1A22A #define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B #define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C #define GL_MAX_VERTEX_HINT_PGI 0x1A22D #define GL_COLOR3_BIT_PGI 0x00010000 #define GL_COLOR4_BIT_PGI 0x00020000 #define GL_EDGEFLAG_BIT_PGI 0x00040000 #define GL_INDEX_BIT_PGI 0x00080000 #define GL_MAT_AMBIENT_BIT_PGI 0x00100000 #define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 #define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 #define GL_MAT_EMISSION_BIT_PGI 0x00800000 #define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 #define GL_MAT_SHININESS_BIT_PGI 0x02000000 #define GL_MAT_SPECULAR_BIT_PGI 0x04000000 #define GL_NORMAL_BIT_PGI 0x08000000 #define GL_TEXCOORD1_BIT_PGI 0x10000000 #define GL_TEXCOORD2_BIT_PGI 0x20000000 #define GL_TEXCOORD3_BIT_PGI 0x40000000 #define GL_TEXCOORD4_BIT_PGI 0x80000000 #define GL_VERTEX23_BIT_PGI 0x00000004 #define GL_VERTEX4_BIT_PGI 0x00000008 #endif #ifndef GL_PGI_misc_hints #define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 #define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD #define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE #define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 #define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 #define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 #define GL_ALWAYS_FAST_HINT_PGI 0x1A20C #define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D #define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E #define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F #define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 #define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 #define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 #define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 #define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 #define GL_FULL_STIPPLE_HINT_PGI 0x1A219 #define GL_CLIP_NEAR_HINT_PGI 0x1A220 #define GL_CLIP_FAR_HINT_PGI 0x1A221 #define GL_WIDE_LINE_HINT_PGI 0x1A222 #define GL_BACK_NORMALS_HINT_PGI 0x1A223 #endif #ifndef GL_EXT_paletted_texture #define GL_COLOR_INDEX1_EXT 0x80E2 #define GL_COLOR_INDEX2_EXT 0x80E3 #define GL_COLOR_INDEX4_EXT 0x80E4 #define GL_COLOR_INDEX8_EXT 0x80E5 #define GL_COLOR_INDEX12_EXT 0x80E6 #define GL_COLOR_INDEX16_EXT 0x80E7 #define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED #endif #ifndef GL_EXT_clip_volume_hint #define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 #endif #ifndef GL_SGIX_list_priority #define GL_LIST_PRIORITY_SGIX 0x8182 #endif #ifndef GL_SGIX_ir_instrument1 #define GL_IR_INSTRUMENT1_SGIX 0x817F #endif #ifndef GL_SGIX_calligraphic_fragment #define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 #endif #ifndef GL_SGIX_texture_lod_bias #define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E #define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F #define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 #endif #ifndef GL_SGIX_shadow_ambient #define GL_SHADOW_AMBIENT_SGIX 0x80BF #endif #ifndef GL_EXT_index_texture #endif #ifndef GL_EXT_index_material #define GL_INDEX_MATERIAL_EXT 0x81B8 #define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 #define GL_INDEX_MATERIAL_FACE_EXT 0x81BA #endif #ifndef GL_EXT_index_func #define GL_INDEX_TEST_EXT 0x81B5 #define GL_INDEX_TEST_FUNC_EXT 0x81B6 #define GL_INDEX_TEST_REF_EXT 0x81B7 #endif #ifndef GL_EXT_index_array_formats #define GL_IUI_V2F_EXT 0x81AD #define GL_IUI_V3F_EXT 0x81AE #define GL_IUI_N3F_V2F_EXT 0x81AF #define GL_IUI_N3F_V3F_EXT 0x81B0 #define GL_T2F_IUI_V2F_EXT 0x81B1 #define GL_T2F_IUI_V3F_EXT 0x81B2 #define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 #define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 #endif #ifndef GL_EXT_compiled_vertex_array #define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 #define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 #endif #ifndef GL_EXT_cull_vertex #define GL_CULL_VERTEX_EXT 0x81AA #define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB #define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC #endif #ifndef GL_SGIX_ycrcb #define GL_YCRCB_422_SGIX 0x81BB #define GL_YCRCB_444_SGIX 0x81BC #endif #ifndef GL_SGIX_fragment_lighting #define GL_FRAGMENT_LIGHTING_SGIX 0x8400 #define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 #define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 #define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 #define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 #define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 #define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 #define GL_LIGHT_ENV_MODE_SGIX 0x8407 #define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 #define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 #define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A #define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B #define GL_FRAGMENT_LIGHT0_SGIX 0x840C #define GL_FRAGMENT_LIGHT1_SGIX 0x840D #define GL_FRAGMENT_LIGHT2_SGIX 0x840E #define GL_FRAGMENT_LIGHT3_SGIX 0x840F #define GL_FRAGMENT_LIGHT4_SGIX 0x8410 #define GL_FRAGMENT_LIGHT5_SGIX 0x8411 #define GL_FRAGMENT_LIGHT6_SGIX 0x8412 #define GL_FRAGMENT_LIGHT7_SGIX 0x8413 #endif #ifndef GL_IBM_rasterpos_clip #define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 #endif #ifndef GL_HP_texture_lighting #define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 #define GL_TEXTURE_POST_SPECULAR_HP 0x8168 #define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 #endif #ifndef GL_EXT_draw_range_elements #define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 #define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 #endif #ifndef GL_WIN_phong_shading #define GL_PHONG_WIN 0x80EA #define GL_PHONG_HINT_WIN 0x80EB #endif #ifndef GL_WIN_specular_fog #define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC #endif #ifndef GL_EXT_light_texture #define GL_FRAGMENT_MATERIAL_EXT 0x8349 #define GL_FRAGMENT_NORMAL_EXT 0x834A #define GL_FRAGMENT_COLOR_EXT 0x834C #define GL_ATTENUATION_EXT 0x834D #define GL_SHADOW_ATTENUATION_EXT 0x834E #define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F #define GL_TEXTURE_LIGHT_EXT 0x8350 #define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 #define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 /* reuse GL_FRAGMENT_DEPTH_EXT */ #endif #ifndef GL_SGIX_blend_alpha_minmax #define GL_ALPHA_MIN_SGIX 0x8320 #define GL_ALPHA_MAX_SGIX 0x8321 #endif #ifndef GL_SGIX_impact_pixel_texture #define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184 #define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185 #define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186 #define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187 #define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188 #define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189 #define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A #endif #ifndef GL_EXT_bgra #define GL_BGR_EXT 0x80E0 #define GL_BGRA_EXT 0x80E1 #endif #ifndef GL_SGIX_async #define GL_ASYNC_MARKER_SGIX 0x8329 #endif #ifndef GL_SGIX_async_pixel #define GL_ASYNC_TEX_IMAGE_SGIX 0x835C #define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D #define GL_ASYNC_READ_PIXELS_SGIX 0x835E #define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F #define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 #define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 #endif #ifndef GL_SGIX_async_histogram #define GL_ASYNC_HISTOGRAM_SGIX 0x832C #define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D #endif #ifndef GL_INTEL_texture_scissor #endif #ifndef GL_INTEL_parallel_arrays #define GL_PARALLEL_ARRAYS_INTEL 0x83F4 #define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 #define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 #define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 #define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 #endif #ifndef GL_HP_occlusion_test #define GL_OCCLUSION_TEST_HP 0x8165 #define GL_OCCLUSION_TEST_RESULT_HP 0x8166 #endif #ifndef GL_EXT_pixel_transform #define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 #define GL_PIXEL_MAG_FILTER_EXT 0x8331 #define GL_PIXEL_MIN_FILTER_EXT 0x8332 #define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 #define GL_CUBIC_EXT 0x8334 #define GL_AVERAGE_EXT 0x8335 #define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 #define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 #define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 #endif #ifndef GL_EXT_pixel_transform_color_table #endif #ifndef GL_EXT_shared_texture_palette #define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB #endif #ifndef GL_EXT_separate_specular_color #define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 #define GL_SINGLE_COLOR_EXT 0x81F9 #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #endif #ifndef GL_EXT_secondary_color #define GL_COLOR_SUM_EXT 0x8458 #define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 #define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A #define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B #define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C #define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D #define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E #endif #ifndef GL_EXT_texture_perturb_normal #define GL_PERTURB_EXT 0x85AE #define GL_TEXTURE_NORMAL_EXT 0x85AF #endif #ifndef GL_EXT_multi_draw_arrays #endif #ifndef GL_EXT_fog_coord #define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 #define GL_FOG_COORDINATE_EXT 0x8451 #define GL_FRAGMENT_DEPTH_EXT 0x8452 #define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 #define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 #define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 #define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 #define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 #endif #ifndef GL_REND_screen_coordinates #define GL_SCREEN_COORDINATES_REND 0x8490 #define GL_INVERTED_SCREEN_W_REND 0x8491 #endif #ifndef GL_EXT_coordinate_frame #define GL_TANGENT_ARRAY_EXT 0x8439 #define GL_BINORMAL_ARRAY_EXT 0x843A #define GL_CURRENT_TANGENT_EXT 0x843B #define GL_CURRENT_BINORMAL_EXT 0x843C #define GL_TANGENT_ARRAY_TYPE_EXT 0x843E #define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F #define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 #define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 #define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 #define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 #define GL_MAP1_TANGENT_EXT 0x8444 #define GL_MAP2_TANGENT_EXT 0x8445 #define GL_MAP1_BINORMAL_EXT 0x8446 #define GL_MAP2_BINORMAL_EXT 0x8447 #endif #ifndef GL_EXT_texture_env_combine #define GL_COMBINE_EXT 0x8570 #define GL_COMBINE_RGB_EXT 0x8571 #define GL_COMBINE_ALPHA_EXT 0x8572 #define GL_RGB_SCALE_EXT 0x8573 #define GL_ADD_SIGNED_EXT 0x8574 #define GL_INTERPOLATE_EXT 0x8575 #define GL_CONSTANT_EXT 0x8576 #define GL_PRIMARY_COLOR_EXT 0x8577 #define GL_PREVIOUS_EXT 0x8578 #define GL_SOURCE0_RGB_EXT 0x8580 #define GL_SOURCE1_RGB_EXT 0x8581 #define GL_SOURCE2_RGB_EXT 0x8582 #define GL_SOURCE0_ALPHA_EXT 0x8588 #define GL_SOURCE1_ALPHA_EXT 0x8589 #define GL_SOURCE2_ALPHA_EXT 0x858A #define GL_OPERAND0_RGB_EXT 0x8590 #define GL_OPERAND1_RGB_EXT 0x8591 #define GL_OPERAND2_RGB_EXT 0x8592 #define GL_OPERAND0_ALPHA_EXT 0x8598 #define GL_OPERAND1_ALPHA_EXT 0x8599 #define GL_OPERAND2_ALPHA_EXT 0x859A #endif #ifndef GL_APPLE_specular_vector #define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 #endif #ifndef GL_APPLE_transform_hint #define GL_TRANSFORM_HINT_APPLE 0x85B1 #endif #ifndef GL_SGIX_fog_scale #define GL_FOG_SCALE_SGIX 0x81FC #define GL_FOG_SCALE_VALUE_SGIX 0x81FD #endif #ifndef GL_SUNX_constant_data #define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 #define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 #endif #ifndef GL_SUN_global_alpha #define GL_GLOBAL_ALPHA_SUN 0x81D9 #define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA #endif #ifndef GL_SUN_triangle_list #define GL_RESTART_SUN 0x0001 #define GL_REPLACE_MIDDLE_SUN 0x0002 #define GL_REPLACE_OLDEST_SUN 0x0003 #define GL_TRIANGLE_LIST_SUN 0x81D7 #define GL_REPLACEMENT_CODE_SUN 0x81D8 #define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 #define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 #define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 #define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 #define GL_R1UI_V3F_SUN 0x85C4 #define GL_R1UI_C4UB_V3F_SUN 0x85C5 #define GL_R1UI_C3F_V3F_SUN 0x85C6 #define GL_R1UI_N3F_V3F_SUN 0x85C7 #define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 #define GL_R1UI_T2F_V3F_SUN 0x85C9 #define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA #define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB #endif #ifndef GL_SUN_vertex #endif #ifndef GL_EXT_blend_func_separate #define GL_BLEND_DST_RGB_EXT 0x80C8 #define GL_BLEND_SRC_RGB_EXT 0x80C9 #define GL_BLEND_DST_ALPHA_EXT 0x80CA #define GL_BLEND_SRC_ALPHA_EXT 0x80CB #endif #ifndef GL_INGR_color_clamp #define GL_RED_MIN_CLAMP_INGR 0x8560 #define GL_GREEN_MIN_CLAMP_INGR 0x8561 #define GL_BLUE_MIN_CLAMP_INGR 0x8562 #define GL_ALPHA_MIN_CLAMP_INGR 0x8563 #define GL_RED_MAX_CLAMP_INGR 0x8564 #define GL_GREEN_MAX_CLAMP_INGR 0x8565 #define GL_BLUE_MAX_CLAMP_INGR 0x8566 #define GL_ALPHA_MAX_CLAMP_INGR 0x8567 #endif #ifndef GL_INGR_interlace_read #define GL_INTERLACE_READ_INGR 0x8568 #endif #ifndef GL_EXT_stencil_wrap #define GL_INCR_WRAP_EXT 0x8507 #define GL_DECR_WRAP_EXT 0x8508 #endif #ifndef GL_EXT_422_pixels #define GL_422_EXT 0x80CC #define GL_422_REV_EXT 0x80CD #define GL_422_AVERAGE_EXT 0x80CE #define GL_422_REV_AVERAGE_EXT 0x80CF #endif #ifndef GL_NV_texgen_reflection #define GL_NORMAL_MAP_NV 0x8511 #define GL_REFLECTION_MAP_NV 0x8512 #endif #ifndef GL_EXT_texture_cube_map #define GL_NORMAL_MAP_EXT 0x8511 #define GL_REFLECTION_MAP_EXT 0x8512 #define GL_TEXTURE_CUBE_MAP_EXT 0x8513 #define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A #define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B #define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C #endif #ifndef GL_SUN_convolution_border_modes #define GL_WRAP_BORDER_SUN 0x81D4 #endif #ifndef GL_EXT_texture_env_add #endif #ifndef GL_EXT_texture_lod_bias #define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD #define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 #define GL_TEXTURE_LOD_BIAS_EXT 0x8501 #endif #ifndef GL_EXT_texture_filter_anisotropic #define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE #define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF #endif #ifndef GL_EXT_vertex_weighting #define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH #define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 #define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX #define GL_MODELVIEW1_MATRIX_EXT 0x8506 #define GL_VERTEX_WEIGHTING_EXT 0x8509 #define GL_MODELVIEW0_EXT GL_MODELVIEW #define GL_MODELVIEW1_EXT 0x850A #define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B #define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C #define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D #define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E #define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F #define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 #endif #ifndef GL_NV_light_max_exponent #define GL_MAX_SHININESS_NV 0x8504 #define GL_MAX_SPOT_EXPONENT_NV 0x8505 #endif #ifndef GL_NV_vertex_array_range #define GL_VERTEX_ARRAY_RANGE_NV 0x851D #define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E #define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F #define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 #define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 #endif #ifndef GL_NV_register_combiners #define GL_REGISTER_COMBINERS_NV 0x8522 #define GL_VARIABLE_A_NV 0x8523 #define GL_VARIABLE_B_NV 0x8524 #define GL_VARIABLE_C_NV 0x8525 #define GL_VARIABLE_D_NV 0x8526 #define GL_VARIABLE_E_NV 0x8527 #define GL_VARIABLE_F_NV 0x8528 #define GL_VARIABLE_G_NV 0x8529 #define GL_CONSTANT_COLOR0_NV 0x852A #define GL_CONSTANT_COLOR1_NV 0x852B #define GL_PRIMARY_COLOR_NV 0x852C #define GL_SECONDARY_COLOR_NV 0x852D #define GL_SPARE0_NV 0x852E #define GL_SPARE1_NV 0x852F #define GL_DISCARD_NV 0x8530 #define GL_E_TIMES_F_NV 0x8531 #define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 #define GL_UNSIGNED_IDENTITY_NV 0x8536 #define GL_UNSIGNED_INVERT_NV 0x8537 #define GL_EXPAND_NORMAL_NV 0x8538 #define GL_EXPAND_NEGATE_NV 0x8539 #define GL_HALF_BIAS_NORMAL_NV 0x853A #define GL_HALF_BIAS_NEGATE_NV 0x853B #define GL_SIGNED_IDENTITY_NV 0x853C #define GL_SIGNED_NEGATE_NV 0x853D #define GL_SCALE_BY_TWO_NV 0x853E #define GL_SCALE_BY_FOUR_NV 0x853F #define GL_SCALE_BY_ONE_HALF_NV 0x8540 #define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 #define GL_COMBINER_INPUT_NV 0x8542 #define GL_COMBINER_MAPPING_NV 0x8543 #define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 #define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 #define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 #define GL_COMBINER_MUX_SUM_NV 0x8547 #define GL_COMBINER_SCALE_NV 0x8548 #define GL_COMBINER_BIAS_NV 0x8549 #define GL_COMBINER_AB_OUTPUT_NV 0x854A #define GL_COMBINER_CD_OUTPUT_NV 0x854B #define GL_COMBINER_SUM_OUTPUT_NV 0x854C #define GL_MAX_GENERAL_COMBINERS_NV 0x854D #define GL_NUM_GENERAL_COMBINERS_NV 0x854E #define GL_COLOR_SUM_CLAMP_NV 0x854F #define GL_COMBINER0_NV 0x8550 #define GL_COMBINER1_NV 0x8551 #define GL_COMBINER2_NV 0x8552 #define GL_COMBINER3_NV 0x8553 #define GL_COMBINER4_NV 0x8554 #define GL_COMBINER5_NV 0x8555 #define GL_COMBINER6_NV 0x8556 #define GL_COMBINER7_NV 0x8557 /* reuse GL_TEXTURE0_ARB */ /* reuse GL_TEXTURE1_ARB */ /* reuse GL_ZERO */ /* reuse GL_NONE */ /* reuse GL_FOG */ #endif #ifndef GL_NV_fog_distance #define GL_FOG_DISTANCE_MODE_NV 0x855A #define GL_EYE_RADIAL_NV 0x855B #define GL_EYE_PLANE_ABSOLUTE_NV 0x855C /* reuse GL_EYE_PLANE */ #endif #ifndef GL_NV_texgen_emboss #define GL_EMBOSS_LIGHT_NV 0x855D #define GL_EMBOSS_CONSTANT_NV 0x855E #define GL_EMBOSS_MAP_NV 0x855F #endif #ifndef GL_NV_blend_square #endif #ifndef GL_NV_texture_env_combine4 #define GL_COMBINE4_NV 0x8503 #define GL_SOURCE3_RGB_NV 0x8583 #define GL_SOURCE3_ALPHA_NV 0x858B #define GL_OPERAND3_RGB_NV 0x8593 #define GL_OPERAND3_ALPHA_NV 0x859B #endif #ifndef GL_MESA_resize_buffers #endif #ifndef GL_MESA_window_pos #endif #ifndef GL_EXT_texture_compression_s3tc #define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 #define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 #define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 #define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 #endif #ifndef GL_IBM_cull_vertex #define GL_CULL_VERTEX_IBM 103050 #endif #ifndef GL_IBM_multimode_draw_arrays #endif #ifndef GL_IBM_vertex_array_lists #define GL_VERTEX_ARRAY_LIST_IBM 103070 #define GL_NORMAL_ARRAY_LIST_IBM 103071 #define GL_COLOR_ARRAY_LIST_IBM 103072 #define GL_INDEX_ARRAY_LIST_IBM 103073 #define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 #define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 #define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 #define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 #define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 #define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 #define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 #define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 #define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 #define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 #define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 #define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 #endif #ifndef GL_SGIX_subsample #define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 #define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 #define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 #define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 #define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 #endif #ifndef GL_SGIX_ycrcb_subsample #endif #ifndef GL_SGIX_ycrcba #define GL_YCRCB_SGIX 0x8318 #define GL_YCRCBA_SGIX 0x8319 #endif #ifndef GL_SGI_depth_pass_instrument #define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 #define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 #define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 #endif #ifndef GL_3DFX_texture_compression_FXT1 #define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 #define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 #endif #ifndef GL_3DFX_multisample #define GL_MULTISAMPLE_3DFX 0x86B2 #define GL_SAMPLE_BUFFERS_3DFX 0x86B3 #define GL_SAMPLES_3DFX 0x86B4 #define GL_MULTISAMPLE_BIT_3DFX 0x20000000 #endif #ifndef GL_3DFX_tbuffer #endif #ifndef GL_EXT_multisample #define GL_MULTISAMPLE_EXT 0x809D #define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E #define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F #define GL_SAMPLE_MASK_EXT 0x80A0 #define GL_1PASS_EXT 0x80A1 #define GL_2PASS_0_EXT 0x80A2 #define GL_2PASS_1_EXT 0x80A3 #define GL_4PASS_0_EXT 0x80A4 #define GL_4PASS_1_EXT 0x80A5 #define GL_4PASS_2_EXT 0x80A6 #define GL_4PASS_3_EXT 0x80A7 #define GL_SAMPLE_BUFFERS_EXT 0x80A8 #define GL_SAMPLES_EXT 0x80A9 #define GL_SAMPLE_MASK_VALUE_EXT 0x80AA #define GL_SAMPLE_MASK_INVERT_EXT 0x80AB #define GL_SAMPLE_PATTERN_EXT 0x80AC #define GL_MULTISAMPLE_BIT_EXT 0x20000000 #endif #ifndef GL_SGIX_vertex_preclip #define GL_VERTEX_PRECLIP_SGIX 0x83EE #define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF #endif #ifndef GL_SGIX_convolution_accuracy #define GL_CONVOLUTION_HINT_SGIX 0x8316 #endif #ifndef GL_SGIX_resample #define GL_PACK_RESAMPLE_SGIX 0x842C #define GL_UNPACK_RESAMPLE_SGIX 0x842D #define GL_RESAMPLE_REPLICATE_SGIX 0x842E #define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F #define GL_RESAMPLE_DECIMATE_SGIX 0x8430 #endif #ifndef GL_SGIS_point_line_texgen #define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 #define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 #define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 #define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 #define GL_EYE_POINT_SGIS 0x81F4 #define GL_OBJECT_POINT_SGIS 0x81F5 #define GL_EYE_LINE_SGIS 0x81F6 #define GL_OBJECT_LINE_SGIS 0x81F7 #endif #ifndef GL_SGIS_texture_color_mask #define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF #endif #ifndef GL_EXT_texture_env_dot3 #define GL_DOT3_RGB_EXT 0x8740 #define GL_DOT3_RGBA_EXT 0x8741 #endif #ifndef GL_ATI_texture_mirror_once #define GL_MIRROR_CLAMP_ATI 0x8742 #define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 #endif #ifndef GL_NV_fence #define GL_ALL_COMPLETED_NV 0x84F2 #define GL_FENCE_STATUS_NV 0x84F3 #define GL_FENCE_CONDITION_NV 0x84F4 #endif #ifndef GL_IBM_texture_mirrored_repeat #define GL_MIRRORED_REPEAT_IBM 0x8370 #endif #ifndef GL_NV_evaluators #define GL_EVAL_2D_NV 0x86C0 #define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 #define GL_MAP_TESSELLATION_NV 0x86C2 #define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 #define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 #define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 #define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 #define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 #define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 #define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 #define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA #define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB #define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC #define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD #define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE #define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF #define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 #define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 #define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 #define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 #define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 #define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 #define GL_MAX_MAP_TESSELLATION_NV 0x86D6 #define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 #endif #ifndef GL_NV_packed_depth_stencil #define GL_DEPTH_STENCIL_NV 0x84F9 #define GL_UNSIGNED_INT_24_8_NV 0x84FA #endif #ifndef GL_NV_register_combiners2 #define GL_PER_STAGE_CONSTANTS_NV 0x8535 #endif #ifndef GL_NV_texture_compression_vtc #endif #ifndef GL_NV_texture_rectangle #define GL_TEXTURE_RECTANGLE_NV 0x84F5 #define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 #define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 #define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 #endif #ifndef GL_NV_texture_shader #define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C #define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D #define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E #define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 #define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA #define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB #define GL_DSDT_MAG_INTENSITY_NV 0x86DC #define GL_SHADER_CONSISTENT_NV 0x86DD #define GL_TEXTURE_SHADER_NV 0x86DE #define GL_SHADER_OPERATION_NV 0x86DF #define GL_CULL_MODES_NV 0x86E0 #define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 #define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 #define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 #define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV #define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV #define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV #define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 #define GL_CONST_EYE_NV 0x86E5 #define GL_PASS_THROUGH_NV 0x86E6 #define GL_CULL_FRAGMENT_NV 0x86E7 #define GL_OFFSET_TEXTURE_2D_NV 0x86E8 #define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 #define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA #define GL_DOT_PRODUCT_NV 0x86EC #define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED #define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE #define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 #define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 #define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 #define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 #define GL_HILO_NV 0x86F4 #define GL_DSDT_NV 0x86F5 #define GL_DSDT_MAG_NV 0x86F6 #define GL_DSDT_MAG_VIB_NV 0x86F7 #define GL_HILO16_NV 0x86F8 #define GL_SIGNED_HILO_NV 0x86F9 #define GL_SIGNED_HILO16_NV 0x86FA #define GL_SIGNED_RGBA_NV 0x86FB #define GL_SIGNED_RGBA8_NV 0x86FC #define GL_SIGNED_RGB_NV 0x86FE #define GL_SIGNED_RGB8_NV 0x86FF #define GL_SIGNED_LUMINANCE_NV 0x8701 #define GL_SIGNED_LUMINANCE8_NV 0x8702 #define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 #define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 #define GL_SIGNED_ALPHA_NV 0x8705 #define GL_SIGNED_ALPHA8_NV 0x8706 #define GL_SIGNED_INTENSITY_NV 0x8707 #define GL_SIGNED_INTENSITY8_NV 0x8708 #define GL_DSDT8_NV 0x8709 #define GL_DSDT8_MAG8_NV 0x870A #define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B #define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C #define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D #define GL_HI_SCALE_NV 0x870E #define GL_LO_SCALE_NV 0x870F #define GL_DS_SCALE_NV 0x8710 #define GL_DT_SCALE_NV 0x8711 #define GL_MAGNITUDE_SCALE_NV 0x8712 #define GL_VIBRANCE_SCALE_NV 0x8713 #define GL_HI_BIAS_NV 0x8714 #define GL_LO_BIAS_NV 0x8715 #define GL_DS_BIAS_NV 0x8716 #define GL_DT_BIAS_NV 0x8717 #define GL_MAGNITUDE_BIAS_NV 0x8718 #define GL_VIBRANCE_BIAS_NV 0x8719 #define GL_TEXTURE_BORDER_VALUES_NV 0x871A #define GL_TEXTURE_HI_SIZE_NV 0x871B #define GL_TEXTURE_LO_SIZE_NV 0x871C #define GL_TEXTURE_DS_SIZE_NV 0x871D #define GL_TEXTURE_DT_SIZE_NV 0x871E #define GL_TEXTURE_MAG_SIZE_NV 0x871F #endif #ifndef GL_NV_texture_shader2 #define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF #endif #ifndef GL_NV_vertex_array_range2 #define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 #endif #ifndef GL_NV_vertex_program #define GL_VERTEX_PROGRAM_NV 0x8620 #define GL_VERTEX_STATE_PROGRAM_NV 0x8621 #define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 #define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 #define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 #define GL_CURRENT_ATTRIB_NV 0x8626 #define GL_PROGRAM_LENGTH_NV 0x8627 #define GL_PROGRAM_STRING_NV 0x8628 #define GL_MODELVIEW_PROJECTION_NV 0x8629 #define GL_IDENTITY_NV 0x862A #define GL_INVERSE_NV 0x862B #define GL_TRANSPOSE_NV 0x862C #define GL_INVERSE_TRANSPOSE_NV 0x862D #define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E #define GL_MAX_TRACK_MATRICES_NV 0x862F #define GL_MATRIX0_NV 0x8630 #define GL_MATRIX1_NV 0x8631 #define GL_MATRIX2_NV 0x8632 #define GL_MATRIX3_NV 0x8633 #define GL_MATRIX4_NV 0x8634 #define GL_MATRIX5_NV 0x8635 #define GL_MATRIX6_NV 0x8636 #define GL_MATRIX7_NV 0x8637 #define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 #define GL_CURRENT_MATRIX_NV 0x8641 #define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 #define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 #define GL_PROGRAM_PARAMETER_NV 0x8644 #define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 #define GL_PROGRAM_TARGET_NV 0x8646 #define GL_PROGRAM_RESIDENT_NV 0x8647 #define GL_TRACK_MATRIX_NV 0x8648 #define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 #define GL_VERTEX_PROGRAM_BINDING_NV 0x864A #define GL_PROGRAM_ERROR_POSITION_NV 0x864B #define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 #define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 #define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 #define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 #define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 #define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 #define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 #define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 #define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 #define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 #define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A #define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B #define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C #define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D #define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E #define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F #define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 #define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 #define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 #define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 #define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 #define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 #define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 #define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 #define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 #define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 #define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A #define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B #define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C #define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D #define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E #define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F #define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 #define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 #define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 #define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 #define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 #define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 #define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 #define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 #define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 #define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 #define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A #define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B #define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C #define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D #define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E #define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F #endif #ifndef GL_SGIX_texture_coordinate_clamp #define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 #define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A #define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B #endif #ifndef GL_SGIX_scalebias_hint #define GL_SCALEBIAS_HINT_SGIX 0x8322 #endif #ifndef GL_OML_interlace #define GL_INTERLACE_OML 0x8980 #define GL_INTERLACE_READ_OML 0x8981 #endif #ifndef GL_OML_subsample #define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 #define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 #endif #ifndef GL_OML_resample #define GL_PACK_RESAMPLE_OML 0x8984 #define GL_UNPACK_RESAMPLE_OML 0x8985 #define GL_RESAMPLE_REPLICATE_OML 0x8986 #define GL_RESAMPLE_ZERO_FILL_OML 0x8987 #define GL_RESAMPLE_AVERAGE_OML 0x8988 #define GL_RESAMPLE_DECIMATE_OML 0x8989 #endif #ifndef GL_NV_copy_depth_to_color #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E #define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F #endif #ifndef GL_ATI_envmap_bumpmap #define GL_BUMP_ROT_MATRIX_ATI 0x8775 #define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 #define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 #define GL_BUMP_TEX_UNITS_ATI 0x8778 #define GL_DUDV_ATI 0x8779 #define GL_DU8DV8_ATI 0x877A #define GL_BUMP_ENVMAP_ATI 0x877B #define GL_BUMP_TARGET_ATI 0x877C #endif #ifndef GL_ATI_fragment_shader #define GL_FRAGMENT_SHADER_ATI 0x8920 #define GL_REG_0_ATI 0x8921 #define GL_REG_1_ATI 0x8922 #define GL_REG_2_ATI 0x8923 #define GL_REG_3_ATI 0x8924 #define GL_REG_4_ATI 0x8925 #define GL_REG_5_ATI 0x8926 #define GL_REG_6_ATI 0x8927 #define GL_REG_7_ATI 0x8928 #define GL_REG_8_ATI 0x8929 #define GL_REG_9_ATI 0x892A #define GL_REG_10_ATI 0x892B #define GL_REG_11_ATI 0x892C #define GL_REG_12_ATI 0x892D #define GL_REG_13_ATI 0x892E #define GL_REG_14_ATI 0x892F #define GL_REG_15_ATI 0x8930 #define GL_REG_16_ATI 0x8931 #define GL_REG_17_ATI 0x8932 #define GL_REG_18_ATI 0x8933 #define GL_REG_19_ATI 0x8934 #define GL_REG_20_ATI 0x8935 #define GL_REG_21_ATI 0x8936 #define GL_REG_22_ATI 0x8937 #define GL_REG_23_ATI 0x8938 #define GL_REG_24_ATI 0x8939 #define GL_REG_25_ATI 0x893A #define GL_REG_26_ATI 0x893B #define GL_REG_27_ATI 0x893C #define GL_REG_28_ATI 0x893D #define GL_REG_29_ATI 0x893E #define GL_REG_30_ATI 0x893F #define GL_REG_31_ATI 0x8940 #define GL_CON_0_ATI 0x8941 #define GL_CON_1_ATI 0x8942 #define GL_CON_2_ATI 0x8943 #define GL_CON_3_ATI 0x8944 #define GL_CON_4_ATI 0x8945 #define GL_CON_5_ATI 0x8946 #define GL_CON_6_ATI 0x8947 #define GL_CON_7_ATI 0x8948 #define GL_CON_8_ATI 0x8949 #define GL_CON_9_ATI 0x894A #define GL_CON_10_ATI 0x894B #define GL_CON_11_ATI 0x894C #define GL_CON_12_ATI 0x894D #define GL_CON_13_ATI 0x894E #define GL_CON_14_ATI 0x894F #define GL_CON_15_ATI 0x8950 #define GL_CON_16_ATI 0x8951 #define GL_CON_17_ATI 0x8952 #define GL_CON_18_ATI 0x8953 #define GL_CON_19_ATI 0x8954 #define GL_CON_20_ATI 0x8955 #define GL_CON_21_ATI 0x8956 #define GL_CON_22_ATI 0x8957 #define GL_CON_23_ATI 0x8958 #define GL_CON_24_ATI 0x8959 #define GL_CON_25_ATI 0x895A #define GL_CON_26_ATI 0x895B #define GL_CON_27_ATI 0x895C #define GL_CON_28_ATI 0x895D #define GL_CON_29_ATI 0x895E #define GL_CON_30_ATI 0x895F #define GL_CON_31_ATI 0x8960 #define GL_MOV_ATI 0x8961 #define GL_ADD_ATI 0x8963 #define GL_MUL_ATI 0x8964 #define GL_SUB_ATI 0x8965 #define GL_DOT3_ATI 0x8966 #define GL_DOT4_ATI 0x8967 #define GL_MAD_ATI 0x8968 #define GL_LERP_ATI 0x8969 #define GL_CND_ATI 0x896A #define GL_CND0_ATI 0x896B #define GL_DOT2_ADD_ATI 0x896C #define GL_SECONDARY_INTERPOLATOR_ATI 0x896D #define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E #define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F #define GL_NUM_PASSES_ATI 0x8970 #define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 #define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 #define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 #define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 #define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 #define GL_SWIZZLE_STR_ATI 0x8976 #define GL_SWIZZLE_STQ_ATI 0x8977 #define GL_SWIZZLE_STR_DR_ATI 0x8978 #define GL_SWIZZLE_STQ_DQ_ATI 0x8979 #define GL_SWIZZLE_STRQ_ATI 0x897A #define GL_SWIZZLE_STRQ_DQ_ATI 0x897B #define GL_RED_BIT_ATI 0x00000001 #define GL_GREEN_BIT_ATI 0x00000002 #define GL_BLUE_BIT_ATI 0x00000004 #define GL_2X_BIT_ATI 0x00000001 #define GL_4X_BIT_ATI 0x00000002 #define GL_8X_BIT_ATI 0x00000004 #define GL_HALF_BIT_ATI 0x00000008 #define GL_QUARTER_BIT_ATI 0x00000010 #define GL_EIGHTH_BIT_ATI 0x00000020 #define GL_SATURATE_BIT_ATI 0x00000040 #define GL_COMP_BIT_ATI 0x00000002 #define GL_NEGATE_BIT_ATI 0x00000004 #define GL_BIAS_BIT_ATI 0x00000008 #endif #ifndef GL_ATI_pn_triangles #define GL_PN_TRIANGLES_ATI 0x87F0 #define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 #define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 #define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 #define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 #define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 #define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 #define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 #define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 #endif #ifndef GL_ATI_vertex_array_object #define GL_STATIC_ATI 0x8760 #define GL_DYNAMIC_ATI 0x8761 #define GL_PRESERVE_ATI 0x8762 #define GL_DISCARD_ATI 0x8763 #define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 #define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 #define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 #define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 #endif #ifndef GL_EXT_vertex_shader #define GL_VERTEX_SHADER_EXT 0x8780 #define GL_VERTEX_SHADER_BINDING_EXT 0x8781 #define GL_OP_INDEX_EXT 0x8782 #define GL_OP_NEGATE_EXT 0x8783 #define GL_OP_DOT3_EXT 0x8784 #define GL_OP_DOT4_EXT 0x8785 #define GL_OP_MUL_EXT 0x8786 #define GL_OP_ADD_EXT 0x8787 #define GL_OP_MADD_EXT 0x8788 #define GL_OP_FRAC_EXT 0x8789 #define GL_OP_MAX_EXT 0x878A #define GL_OP_MIN_EXT 0x878B #define GL_OP_SET_GE_EXT 0x878C #define GL_OP_SET_LT_EXT 0x878D #define GL_OP_CLAMP_EXT 0x878E #define GL_OP_FLOOR_EXT 0x878F #define GL_OP_ROUND_EXT 0x8790 #define GL_OP_EXP_BASE_2_EXT 0x8791 #define GL_OP_LOG_BASE_2_EXT 0x8792 #define GL_OP_POWER_EXT 0x8793 #define GL_OP_RECIP_EXT 0x8794 #define GL_OP_RECIP_SQRT_EXT 0x8795 #define GL_OP_SUB_EXT 0x8796 #define GL_OP_CROSS_PRODUCT_EXT 0x8797 #define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 #define GL_OP_MOV_EXT 0x8799 #define GL_OUTPUT_VERTEX_EXT 0x879A #define GL_OUTPUT_COLOR0_EXT 0x879B #define GL_OUTPUT_COLOR1_EXT 0x879C #define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D #define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E #define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F #define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 #define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 #define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 #define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 #define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 #define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 #define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 #define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 #define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 #define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 #define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA #define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB #define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC #define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD #define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE #define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF #define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 #define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 #define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 #define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 #define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 #define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 #define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 #define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 #define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 #define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 #define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA #define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB #define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC #define GL_OUTPUT_FOG_EXT 0x87BD #define GL_SCALAR_EXT 0x87BE #define GL_VECTOR_EXT 0x87BF #define GL_MATRIX_EXT 0x87C0 #define GL_VARIANT_EXT 0x87C1 #define GL_INVARIANT_EXT 0x87C2 #define GL_LOCAL_CONSTANT_EXT 0x87C3 #define GL_LOCAL_EXT 0x87C4 #define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 #define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 #define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 #define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 #define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA #define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB #define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC #define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD #define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE #define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF #define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 #define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 #define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 #define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 #define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 #define GL_X_EXT 0x87D5 #define GL_Y_EXT 0x87D6 #define GL_Z_EXT 0x87D7 #define GL_W_EXT 0x87D8 #define GL_NEGATIVE_X_EXT 0x87D9 #define GL_NEGATIVE_Y_EXT 0x87DA #define GL_NEGATIVE_Z_EXT 0x87DB #define GL_NEGATIVE_W_EXT 0x87DC #define GL_ZERO_EXT 0x87DD #define GL_ONE_EXT 0x87DE #define GL_NEGATIVE_ONE_EXT 0x87DF #define GL_NORMALIZED_RANGE_EXT 0x87E0 #define GL_FULL_RANGE_EXT 0x87E1 #define GL_CURRENT_VERTEX_EXT 0x87E2 #define GL_MVP_MATRIX_EXT 0x87E3 #define GL_VARIANT_VALUE_EXT 0x87E4 #define GL_VARIANT_DATATYPE_EXT 0x87E5 #define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 #define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 #define GL_VARIANT_ARRAY_EXT 0x87E8 #define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 #define GL_INVARIANT_VALUE_EXT 0x87EA #define GL_INVARIANT_DATATYPE_EXT 0x87EB #define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC #define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED #endif #ifndef GL_ATI_vertex_streams #define GL_MAX_VERTEX_STREAMS_ATI 0x876B #define GL_VERTEX_STREAM0_ATI 0x876C #define GL_VERTEX_STREAM1_ATI 0x876D #define GL_VERTEX_STREAM2_ATI 0x876E #define GL_VERTEX_STREAM3_ATI 0x876F #define GL_VERTEX_STREAM4_ATI 0x8770 #define GL_VERTEX_STREAM5_ATI 0x8771 #define GL_VERTEX_STREAM6_ATI 0x8772 #define GL_VERTEX_STREAM7_ATI 0x8773 #define GL_VERTEX_SOURCE_ATI 0x8774 #endif #ifndef GL_ATI_element_array #define GL_ELEMENT_ARRAY_ATI 0x8768 #define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 #define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A #endif #ifndef GL_SUN_mesh_array #define GL_QUAD_MESH_SUN 0x8614 #define GL_TRIANGLE_MESH_SUN 0x8615 #endif #ifndef GL_SUN_slice_accum #define GL_SLICE_ACCUM_SUN 0x85CC #endif #ifndef GL_NV_multisample_filter_hint #define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 #endif #ifndef GL_NV_depth_clamp #define GL_DEPTH_CLAMP_NV 0x864F #endif #ifndef GL_NV_occlusion_query #define GL_PIXEL_COUNTER_BITS_NV 0x8864 #define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 #define GL_PIXEL_COUNT_NV 0x8866 #define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 #endif #ifndef GL_NV_point_sprite #define GL_POINT_SPRITE_NV 0x8861 #define GL_COORD_REPLACE_NV 0x8862 #define GL_POINT_SPRITE_R_MODE_NV 0x8863 #endif #ifndef GL_NV_texture_shader3 #define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 #define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 #define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 #define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 #define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 #define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 #define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 #define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 #define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 #define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 #define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A #define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B #define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C #define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D #define GL_HILO8_NV 0x885E #define GL_SIGNED_HILO8_NV 0x885F #define GL_FORCE_BLUE_TO_ONE_NV 0x8860 #endif #ifndef GL_NV_vertex_program1_1 #endif #ifndef GL_EXT_shadow_funcs #endif #ifndef GL_EXT_stencil_two_side #define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 #define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 #endif #ifndef GL_ATI_text_fragment_shader #define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 #endif #ifndef GL_APPLE_client_storage #define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 #endif #ifndef GL_APPLE_element_array #define GL_ELEMENT_ARRAY_APPLE 0x8768 #define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769 #define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A #endif #ifndef GL_APPLE_fence #define GL_DRAW_PIXELS_APPLE 0x8A0A #define GL_FENCE_APPLE 0x8A0B #endif #ifndef GL_APPLE_vertex_array_object #define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 #endif #ifndef GL_APPLE_vertex_array_range #define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D #define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E #define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F #define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 #define GL_STORAGE_CACHED_APPLE 0x85BE #define GL_STORAGE_SHARED_APPLE 0x85BF #endif #ifndef GL_APPLE_ycbcr_422 #define GL_YCBCR_422_APPLE 0x85B9 #define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA #define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB #endif #ifndef GL_S3_s3tc #define GL_RGB_S3TC 0x83A0 #define GL_RGB4_S3TC 0x83A1 #define GL_RGBA_S3TC 0x83A2 #define GL_RGBA4_S3TC 0x83A3 #endif #ifndef GL_ATI_draw_buffers #define GL_MAX_DRAW_BUFFERS_ATI 0x8824 #define GL_DRAW_BUFFER0_ATI 0x8825 #define GL_DRAW_BUFFER1_ATI 0x8826 #define GL_DRAW_BUFFER2_ATI 0x8827 #define GL_DRAW_BUFFER3_ATI 0x8828 #define GL_DRAW_BUFFER4_ATI 0x8829 #define GL_DRAW_BUFFER5_ATI 0x882A #define GL_DRAW_BUFFER6_ATI 0x882B #define GL_DRAW_BUFFER7_ATI 0x882C #define GL_DRAW_BUFFER8_ATI 0x882D #define GL_DRAW_BUFFER9_ATI 0x882E #define GL_DRAW_BUFFER10_ATI 0x882F #define GL_DRAW_BUFFER11_ATI 0x8830 #define GL_DRAW_BUFFER12_ATI 0x8831 #define GL_DRAW_BUFFER13_ATI 0x8832 #define GL_DRAW_BUFFER14_ATI 0x8833 #define GL_DRAW_BUFFER15_ATI 0x8834 #endif #ifndef GL_ATI_pixel_format_float #define GL_TYPE_RGBA_FLOAT_ATI 0x8820 #define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 #endif #ifndef GL_ATI_texture_env_combine3 #define GL_MODULATE_ADD_ATI 0x8744 #define GL_MODULATE_SIGNED_ADD_ATI 0x8745 #define GL_MODULATE_SUBTRACT_ATI 0x8746 #endif #ifndef GL_ATI_texture_float #define GL_RGBA_FLOAT32_ATI 0x8814 #define GL_RGB_FLOAT32_ATI 0x8815 #define GL_ALPHA_FLOAT32_ATI 0x8816 #define GL_INTENSITY_FLOAT32_ATI 0x8817 #define GL_LUMINANCE_FLOAT32_ATI 0x8818 #define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 #define GL_RGBA_FLOAT16_ATI 0x881A #define GL_RGB_FLOAT16_ATI 0x881B #define GL_ALPHA_FLOAT16_ATI 0x881C #define GL_INTENSITY_FLOAT16_ATI 0x881D #define GL_LUMINANCE_FLOAT16_ATI 0x881E #define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F #endif #ifndef GL_NV_float_buffer #define GL_FLOAT_R_NV 0x8880 #define GL_FLOAT_RG_NV 0x8881 #define GL_FLOAT_RGB_NV 0x8882 #define GL_FLOAT_RGBA_NV 0x8883 #define GL_FLOAT_R16_NV 0x8884 #define GL_FLOAT_R32_NV 0x8885 #define GL_FLOAT_RG16_NV 0x8886 #define GL_FLOAT_RG32_NV 0x8887 #define GL_FLOAT_RGB16_NV 0x8888 #define GL_FLOAT_RGB32_NV 0x8889 #define GL_FLOAT_RGBA16_NV 0x888A #define GL_FLOAT_RGBA32_NV 0x888B #define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C #define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D #define GL_FLOAT_RGBA_MODE_NV 0x888E #endif #ifndef GL_NV_fragment_program #define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 #define GL_FRAGMENT_PROGRAM_NV 0x8870 #define GL_MAX_TEXTURE_COORDS_NV 0x8871 #define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 #define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 #define GL_PROGRAM_ERROR_STRING_NV 0x8874 #endif #ifndef GL_NV_half_float #define GL_HALF_FLOAT_NV 0x140B #endif #ifndef GL_NV_pixel_data_range #define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 #define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 #define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A #define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B #define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C #define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D #endif #ifndef GL_NV_primitive_restart #define GL_PRIMITIVE_RESTART_NV 0x8558 #define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 #endif #ifndef GL_NV_texture_expand_normal #define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F #endif #ifndef GL_NV_vertex_program2 #endif #ifndef GL_ATI_map_object_buffer #endif #ifndef GL_ATI_separate_stencil #define GL_STENCIL_BACK_FUNC_ATI 0x8800 #define GL_STENCIL_BACK_FAIL_ATI 0x8801 #define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 #define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 #endif #ifndef GL_ATI_vertex_attrib_array_object #endif #ifndef GL_OES_read_format #define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A #define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B #endif #ifndef GL_EXT_depth_bounds_test #define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 #define GL_DEPTH_BOUNDS_EXT 0x8891 #endif #ifndef GL_EXT_texture_mirror_clamp #define GL_MIRROR_CLAMP_EXT 0x8742 #define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 #define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 #endif #ifndef GL_EXT_blend_equation_separate #define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION #define GL_BLEND_EQUATION_ALPHA_EXT 0x883D #endif #ifndef GL_MESA_pack_invert #define GL_PACK_INVERT_MESA 0x8758 #endif #ifndef GL_MESA_ycbcr_texture #define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA #define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB #define GL_YCBCR_MESA 0x8757 #endif #ifndef GL_EXT_pixel_buffer_object #define GL_PIXEL_PACK_BUFFER_EXT 0x88EB #define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC #define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED #define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF #endif #ifndef GL_NV_fragment_program_option #endif #ifndef GL_NV_fragment_program2 #define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 #define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 #define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 #define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 #define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 #endif #ifndef GL_NV_vertex_program2_option /* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */ /* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */ #endif #ifndef GL_NV_vertex_program3 /* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */ #endif #ifndef GL_EXT_framebuffer_object #define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 #define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 #define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 #define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 #define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 #define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 #define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 #define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 #define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 #define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 #define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA #define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB #define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC #define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD #define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF #define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 #define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 #define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 #define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 #define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 #define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 #define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 #define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 #define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 #define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 #define GL_COLOR_ATTACHMENT10_EXT 0x8CEA #define GL_COLOR_ATTACHMENT11_EXT 0x8CEB #define GL_COLOR_ATTACHMENT12_EXT 0x8CEC #define GL_COLOR_ATTACHMENT13_EXT 0x8CED #define GL_COLOR_ATTACHMENT14_EXT 0x8CEE #define GL_COLOR_ATTACHMENT15_EXT 0x8CEF #define GL_DEPTH_ATTACHMENT_EXT 0x8D00 #define GL_STENCIL_ATTACHMENT_EXT 0x8D20 #define GL_FRAMEBUFFER_EXT 0x8D40 #define GL_RENDERBUFFER_EXT 0x8D41 #define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 #define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 #define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 #define GL_STENCIL_INDEX1_EXT 0x8D46 #define GL_STENCIL_INDEX4_EXT 0x8D47 #define GL_STENCIL_INDEX8_EXT 0x8D48 #define GL_STENCIL_INDEX16_EXT 0x8D49 #define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 #define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 #define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 #define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 #define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 #define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 #endif #ifndef GL_GREMEDY_string_marker #endif #ifndef GL_EXT_packed_depth_stencil #define GL_DEPTH_STENCIL_EXT 0x84F9 #define GL_UNSIGNED_INT_24_8_EXT 0x84FA #define GL_DEPTH24_STENCIL8_EXT 0x88F0 #define GL_TEXTURE_STENCIL_SIZE_EXT 0x88F1 #endif #ifndef GL_EXT_stencil_clear_tag #define GL_STENCIL_TAG_BITS_EXT 0x88F2 #define GL_STENCIL_CLEAR_TAG_VALUE_EXT 0x88F3 #endif #ifndef GL_EXT_texture_sRGB #define GL_SRGB_EXT 0x8C40 #define GL_SRGB8_EXT 0x8C41 #define GL_SRGB_ALPHA_EXT 0x8C42 #define GL_SRGB8_ALPHA8_EXT 0x8C43 #define GL_SLUMINANCE_ALPHA_EXT 0x8C44 #define GL_SLUMINANCE8_ALPHA8_EXT 0x8C45 #define GL_SLUMINANCE_EXT 0x8C46 #define GL_SLUMINANCE8_EXT 0x8C47 #define GL_COMPRESSED_SRGB_EXT 0x8C48 #define GL_COMPRESSED_SRGB_ALPHA_EXT 0x8C49 #define GL_COMPRESSED_SLUMINANCE_EXT 0x8C4A #define GL_COMPRESSED_SLUMINANCE_ALPHA_EXT 0x8C4B #define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F #endif #ifndef GL_EXT_framebuffer_blit #define GL_READ_FRAMEBUFFER_EXT 0x8CA8 #define GL_DRAW_FRAMEBUFFER_EXT 0x8CA9 #define GL_DRAW_FRAMEBUFFER_BINDING_EXT GL_FRAMEBUFFER_BINDING_EXT #define GL_READ_FRAMEBUFFER_BINDING_EXT 0x8CAA #endif #ifndef GL_EXT_framebuffer_multisample #define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB #define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 #define GL_MAX_SAMPLES_EXT 0x8D57 #endif #ifndef GL_MESAX_texture_stack #define GL_TEXTURE_1D_STACK_MESAX 0x8759 #define GL_TEXTURE_2D_STACK_MESAX 0x875A #define GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B #define GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C #define GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D #define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E #endif #ifndef GL_EXT_timer_query #define GL_TIME_ELAPSED_EXT 0x88BF #endif #ifndef GL_EXT_gpu_program_parameters #endif #ifndef GL_APPLE_flush_buffer_range #define GL_BUFFER_SERIALIZED_MODIFY_APPLE 0x8A12 #define GL_BUFFER_FLUSHING_UNMAP_APPLE 0x8A13 #endif #ifndef GL_NV_gpu_program4 #define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 #define GL_MAX_PROGRAM_TEXEL_OFFSET_NV 0x8905 #define GL_PROGRAM_ATTRIB_COMPONENTS_NV 0x8906 #define GL_PROGRAM_RESULT_COMPONENTS_NV 0x8907 #define GL_MAX_PROGRAM_ATTRIB_COMPONENTS_NV 0x8908 #define GL_MAX_PROGRAM_RESULT_COMPONENTS_NV 0x8909 #define GL_MAX_PROGRAM_GENERIC_ATTRIBS_NV 0x8DA5 #define GL_MAX_PROGRAM_GENERIC_RESULTS_NV 0x8DA6 #endif #ifndef GL_NV_geometry_program4 #define GL_LINES_ADJACENCY_EXT 0x000A #define GL_LINE_STRIP_ADJACENCY_EXT 0x000B #define GL_TRIANGLES_ADJACENCY_EXT 0x000C #define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D #define GL_GEOMETRY_PROGRAM_NV 0x8C26 #define GL_MAX_PROGRAM_OUTPUT_VERTICES_NV 0x8C27 #define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 #define GL_GEOMETRY_VERTICES_OUT_EXT 0x8DDA #define GL_GEOMETRY_INPUT_TYPE_EXT 0x8DDB #define GL_GEOMETRY_OUTPUT_TYPE_EXT 0x8DDC #define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 #define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 #define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 #define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT 0x8DA9 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT 0x8CD4 #define GL_PROGRAM_POINT_SIZE_EXT 0x8642 #endif #ifndef GL_EXT_geometry_shader4 #define GL_GEOMETRY_SHADER_EXT 0x8DD9 /* reuse GL_GEOMETRY_VERTICES_OUT_EXT */ /* reuse GL_GEOMETRY_INPUT_TYPE_EXT */ /* reuse GL_GEOMETRY_OUTPUT_TYPE_EXT */ /* reuse GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT */ #define GL_MAX_GEOMETRY_VARYING_COMPONENTS_EXT 0x8DDD #define GL_MAX_VERTEX_VARYING_COMPONENTS_EXT 0x8DDE #define GL_MAX_VARYING_COMPONENTS_EXT 0x8B4B #define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF #define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 #define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 /* reuse GL_LINES_ADJACENCY_EXT */ /* reuse GL_LINE_STRIP_ADJACENCY_EXT */ /* reuse GL_TRIANGLES_ADJACENCY_EXT */ /* reuse GL_TRIANGLE_STRIP_ADJACENCY_EXT */ /* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT */ /* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT */ /* reuse GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT */ /* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ /* reuse GL_PROGRAM_POINT_SIZE_EXT */ #endif #ifndef GL_NV_vertex_program4 #define GL_VERTEX_ATTRIB_ARRAY_INTEGER_NV 0x88FD #endif #ifndef GL_EXT_gpu_shader4 #define GL_SAMPLER_1D_ARRAY_EXT 0x8DC0 #define GL_SAMPLER_2D_ARRAY_EXT 0x8DC1 #define GL_SAMPLER_BUFFER_EXT 0x8DC2 #define GL_SAMPLER_1D_ARRAY_SHADOW_EXT 0x8DC3 #define GL_SAMPLER_2D_ARRAY_SHADOW_EXT 0x8DC4 #define GL_SAMPLER_CUBE_SHADOW_EXT 0x8DC5 #define GL_UNSIGNED_INT_VEC2_EXT 0x8DC6 #define GL_UNSIGNED_INT_VEC3_EXT 0x8DC7 #define GL_UNSIGNED_INT_VEC4_EXT 0x8DC8 #define GL_INT_SAMPLER_1D_EXT 0x8DC9 #define GL_INT_SAMPLER_2D_EXT 0x8DCA #define GL_INT_SAMPLER_3D_EXT 0x8DCB #define GL_INT_SAMPLER_CUBE_EXT 0x8DCC #define GL_INT_SAMPLER_2D_RECT_EXT 0x8DCD #define GL_INT_SAMPLER_1D_ARRAY_EXT 0x8DCE #define GL_INT_SAMPLER_2D_ARRAY_EXT 0x8DCF #define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0 #define GL_UNSIGNED_INT_SAMPLER_1D_EXT 0x8DD1 #define GL_UNSIGNED_INT_SAMPLER_2D_EXT 0x8DD2 #define GL_UNSIGNED_INT_SAMPLER_3D_EXT 0x8DD3 #define GL_UNSIGNED_INT_SAMPLER_CUBE_EXT 0x8DD4 #define GL_UNSIGNED_INT_SAMPLER_2D_RECT_EXT 0x8DD5 #define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY_EXT 0x8DD6 #define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY_EXT 0x8DD7 #define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 #endif #ifndef GL_EXT_draw_instanced #endif #ifndef GL_EXT_packed_float #define GL_R11F_G11F_B10F_EXT 0x8C3A #define GL_UNSIGNED_INT_10F_11F_11F_REV_EXT 0x8C3B #define GL_RGBA_SIGNED_COMPONENTS_EXT 0x8C3C #endif #ifndef GL_EXT_texture_array #define GL_TEXTURE_1D_ARRAY_EXT 0x8C18 #define GL_PROXY_TEXTURE_1D_ARRAY_EXT 0x8C19 #define GL_TEXTURE_2D_ARRAY_EXT 0x8C1A #define GL_PROXY_TEXTURE_2D_ARRAY_EXT 0x8C1B #define GL_TEXTURE_BINDING_1D_ARRAY_EXT 0x8C1C #define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D #define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF #define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E /* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ #endif #ifndef GL_EXT_texture_buffer_object #define GL_TEXTURE_BUFFER_EXT 0x8C2A #define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B #define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C #define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D #define GL_TEXTURE_BUFFER_FORMAT_EXT 0x8C2E #endif #ifndef GL_EXT_texture_compression_latc #define GL_COMPRESSED_LUMINANCE_LATC1_EXT 0x8C70 #define GL_COMPRESSED_SIGNED_LUMINANCE_LATC1_EXT 0x8C71 #define GL_COMPRESSED_LUMINANCE_ALPHA_LATC2_EXT 0x8C72 #define GL_COMPRESSED_SIGNED_LUMINANCE_ALPHA_LATC2_EXT 0x8C73 #endif #ifndef GL_EXT_texture_compression_rgtc #define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB #define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC #define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD #define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE #endif #ifndef GL_EXT_texture_shared_exponent #define GL_RGB9_E5_EXT 0x8C3D #define GL_UNSIGNED_INT_5_9_9_9_REV_EXT 0x8C3E #define GL_TEXTURE_SHARED_SIZE_EXT 0x8C3F #endif #ifndef GL_NV_depth_buffer_float #define GL_DEPTH_COMPONENT32F_NV 0x8DAB #define GL_DEPTH32F_STENCIL8_NV 0x8DAC #define GL_FLOAT_32_UNSIGNED_INT_24_8_REV_NV 0x8DAD #define GL_DEPTH_BUFFER_FLOAT_MODE_NV 0x8DAF #endif #ifndef GL_NV_fragment_program4 #endif #ifndef GL_NV_framebuffer_multisample_coverage #define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB #define GL_RENDERBUFFER_COLOR_SAMPLES_NV 0x8E10 #define GL_MAX_MULTISAMPLE_COVERAGE_MODES_NV 0x8E11 #define GL_MULTISAMPLE_COVERAGE_MODES_NV 0x8E12 #endif #ifndef GL_EXT_framebuffer_sRGB #define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 #define GL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x8DBA #endif #ifndef GL_NV_geometry_shader4 #endif #ifndef GL_NV_parameter_buffer_object #define GL_MAX_PROGRAM_PARAMETER_BUFFER_BINDINGS_NV 0x8DA0 #define GL_MAX_PROGRAM_PARAMETER_BUFFER_SIZE_NV 0x8DA1 #define GL_VERTEX_PROGRAM_PARAMETER_BUFFER_NV 0x8DA2 #define GL_GEOMETRY_PROGRAM_PARAMETER_BUFFER_NV 0x8DA3 #define GL_FRAGMENT_PROGRAM_PARAMETER_BUFFER_NV 0x8DA4 #endif #ifndef GL_EXT_draw_buffers2 #endif #ifndef GL_NV_transform_feedback #define GL_BACK_PRIMARY_COLOR_NV 0x8C77 #define GL_BACK_SECONDARY_COLOR_NV 0x8C78 #define GL_TEXTURE_COORD_NV 0x8C79 #define GL_CLIP_DISTANCE_NV 0x8C7A #define GL_VERTEX_ID_NV 0x8C7B #define GL_PRIMITIVE_ID_NV 0x8C7C #define GL_GENERIC_ATTRIB_NV 0x8C7D #define GL_TRANSFORM_FEEDBACK_ATTRIBS_NV 0x8C7E #define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_NV 0x8C7F #define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_NV 0x8C80 #define GL_ACTIVE_VARYINGS_NV 0x8C81 #define GL_ACTIVE_VARYING_MAX_LENGTH_NV 0x8C82 #define GL_TRANSFORM_FEEDBACK_VARYINGS_NV 0x8C83 #define GL_TRANSFORM_FEEDBACK_BUFFER_START_NV 0x8C84 #define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_NV 0x8C85 #define GL_TRANSFORM_FEEDBACK_RECORD_NV 0x8C86 #define GL_PRIMITIVES_GENERATED_NV 0x8C87 #define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_NV 0x8C88 #define GL_RASTERIZER_DISCARD_NV 0x8C89 #define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_ATTRIBS_NV 0x8C8A #define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_NV 0x8C8B #define GL_INTERLEAVED_ATTRIBS_NV 0x8C8C #define GL_SEPARATE_ATTRIBS_NV 0x8C8D #define GL_TRANSFORM_FEEDBACK_BUFFER_NV 0x8C8E #define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_NV 0x8C8F #endif #ifndef GL_EXT_bindable_uniform #define GL_MAX_VERTEX_BINDABLE_UNIFORMS_EXT 0x8DE2 #define GL_MAX_FRAGMENT_BINDABLE_UNIFORMS_EXT 0x8DE3 #define GL_MAX_GEOMETRY_BINDABLE_UNIFORMS_EXT 0x8DE4 #define GL_MAX_BINDABLE_UNIFORM_SIZE_EXT 0x8DED #define GL_UNIFORM_BUFFER_EXT 0x8DEE #define GL_UNIFORM_BUFFER_BINDING_EXT 0x8DEF #endif #ifndef GL_EXT_texture_integer #define GL_RGBA32UI_EXT 0x8D70 #define GL_RGB32UI_EXT 0x8D71 #define GL_ALPHA32UI_EXT 0x8D72 #define GL_INTENSITY32UI_EXT 0x8D73 #define GL_LUMINANCE32UI_EXT 0x8D74 #define GL_LUMINANCE_ALPHA32UI_EXT 0x8D75 #define GL_RGBA16UI_EXT 0x8D76 #define GL_RGB16UI_EXT 0x8D77 #define GL_ALPHA16UI_EXT 0x8D78 #define GL_INTENSITY16UI_EXT 0x8D79 #define GL_LUMINANCE16UI_EXT 0x8D7A #define GL_LUMINANCE_ALPHA16UI_EXT 0x8D7B #define GL_RGBA8UI_EXT 0x8D7C #define GL_RGB8UI_EXT 0x8D7D #define GL_ALPHA8UI_EXT 0x8D7E #define GL_INTENSITY8UI_EXT 0x8D7F #define GL_LUMINANCE8UI_EXT 0x8D80 #define GL_LUMINANCE_ALPHA8UI_EXT 0x8D81 #define GL_RGBA32I_EXT 0x8D82 #define GL_RGB32I_EXT 0x8D83 #define GL_ALPHA32I_EXT 0x8D84 #define GL_INTENSITY32I_EXT 0x8D85 #define GL_LUMINANCE32I_EXT 0x8D86 #define GL_LUMINANCE_ALPHA32I_EXT 0x8D87 #define GL_RGBA16I_EXT 0x8D88 #define GL_RGB16I_EXT 0x8D89 #define GL_ALPHA16I_EXT 0x8D8A #define GL_INTENSITY16I_EXT 0x8D8B #define GL_LUMINANCE16I_EXT 0x8D8C #define GL_LUMINANCE_ALPHA16I_EXT 0x8D8D #define GL_RGBA8I_EXT 0x8D8E #define GL_RGB8I_EXT 0x8D8F #define GL_ALPHA8I_EXT 0x8D90 #define GL_INTENSITY8I_EXT 0x8D91 #define GL_LUMINANCE8I_EXT 0x8D92 #define GL_LUMINANCE_ALPHA8I_EXT 0x8D93 #define GL_RED_INTEGER_EXT 0x8D94 #define GL_GREEN_INTEGER_EXT 0x8D95 #define GL_BLUE_INTEGER_EXT 0x8D96 #define GL_ALPHA_INTEGER_EXT 0x8D97 #define GL_RGB_INTEGER_EXT 0x8D98 #define GL_RGBA_INTEGER_EXT 0x8D99 #define GL_BGR_INTEGER_EXT 0x8D9A #define GL_BGRA_INTEGER_EXT 0x8D9B #define GL_LUMINANCE_INTEGER_EXT 0x8D9C #define GL_LUMINANCE_ALPHA_INTEGER_EXT 0x8D9D #define GL_RGBA_INTEGER_MODE_EXT 0x8D9E #endif #ifndef GL_GREMEDY_frame_terminator #endif /*************************************************************/ #include #ifndef GL_VERSION_2_0 /* GL type for program/shader text */ typedef char GLchar; /* native character */ #endif #ifndef GL_VERSION_1_5 /* GL types for handling large vertex buffer objects */ #ifdef __APPLE__ typedef long GLintptr; typedef long GLsizeiptr; #else typedef ptrdiff_t GLintptr; typedef ptrdiff_t GLsizeiptr; #endif #endif #ifndef GL_ARB_vertex_buffer_object /* GL types for handling large vertex buffer objects */ #ifdef __APPLE__ typedef long GLintptrARB; typedef long GLsizeiptrARB; #else typedef ptrdiff_t GLintptrARB; typedef ptrdiff_t GLsizeiptrARB; #endif #endif #ifndef GL_ARB_shader_objects /* GL types for handling shader object handles and program/shader text */ typedef char GLcharARB; /* native character */ #if defined(__APPLE__) typedef void *GLhandleARB; /* shader object handle */ #else typedef unsigned int GLhandleARB; /* shader object handle */ #endif #endif /* GL types for "half" precision (s10e5) float data in host memory */ #ifndef GL_ARB_half_float_pixel typedef unsigned short GLhalfARB; #endif #ifndef GL_NV_half_float typedef unsigned short GLhalfNV; #endif #ifndef GLEXT_64_TYPES_DEFINED /* This code block is duplicated in glxext.h, so must be protected */ #define GLEXT_64_TYPES_DEFINED /* Define int32_t, int64_t, and uint64_t types for UST/MSC */ /* (as used in the GL_EXT_timer_query extension). */ #if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L #include #elif defined(__sun__) || defined(__digital__) #include #if defined(__STDC__) #if defined(__arch64__) || defined(_LP64) typedef long int int64_t; typedef unsigned long int uint64_t; #else typedef long long int int64_t; typedef unsigned long long int uint64_t; #endif /* __arch64__ */ #endif /* __STDC__ */ #elif defined( __VMS ) || defined(__sgi) #include #elif defined(__SCO__) || defined(__USLC__) #include #elif defined(__UNIXOS2__) || defined(__SOL64__) typedef long int int32_t; typedef long long int int64_t; typedef unsigned long long int uint64_t; #elif defined(_WIN32) && (defined(__GNUC__)||defined(__WATCOMC__)) #include #elif defined(_WIN32) #if 0 /* handled by SDL_config_windows.h */ typedef __int32 int32_t; typedef __int64 int64_t; typedef unsigned __int64 uint64_t; #endif /* */ #else #include /* Fallback option */ #endif #endif #ifndef GL_EXT_timer_query typedef int64_t GLint64EXT; typedef uint64_t GLuint64EXT; #endif #ifndef GL_VERSION_1_2 #define GL_VERSION_1_2 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf); GLAPI void APIENTRY glBlendEquation (GLenum); GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei); GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei); GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint); GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei); GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean); GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean); GLAPI void APIENTRY glResetHistogram (GLenum); GLAPI void APIENTRY glResetMinmax (GLenum); GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #endif #ifndef GL_VERSION_1_3 #define GL_VERSION_1_3 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glActiveTexture (GLenum); GLAPI void APIENTRY glClientActiveTexture (GLenum); GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble); GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat); GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint); GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort); GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *); GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *); GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *); GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *); GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *); GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean); GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); #endif #ifndef GL_VERSION_1_4 #define GL_VERSION_1_4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glFogCoordf (GLfloat); GLAPI void APIENTRY glFogCoordfv (const GLfloat *); GLAPI void APIENTRY glFogCoordd (GLdouble); GLAPI void APIENTRY glFogCoorddv (const GLdouble *); GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei); GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat); GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *); GLAPI void APIENTRY glPointParameteri (GLenum, GLint); GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *); GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte); GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *); GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *); GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *); GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint); GLAPI void APIENTRY glSecondaryColor3iv (const GLint *); GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort); GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *); GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte); GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *); GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint); GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *); GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort); GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *); GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos2dv (const GLdouble *); GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos2fv (const GLfloat *); GLAPI void APIENTRY glWindowPos2i (GLint, GLint); GLAPI void APIENTRY glWindowPos2iv (const GLint *); GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort); GLAPI void APIENTRY glWindowPos2sv (const GLshort *); GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos3dv (const GLdouble *); GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos3fv (const GLfloat *); GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint); GLAPI void APIENTRY glWindowPos3iv (const GLint *); GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort); GLAPI void APIENTRY glWindowPos3sv (const GLshort *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); #endif #ifndef GL_VERSION_1_5 #define GL_VERSION_1_5 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *); GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *); GLAPI GLboolean APIENTRY glIsQuery (GLuint); GLAPI void APIENTRY glBeginQuery (GLenum, GLuint); GLAPI void APIENTRY glEndQuery (GLenum); GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *); GLAPI void APIENTRY glBindBuffer (GLenum, GLuint); GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *); GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *); GLAPI GLboolean APIENTRY glIsBuffer (GLuint); GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum); GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *); GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *); GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum); GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum); GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); #endif #ifndef GL_VERSION_2_0 #define GL_VERSION_2_0 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum); GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *); GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint); GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint); GLAPI void APIENTRY glAttachShader (GLuint, GLuint); GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *); GLAPI void APIENTRY glCompileShader (GLuint); GLAPI GLuint APIENTRY glCreateProgram (void); GLAPI GLuint APIENTRY glCreateShader (GLenum); GLAPI void APIENTRY glDeleteProgram (GLuint); GLAPI void APIENTRY glDeleteShader (GLuint); GLAPI void APIENTRY glDetachShader (GLuint, GLuint); GLAPI void APIENTRY glDisableVertexAttribArray (GLuint); GLAPI void APIENTRY glEnableVertexAttribArray (GLuint); GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *); GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *); GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *); GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *); GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *); GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *); GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *); GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *); GLAPI GLboolean APIENTRY glIsProgram (GLuint); GLAPI GLboolean APIENTRY glIsShader (GLuint); GLAPI void APIENTRY glLinkProgram (GLuint); GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *); GLAPI void APIENTRY glUseProgram (GLuint); GLAPI void APIENTRY glUniform1f (GLint, GLfloat); GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat); GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glUniform1i (GLint, GLint); GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint); GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint); GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glValidateProgram (GLuint); GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble); GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat); GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort); GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *); GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *); GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *); GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *); GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_VERSION_2_1 #define GL_VERSION_2_1 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glUniformMatrix2x3fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix3x2fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix2x4fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix4x2fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix3x4fv (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix4x3fv (GLint, GLsizei, GLboolean, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); #endif #ifndef GL_ARB_multitexture #define GL_ARB_multitexture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glActiveTextureARB (GLenum); GLAPI void APIENTRY glClientActiveTextureARB (GLenum); GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble); GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat); GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint); GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort); GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *); GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *); GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *); GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *); GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); #endif #ifndef GL_ARB_transpose_matrix #define GL_ARB_transpose_matrix 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *); GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *); GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *); GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); #endif #ifndef GL_ARB_multisample #define GL_ARB_multisample 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); #endif #ifndef GL_ARB_texture_env_add #define GL_ARB_texture_env_add 1 #endif #ifndef GL_ARB_texture_cube_map #define GL_ARB_texture_cube_map 1 #endif #ifndef GL_ARB_texture_compression #define GL_ARB_texture_compression 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); #endif #ifndef GL_ARB_texture_border_clamp #define GL_ARB_texture_border_clamp 1 #endif #ifndef GL_ARB_point_parameters #define GL_ARB_point_parameters 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat); GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); #endif #ifndef GL_ARB_vertex_blend #define GL_ARB_vertex_blend 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *); GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *); GLAPI void APIENTRY glWeightivARB (GLint, const GLint *); GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *); GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *); GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *); GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *); GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *); GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glVertexBlendARB (GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); #endif #ifndef GL_ARB_matrix_palette #define GL_ARB_matrix_palette 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint); GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *); GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *); GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *); GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_ARB_texture_env_combine #define GL_ARB_texture_env_combine 1 #endif #ifndef GL_ARB_texture_env_crossbar #define GL_ARB_texture_env_crossbar 1 #endif #ifndef GL_ARB_texture_env_dot3 #define GL_ARB_texture_env_dot3 1 #endif #ifndef GL_ARB_texture_mirrored_repeat #define GL_ARB_texture_mirrored_repeat 1 #endif #ifndef GL_ARB_depth_texture #define GL_ARB_depth_texture 1 #endif #ifndef GL_ARB_shadow #define GL_ARB_shadow 1 #endif #ifndef GL_ARB_shadow_ambient #define GL_ARB_shadow_ambient 1 #endif #ifndef GL_ARB_window_pos #define GL_ARB_window_pos 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *); GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *); GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint); GLAPI void APIENTRY glWindowPos2ivARB (const GLint *); GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort); GLAPI void APIENTRY glWindowPos2svARB (const GLshort *); GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *); GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *); GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint); GLAPI void APIENTRY glWindowPos3ivARB (const GLint *); GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort); GLAPI void APIENTRY glWindowPos3svARB (const GLshort *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); #endif #ifndef GL_ARB_vertex_program #define GL_ARB_vertex_program 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble); GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat); GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort); GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *); GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *); GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *); GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *); GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint); GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint); GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint); GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *); GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *); GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *); GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *); GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *); GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *); GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *); GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *); GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *); GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *); GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *); GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *); GLAPI GLboolean APIENTRY glIsProgramARB (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); #endif #ifndef GL_ARB_fragment_program #define GL_ARB_fragment_program 1 /* All ARB_fragment_program entry points are shared with ARB_vertex_program. */ #endif #ifndef GL_ARB_vertex_buffer_object #define GL_ARB_vertex_buffer_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint); GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *); GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *); GLAPI GLboolean APIENTRY glIsBufferARB (GLuint); GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum); GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *); GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *); GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum); GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum); GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); #endif #ifndef GL_ARB_occlusion_query #define GL_ARB_occlusion_query 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *); GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *); GLAPI GLboolean APIENTRY glIsQueryARB (GLuint); GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint); GLAPI void APIENTRY glEndQueryARB (GLenum); GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); #endif #ifndef GL_ARB_shader_objects #define GL_ARB_shader_objects 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB); GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum); GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB); GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum); GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *); GLAPI void APIENTRY glCompileShaderARB (GLhandleARB); GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB); GLAPI void APIENTRY glLinkProgramARB (GLhandleARB); GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB); GLAPI void APIENTRY glValidateProgramARB (GLhandleARB); GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat); GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat); GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glUniform1iARB (GLint, GLint); GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint); GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint); GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *); GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *); GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *); GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *); GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *); GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *); GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *); GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *); GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *); GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); #endif #ifndef GL_ARB_vertex_shader #define GL_ARB_vertex_shader 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *); GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); #endif #ifndef GL_ARB_fragment_shader #define GL_ARB_fragment_shader 1 #endif #ifndef GL_ARB_shading_language_100 #define GL_ARB_shading_language_100 1 #endif #ifndef GL_ARB_texture_non_power_of_two #define GL_ARB_texture_non_power_of_two 1 #endif #ifndef GL_ARB_point_sprite #define GL_ARB_point_sprite 1 #endif #ifndef GL_ARB_fragment_program_shadow #define GL_ARB_fragment_program_shadow 1 #endif #ifndef GL_ARB_draw_buffers #define GL_ARB_draw_buffers 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); #endif #ifndef GL_ARB_texture_rectangle #define GL_ARB_texture_rectangle 1 #endif #ifndef GL_ARB_color_buffer_float #define GL_ARB_color_buffer_float 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glClampColorARB (GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); #endif #ifndef GL_ARB_half_float_pixel #define GL_ARB_half_float_pixel 1 #endif #ifndef GL_ARB_texture_float #define GL_ARB_texture_float 1 #endif #ifndef GL_ARB_pixel_buffer_object #define GL_ARB_pixel_buffer_object 1 #endif #ifndef GL_EXT_abgr #define GL_EXT_abgr 1 #endif #ifndef GL_EXT_blend_color #define GL_EXT_blend_color 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); #endif #ifndef GL_EXT_polygon_offset #define GL_EXT_polygon_offset 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); #endif #ifndef GL_EXT_texture #define GL_EXT_texture 1 #endif #ifndef GL_EXT_texture3D #define GL_EXT_texture3D 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); #endif #ifndef GL_SGIS_texture_filter4 #define GL_SGIS_texture_filter4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); #endif #ifndef GL_EXT_subtexture #define GL_EXT_subtexture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); #endif #ifndef GL_EXT_copy_texture #define GL_EXT_copy_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint); GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint); GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei); GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #endif #ifndef GL_EXT_histogram #define GL_EXT_histogram 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *); GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean); GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean); GLAPI void APIENTRY glResetHistogramEXT (GLenum); GLAPI void APIENTRY glResetMinmaxEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); #endif #ifndef GL_EXT_convolution #define GL_EXT_convolution 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint); GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei); GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); #endif #ifndef GL_SGI_color_matrix #define GL_SGI_color_matrix 1 #endif #ifndef GL_SGI_color_table #define GL_SGI_color_table 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei); GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); #endif #ifndef GL_SGIX_pixel_texture #define GL_SGIX_pixel_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPixelTexGenSGIX (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); #endif #ifndef GL_SGIS_pixel_texture #define GL_SGIS_pixel_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint); GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *); GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat); GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *); GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *); GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); #endif #ifndef GL_SGIS_texture4D #define GL_SGIS_texture4D 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); #endif #ifndef GL_SGI_texture_color_table #define GL_SGI_texture_color_table 1 #endif #ifndef GL_EXT_cmyka #define GL_EXT_cmyka 1 #endif #ifndef GL_EXT_texture_object #define GL_EXT_texture_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *); GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint); GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *); GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *); GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint); GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); #endif #ifndef GL_SGIS_detail_texture #define GL_SGIS_detail_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *); GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); #endif #ifndef GL_SGIS_sharpen_texture #define GL_SGIS_sharpen_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *); GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); #endif #ifndef GL_EXT_packed_pixels #define GL_EXT_packed_pixels 1 #endif #ifndef GL_SGIS_texture_lod #define GL_SGIS_texture_lod 1 #endif #ifndef GL_SGIS_multisample #define GL_SGIS_multisample 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean); GLAPI void APIENTRY glSamplePatternSGIS (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); #endif #ifndef GL_EXT_rescale_normal #define GL_EXT_rescale_normal 1 #endif #ifndef GL_EXT_vertex_array #define GL_EXT_vertex_array 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glArrayElementEXT (GLint); GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei); GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *); GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *); GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); #endif #ifndef GL_EXT_misc_attribute #define GL_EXT_misc_attribute 1 #endif #ifndef GL_SGIS_generate_mipmap #define GL_SGIS_generate_mipmap 1 #endif #ifndef GL_SGIX_clipmap #define GL_SGIX_clipmap 1 #endif #ifndef GL_SGIX_shadow #define GL_SGIX_shadow 1 #endif #ifndef GL_SGIS_texture_edge_clamp #define GL_SGIS_texture_edge_clamp 1 #endif #ifndef GL_SGIS_texture_border_clamp #define GL_SGIS_texture_border_clamp 1 #endif #ifndef GL_EXT_blend_minmax #define GL_EXT_blend_minmax 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendEquationEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); #endif #ifndef GL_EXT_blend_subtract #define GL_EXT_blend_subtract 1 #endif #ifndef GL_EXT_blend_logic_op #define GL_EXT_blend_logic_op 1 #endif #ifndef GL_SGIX_interlace #define GL_SGIX_interlace 1 #endif #ifndef GL_SGIX_pixel_tiles #define GL_SGIX_pixel_tiles 1 #endif #ifndef GL_SGIX_texture_select #define GL_SGIX_texture_select 1 #endif #ifndef GL_SGIX_sprite #define GL_SGIX_sprite 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat); GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *); GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint); GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); #endif #ifndef GL_SGIX_texture_multi_buffer #define GL_SGIX_texture_multi_buffer 1 #endif #ifndef GL_EXT_point_parameters #define GL_EXT_point_parameters 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat); GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); #endif #ifndef GL_SGIS_point_parameters #define GL_SGIS_point_parameters 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat); GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); #endif #ifndef GL_SGIX_instruments #define GL_SGIX_instruments 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *); GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *); GLAPI void APIENTRY glReadInstrumentsSGIX (GLint); GLAPI void APIENTRY glStartInstrumentsSGIX (void); GLAPI void APIENTRY glStopInstrumentsSGIX (GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); #endif #ifndef GL_SGIX_texture_scale_bias #define GL_SGIX_texture_scale_bias 1 #endif #ifndef GL_SGIX_framezoom #define GL_SGIX_framezoom 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFrameZoomSGIX (GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); #endif #ifndef GL_SGIX_tag_sample_buffer #define GL_SGIX_tag_sample_buffer 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTagSampleBufferSGIX (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); #endif #ifndef GL_SGIX_polynomial_ffd #define GL_SGIX_polynomial_ffd 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *); GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *); GLAPI void APIENTRY glDeformSGIX (GLbitfield); GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); #endif #ifndef GL_SGIX_reference_plane #define GL_SGIX_reference_plane 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); #endif #ifndef GL_SGIX_flush_raster #define GL_SGIX_flush_raster 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFlushRasterSGIX (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); #endif #ifndef GL_SGIX_depth_texture #define GL_SGIX_depth_texture 1 #endif #ifndef GL_SGIS_fog_function #define GL_SGIS_fog_function 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *); GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); #endif #ifndef GL_SGIX_fog_offset #define GL_SGIX_fog_offset 1 #endif #ifndef GL_HP_image_transform #define GL_HP_image_transform 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint); GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); #endif #ifndef GL_HP_convolution_border_modes #define GL_HP_convolution_border_modes 1 #endif #ifndef GL_SGIX_texture_add_env #define GL_SGIX_texture_add_env 1 #endif #ifndef GL_EXT_color_subtable #define GL_EXT_color_subtable 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); #endif #ifndef GL_PGI_vertex_hints #define GL_PGI_vertex_hints 1 #endif #ifndef GL_PGI_misc_hints #define GL_PGI_misc_hints 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glHintPGI (GLenum, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); #endif #ifndef GL_EXT_paletted_texture #define GL_EXT_paletted_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *); GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); #endif #ifndef GL_EXT_clip_volume_hint #define GL_EXT_clip_volume_hint 1 #endif #ifndef GL_SGIX_list_priority #define GL_SGIX_list_priority 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *); GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat); GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *); GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint); GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); #endif #ifndef GL_SGIX_ir_instrument1 #define GL_SGIX_ir_instrument1 1 #endif #ifndef GL_SGIX_calligraphic_fragment #define GL_SGIX_calligraphic_fragment 1 #endif #ifndef GL_SGIX_texture_lod_bias #define GL_SGIX_texture_lod_bias 1 #endif #ifndef GL_SGIX_shadow_ambient #define GL_SGIX_shadow_ambient 1 #endif #ifndef GL_EXT_index_texture #define GL_EXT_index_texture 1 #endif #ifndef GL_EXT_index_material #define GL_EXT_index_material 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); #endif #ifndef GL_EXT_index_func #define GL_EXT_index_func 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); #endif #ifndef GL_EXT_index_array_formats #define GL_EXT_index_array_formats 1 #endif #ifndef GL_EXT_compiled_vertex_array #define GL_EXT_compiled_vertex_array 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei); GLAPI void APIENTRY glUnlockArraysEXT (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); #endif #ifndef GL_EXT_cull_vertex #define GL_EXT_cull_vertex 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *); GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); #endif #ifndef GL_SGIX_ycrcb #define GL_SGIX_ycrcb 1 #endif #ifndef GL_SGIX_fragment_lighting #define GL_SGIX_fragment_lighting 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum); GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint); GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat); GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *); GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint); GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *); GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint); GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *); GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); #endif #ifndef GL_IBM_rasterpos_clip #define GL_IBM_rasterpos_clip 1 #endif #ifndef GL_HP_texture_lighting #define GL_HP_texture_lighting 1 #endif #ifndef GL_EXT_draw_range_elements #define GL_EXT_draw_range_elements 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); #endif #ifndef GL_WIN_phong_shading #define GL_WIN_phong_shading 1 #endif #ifndef GL_WIN_specular_fog #define GL_WIN_specular_fog 1 #endif #ifndef GL_EXT_light_texture #define GL_EXT_light_texture 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glApplyTextureEXT (GLenum); GLAPI void APIENTRY glTextureLightEXT (GLenum); GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); #endif #ifndef GL_SGIX_blend_alpha_minmax #define GL_SGIX_blend_alpha_minmax 1 #endif #ifndef GL_EXT_bgra #define GL_EXT_bgra 1 #endif #ifndef GL_SGIX_async #define GL_SGIX_async 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint); GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *); GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *); GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei); GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei); GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); #endif #ifndef GL_SGIX_async_pixel #define GL_SGIX_async_pixel 1 #endif #ifndef GL_SGIX_async_histogram #define GL_SGIX_async_histogram 1 #endif #ifndef GL_INTEL_parallel_arrays #define GL_INTEL_parallel_arrays 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *); GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *); GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *); GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); #endif #ifndef GL_HP_occlusion_test #define GL_HP_occlusion_test 1 #endif #ifndef GL_EXT_pixel_transform #define GL_EXT_pixel_transform 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint); GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat); GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); #endif #ifndef GL_EXT_pixel_transform_color_table #define GL_EXT_pixel_transform_color_table 1 #endif #ifndef GL_EXT_shared_texture_palette #define GL_EXT_shared_texture_palette 1 #endif #ifndef GL_EXT_separate_specular_color #define GL_EXT_separate_specular_color 1 #endif #ifndef GL_EXT_secondary_color #define GL_EXT_secondary_color 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte); GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *); GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *); GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *); GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint); GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *); GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort); GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *); GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte); GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *); GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint); GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *); GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort); GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *); GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_EXT_texture_perturb_normal #define GL_EXT_texture_perturb_normal 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTextureNormalEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #endif #ifndef GL_EXT_multi_draw_arrays #define GL_EXT_multi_draw_arrays 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei); GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); #endif #ifndef GL_EXT_fog_coord #define GL_EXT_fog_coord 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFogCoordfEXT (GLfloat); GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *); GLAPI void APIENTRY glFogCoorddEXT (GLdouble); GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *); GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_REND_screen_coordinates #define GL_REND_screen_coordinates 1 #endif #ifndef GL_EXT_coordinate_frame #define GL_EXT_coordinate_frame 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte); GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *); GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *); GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *); GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint); GLAPI void APIENTRY glTangent3ivEXT (const GLint *); GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort); GLAPI void APIENTRY glTangent3svEXT (const GLshort *); GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte); GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *); GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *); GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *); GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint); GLAPI void APIENTRY glBinormal3ivEXT (const GLint *); GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort); GLAPI void APIENTRY glBinormal3svEXT (const GLshort *); GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_EXT_texture_env_combine #define GL_EXT_texture_env_combine 1 #endif #ifndef GL_APPLE_specular_vector #define GL_APPLE_specular_vector 1 #endif #ifndef GL_APPLE_transform_hint #define GL_APPLE_transform_hint 1 #endif #ifndef GL_SGIX_fog_scale #define GL_SGIX_fog_scale 1 #endif #ifndef GL_SUNX_constant_data #define GL_SUNX_constant_data 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFinishTextureSUNX (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); #endif #ifndef GL_SUN_global_alpha #define GL_SUN_global_alpha 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte); GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort); GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint); GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat); GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble); GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte); GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort); GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); #endif #ifndef GL_SUN_triangle_list #define GL_SUN_triangle_list 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint); GLAPI void APIENTRY glReplacementCodeusSUN (GLushort); GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte); GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *); GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *); GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *); GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); #endif #ifndef GL_SUN_vertex #define GL_SUN_vertex 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat); GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *); GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *); GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *); GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *); GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *); GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); #endif #ifndef GL_EXT_blend_func_separate #define GL_EXT_blend_func_separate 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); #endif #ifndef GL_INGR_blend_func_separate #define GL_INGR_blend_func_separate 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); #endif #ifndef GL_INGR_color_clamp #define GL_INGR_color_clamp 1 #endif #ifndef GL_INGR_interlace_read #define GL_INGR_interlace_read 1 #endif #ifndef GL_EXT_stencil_wrap #define GL_EXT_stencil_wrap 1 #endif #ifndef GL_EXT_422_pixels #define GL_EXT_422_pixels 1 #endif #ifndef GL_NV_texgen_reflection #define GL_NV_texgen_reflection 1 #endif #ifndef GL_SUN_convolution_border_modes #define GL_SUN_convolution_border_modes 1 #endif #ifndef GL_EXT_texture_env_add #define GL_EXT_texture_env_add 1 #endif #ifndef GL_EXT_texture_lod_bias #define GL_EXT_texture_lod_bias 1 #endif #ifndef GL_EXT_texture_filter_anisotropic #define GL_EXT_texture_filter_anisotropic 1 #endif #ifndef GL_EXT_vertex_weighting #define GL_EXT_vertex_weighting 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexWeightfEXT (GLfloat); GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *); GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); #endif #ifndef GL_NV_light_max_exponent #define GL_NV_light_max_exponent 1 #endif #ifndef GL_NV_vertex_array_range #define GL_NV_vertex_array_range 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); #endif #ifndef GL_NV_register_combiners #define GL_NV_register_combiners 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *); GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat); GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *); GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint); GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean); GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); #endif #ifndef GL_NV_fog_distance #define GL_NV_fog_distance 1 #endif #ifndef GL_NV_texgen_emboss #define GL_NV_texgen_emboss 1 #endif #ifndef GL_NV_blend_square #define GL_NV_blend_square 1 #endif #ifndef GL_NV_texture_env_combine4 #define GL_NV_texture_env_combine4 1 #endif #ifndef GL_MESA_resize_buffers #define GL_MESA_resize_buffers 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glResizeBuffersMESA (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); #endif #ifndef GL_MESA_window_pos #define GL_MESA_window_pos 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *); GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *); GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint); GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *); GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort); GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *); GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *); GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *); GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint); GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *); GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort); GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *); GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *); GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *); GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint); GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *); GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); #endif #ifndef GL_IBM_cull_vertex #define GL_IBM_cull_vertex 1 #endif #ifndef GL_IBM_multimode_draw_arrays #define GL_IBM_multimode_draw_arrays 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint); GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); #endif #ifndef GL_IBM_vertex_array_lists #define GL_IBM_vertex_array_lists 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint); GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); #endif #ifndef GL_SGIX_subsample #define GL_SGIX_subsample 1 #endif #ifndef GL_SGIX_ycrcba #define GL_SGIX_ycrcba 1 #endif #ifndef GL_SGIX_ycrcb_subsample #define GL_SGIX_ycrcb_subsample 1 #endif #ifndef GL_SGIX_depth_pass_instrument #define GL_SGIX_depth_pass_instrument 1 #endif #ifndef GL_3DFX_texture_compression_FXT1 #define GL_3DFX_texture_compression_FXT1 1 #endif #ifndef GL_3DFX_multisample #define GL_3DFX_multisample 1 #endif #ifndef GL_3DFX_tbuffer #define GL_3DFX_tbuffer 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTbufferMask3DFX (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); #endif #ifndef GL_EXT_multisample #define GL_EXT_multisample 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean); GLAPI void APIENTRY glSamplePatternEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); #endif #ifndef GL_SGIX_vertex_preclip #define GL_SGIX_vertex_preclip 1 #endif #ifndef GL_SGIX_convolution_accuracy #define GL_SGIX_convolution_accuracy 1 #endif #ifndef GL_SGIX_resample #define GL_SGIX_resample 1 #endif #ifndef GL_SGIS_point_line_texgen #define GL_SGIS_point_line_texgen 1 #endif #ifndef GL_SGIS_texture_color_mask #define GL_SGIS_texture_color_mask 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); #endif #ifndef GL_SGIX_igloo_interface #define GL_SGIX_igloo_interface 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); #endif #ifndef GL_EXT_texture_env_dot3 #define GL_EXT_texture_env_dot3 1 #endif #ifndef GL_ATI_texture_mirror_once #define GL_ATI_texture_mirror_once 1 #endif #ifndef GL_NV_fence #define GL_NV_fence 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *); GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *); GLAPI GLboolean APIENTRY glIsFenceNV (GLuint); GLAPI GLboolean APIENTRY glTestFenceNV (GLuint); GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *); GLAPI void APIENTRY glFinishFenceNV (GLuint); GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); #endif #ifndef GL_NV_evaluators #define GL_NV_evaluators 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *); GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *); GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); #endif #ifndef GL_NV_packed_depth_stencil #define GL_NV_packed_depth_stencil 1 #endif #ifndef GL_NV_register_combiners2 #define GL_NV_register_combiners2 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *); GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); #endif #ifndef GL_NV_texture_compression_vtc #define GL_NV_texture_compression_vtc 1 #endif #ifndef GL_NV_texture_rectangle #define GL_NV_texture_rectangle 1 #endif #ifndef GL_NV_texture_shader #define GL_NV_texture_shader 1 #endif #ifndef GL_NV_texture_shader2 #define GL_NV_texture_shader2 1 #endif #ifndef GL_NV_vertex_array_range2 #define GL_NV_vertex_array_range2 1 #endif #ifndef GL_NV_vertex_program #define GL_NV_vertex_program 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *); GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint); GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *); GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *); GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *); GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *); GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *); GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *); GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *); GLAPI GLboolean APIENTRY glIsProgramNV (GLuint); GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *); GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *); GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *); GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *); GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *); GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *); GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum); GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble); GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat); GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort); GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *); GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *); GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *); GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *); GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *); GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *); GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *); GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *); GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *); GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *); GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); #endif #ifndef GL_SGIX_texture_coordinate_clamp #define GL_SGIX_texture_coordinate_clamp 1 #endif #ifndef GL_SGIX_scalebias_hint #define GL_SGIX_scalebias_hint 1 #endif #ifndef GL_OML_interlace #define GL_OML_interlace 1 #endif #ifndef GL_OML_subsample #define GL_OML_subsample 1 #endif #ifndef GL_OML_resample #define GL_OML_resample 1 #endif #ifndef GL_NV_copy_depth_to_color #define GL_NV_copy_depth_to_color 1 #endif #ifndef GL_ATI_envmap_bumpmap #define GL_ATI_envmap_bumpmap 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *); GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *); GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); #endif #ifndef GL_ATI_fragment_shader #define GL_ATI_fragment_shader 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint); GLAPI void APIENTRY glBindFragmentShaderATI (GLuint); GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint); GLAPI void APIENTRY glBeginFragmentShaderATI (void); GLAPI void APIENTRY glEndFragmentShaderATI (void); GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum); GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum); GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); #endif #ifndef GL_ATI_pn_triangles #define GL_ATI_pn_triangles 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint); GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); #endif #ifndef GL_ATI_vertex_array_object #define GL_ATI_vertex_array_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum); GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint); GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum); GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *); GLAPI void APIENTRY glFreeObjectBufferATI (GLuint); GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint); GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *); GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *); GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint); GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); #endif #ifndef GL_EXT_vertex_shader #define GL_EXT_vertex_shader 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBeginVertexShaderEXT (void); GLAPI void APIENTRY glEndVertexShaderEXT (void); GLAPI void APIENTRY glBindVertexShaderEXT (GLuint); GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint); GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint); GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint); GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint); GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint); GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint); GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint); GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *); GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *); GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *); GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *); GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *); GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *); GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *); GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *); GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *); GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *); GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *); GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint); GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint); GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum); GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum); GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum); GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum); GLAPI GLuint APIENTRY glBindParameterEXT (GLenum); GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum); GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *); GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *); GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *); GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *); GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); #endif #ifndef GL_ATI_vertex_streams #define GL_ATI_vertex_streams 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort); GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *); GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint); GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *); GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat); GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble); GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *); GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort); GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *); GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint); GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *); GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat); GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble); GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *); GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *); GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint); GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *); GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *); GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort); GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *); GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *); GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *); GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte); GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *); GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort); GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *); GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint); GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *); GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *); GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *); GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum); GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint); GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); #endif #ifndef GL_ATI_element_array #define GL_ATI_element_array 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *); GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei); GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); #endif #ifndef GL_SUN_mesh_array #define GL_SUN_mesh_array 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); #endif #ifndef GL_SUN_slice_accum #define GL_SUN_slice_accum 1 #endif #ifndef GL_NV_multisample_filter_hint #define GL_NV_multisample_filter_hint 1 #endif #ifndef GL_NV_depth_clamp #define GL_NV_depth_clamp 1 #endif #ifndef GL_NV_occlusion_query #define GL_NV_occlusion_query 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *); GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *); GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint); GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint); GLAPI void APIENTRY glEndOcclusionQueryNV (void); GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); #endif #ifndef GL_NV_point_sprite #define GL_NV_point_sprite 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint); GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); #endif #ifndef GL_NV_texture_shader3 #define GL_NV_texture_shader3 1 #endif #ifndef GL_NV_vertex_program1_1 #define GL_NV_vertex_program1_1 1 #endif #ifndef GL_EXT_shadow_funcs #define GL_EXT_shadow_funcs 1 #endif #ifndef GL_EXT_stencil_two_side #define GL_EXT_stencil_two_side 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); #endif #ifndef GL_ATI_text_fragment_shader #define GL_ATI_text_fragment_shader 1 #endif #ifndef GL_APPLE_client_storage #define GL_APPLE_client_storage 1 #endif #ifndef GL_APPLE_element_array #define GL_APPLE_element_array 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *); GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei); GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei); GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei); GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); #endif #ifndef GL_APPLE_fence #define GL_APPLE_fence 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *); GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *); GLAPI void APIENTRY glSetFenceAPPLE (GLuint); GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint); GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint); GLAPI void APIENTRY glFinishFenceAPPLE (GLuint); GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint); GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); #endif #ifndef GL_APPLE_vertex_array_object #define GL_APPLE_vertex_array_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint); GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *); GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, GLuint *); GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, GLuint *arrays); typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); #endif #ifndef GL_APPLE_vertex_array_range #define GL_APPLE_vertex_array_range 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *); GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *); GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); #endif #ifndef GL_APPLE_ycbcr_422 #define GL_APPLE_ycbcr_422 1 #endif #ifndef GL_S3_s3tc #define GL_S3_s3tc 1 #endif #ifndef GL_ATI_draw_buffers #define GL_ATI_draw_buffers 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); #endif #ifndef GL_ATI_pixel_format_float #define GL_ATI_pixel_format_float 1 /* This is really a WGL extension, but defines some associated GL enums. * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string. */ #endif #ifndef GL_ATI_texture_env_combine3 #define GL_ATI_texture_env_combine3 1 #endif #ifndef GL_ATI_texture_float #define GL_ATI_texture_float 1 #endif #ifndef GL_NV_float_buffer #define GL_NV_float_buffer 1 #endif #ifndef GL_NV_fragment_program #define GL_NV_fragment_program 1 /* Some NV_fragment_program entry points are shared with ARB_vertex_program. */ #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat); GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble); GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *); GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *); GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *); GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); #endif #ifndef GL_NV_half_float #define GL_NV_half_float 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *); GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *); GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *); GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *); GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *); GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *); GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV); GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *); GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV); GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *); GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *); GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *); GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV); GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *); GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *); GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *); GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *); GLAPI void APIENTRY glFogCoordhNV (GLhalfNV); GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *); GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *); GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV); GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *); GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV); GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *); GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *); GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *); GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *); GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *); GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *); GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *); GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); #endif #ifndef GL_NV_pixel_data_range #define GL_NV_pixel_data_range 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *); GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); #endif #ifndef GL_NV_primitive_restart #define GL_NV_primitive_restart 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glPrimitiveRestartNV (void); GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); #endif #ifndef GL_NV_texture_expand_normal #define GL_NV_texture_expand_normal 1 #endif #ifndef GL_NV_vertex_program2 #define GL_NV_vertex_program2 1 #endif #ifndef GL_ATI_map_object_buffer #define GL_ATI_map_object_buffer 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint); GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); #endif #ifndef GL_ATI_separate_stencil #define GL_ATI_separate_stencil 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum); GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); #endif #ifndef GL_ATI_vertex_attrib_array_object #define GL_ATI_vertex_attrib_array_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint); GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *); GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); #endif #ifndef GL_OES_read_format #define GL_OES_read_format 1 #endif #ifndef GL_EXT_depth_bounds_test #define GL_EXT_depth_bounds_test 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); #endif #ifndef GL_EXT_texture_mirror_clamp #define GL_EXT_texture_mirror_clamp 1 #endif #ifndef GL_EXT_blend_equation_separate #define GL_EXT_blend_equation_separate 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); #endif #ifndef GL_MESA_pack_invert #define GL_MESA_pack_invert 1 #endif #ifndef GL_MESA_ycbcr_texture #define GL_MESA_ycbcr_texture 1 #endif #ifndef GL_EXT_pixel_buffer_object #define GL_EXT_pixel_buffer_object 1 #endif #ifndef GL_NV_fragment_program_option #define GL_NV_fragment_program_option 1 #endif #ifndef GL_NV_fragment_program2 #define GL_NV_fragment_program2 1 #endif #ifndef GL_NV_vertex_program2_option #define GL_NV_vertex_program2_option 1 #endif #ifndef GL_NV_vertex_program3 #define GL_NV_vertex_program3 1 #endif #ifndef GL_EXT_framebuffer_object #define GL_EXT_framebuffer_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint); GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint); GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *); GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *); GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei); GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *); GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint); GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint); GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *); GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *); GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum); GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint); GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint); GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint); GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint); GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *); GLAPI void APIENTRY glGenerateMipmapEXT (GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); #endif #ifndef GL_GREMEDY_string_marker #define GL_GREMEDY_string_marker 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); #endif #ifndef GL_EXT_packed_depth_stencil #define GL_EXT_packed_depth_stencil 1 #endif #ifndef GL_EXT_stencil_clear_tag #define GL_EXT_stencil_clear_tag 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glStencilClearTagEXT (GLsizei, GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLSTENCILCLEARTAGEXTPROC) (GLsizei stencilTagBits, GLuint stencilClearTag); #endif #ifndef GL_EXT_texture_sRGB #define GL_EXT_texture_sRGB 1 #endif #ifndef GL_EXT_framebuffer_blit #define GL_EXT_framebuffer_blit 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlitFramebufferEXT (GLint, GLint, GLint, GLint, GLint, GLint, GLint, GLint, GLbitfield, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBLITFRAMEBUFFEREXTPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); #endif #ifndef GL_EXT_framebuffer_multisample #define GL_EXT_framebuffer_multisample 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glRenderbufferStorageMultisampleEXT (GLenum, GLsizei, GLenum, GLsizei, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); #endif #ifndef GL_MESAX_texture_stack #define GL_MESAX_texture_stack 1 #endif #ifndef GL_EXT_timer_query #define GL_EXT_timer_query 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetQueryObjecti64vEXT (GLuint, GLenum, GLint64EXT *); GLAPI void APIENTRY glGetQueryObjectui64vEXT (GLuint, GLenum, GLuint64EXT *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64EXT *params); typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64EXT *params); #endif #ifndef GL_EXT_gpu_program_parameters #define GL_EXT_gpu_program_parameters 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramEnvParameters4fvEXT (GLenum, GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum, GLuint, GLsizei, const GLfloat *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); #endif #ifndef GL_APPLE_flush_buffer_range #define GL_APPLE_flush_buffer_range 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBufferParameteriAPPLE (GLenum, GLenum, GLint); GLAPI void APIENTRY glFlushMappedBufferRangeAPPLE (GLenum, GLintptr, GLsizeiptr); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size); #endif #ifndef GL_NV_gpu_program4 #define GL_NV_gpu_program4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramLocalParameterI4iNV (GLenum, GLuint, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glProgramLocalParameterI4ivNV (GLenum, GLuint, const GLint *); GLAPI void APIENTRY glProgramLocalParametersI4ivNV (GLenum, GLuint, GLsizei, const GLint *); GLAPI void APIENTRY glProgramLocalParameterI4uiNV (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glProgramLocalParameterI4uivNV (GLenum, GLuint, const GLuint *); GLAPI void APIENTRY glProgramLocalParametersI4uivNV (GLenum, GLuint, GLsizei, const GLuint *); GLAPI void APIENTRY glProgramEnvParameterI4iNV (GLenum, GLuint, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glProgramEnvParameterI4ivNV (GLenum, GLuint, const GLint *); GLAPI void APIENTRY glProgramEnvParametersI4ivNV (GLenum, GLuint, GLsizei, const GLint *); GLAPI void APIENTRY glProgramEnvParameterI4uiNV (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glProgramEnvParameterI4uivNV (GLenum, GLuint, const GLuint *); GLAPI void APIENTRY glProgramEnvParametersI4uivNV (GLenum, GLuint, GLsizei, const GLuint *); GLAPI void APIENTRY glGetProgramLocalParameterIivNV (GLenum, GLuint, GLint *); GLAPI void APIENTRY glGetProgramLocalParameterIuivNV (GLenum, GLuint, GLuint *); GLAPI void APIENTRY glGetProgramEnvParameterIivNV (GLenum, GLuint, GLint *); GLAPI void APIENTRY glGetProgramEnvParameterIuivNV (GLenum, GLuint, GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); #endif #ifndef GL_NV_geometry_program4 #define GL_NV_geometry_program4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramVertexLimitNV (GLenum, GLint); GLAPI void APIENTRY glFramebufferTextureEXT (GLenum, GLenum, GLuint, GLint); GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum, GLenum, GLuint, GLint, GLint); GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum, GLenum, GLuint, GLint, GLenum); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); #endif #ifndef GL_EXT_geometry_shader4 #define GL_EXT_geometry_shader4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramParameteriEXT (GLuint, GLenum, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIEXTPROC) (GLuint program, GLenum pname, GLint value); #endif #ifndef GL_NV_vertex_program4 #define GL_NV_vertex_program4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint, GLint); GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint, GLint, GLint); GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint, GLint, GLint, GLint); GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint, GLint, GLint, GLint, GLint); GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint, GLuint); GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint, GLuint, GLuint); GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint, const GLint *); GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint, const GLuint *); GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint, const GLbyte *); GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint, const GLshort *); GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint, const GLubyte *); GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint, const GLushort *); GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint, GLint, GLenum, GLsizei, const GLvoid *); GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint, GLenum, GLint *); GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint, GLenum, GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); #endif #ifndef GL_EXT_gpu_shader4 #define GL_EXT_gpu_shader4 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGetUniformuivEXT (GLuint, GLint, GLuint *); GLAPI void APIENTRY glBindFragDataLocationEXT (GLuint, GLuint, const GLchar *); GLAPI GLint APIENTRY glGetFragDataLocationEXT (GLuint, const GLchar *); GLAPI void APIENTRY glUniform1uiEXT (GLint, GLuint); GLAPI void APIENTRY glUniform2uiEXT (GLint, GLuint, GLuint); GLAPI void APIENTRY glUniform3uiEXT (GLint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glUniform4uiEXT (GLint, GLuint, GLuint, GLuint, GLuint); GLAPI void APIENTRY glUniform1uivEXT (GLint, GLsizei, const GLuint *); GLAPI void APIENTRY glUniform2uivEXT (GLint, GLsizei, const GLuint *); GLAPI void APIENTRY glUniform3uivEXT (GLint, GLsizei, const GLuint *); GLAPI void APIENTRY glUniform4uivEXT (GLint, GLsizei, const GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLGETUNIFORMUIVEXTPROC) (GLuint program, GLint location, GLuint *params); typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONEXTPROC) (GLuint program, const GLchar *name); typedef void (APIENTRYP PFNGLUNIFORM1UIEXTPROC) (GLint location, GLuint v0); typedef void (APIENTRYP PFNGLUNIFORM2UIEXTPROC) (GLint location, GLuint v0, GLuint v1); typedef void (APIENTRYP PFNGLUNIFORM3UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); typedef void (APIENTRYP PFNGLUNIFORM4UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); typedef void (APIENTRYP PFNGLUNIFORM1UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); typedef void (APIENTRYP PFNGLUNIFORM2UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); typedef void (APIENTRYP PFNGLUNIFORM3UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); typedef void (APIENTRYP PFNGLUNIFORM4UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); #endif #ifndef GL_EXT_draw_instanced #define GL_EXT_draw_instanced 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum, GLint, GLsizei, GLsizei); GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum, GLsizei, GLenum, const GLvoid *, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); #endif #ifndef GL_EXT_packed_float #define GL_EXT_packed_float 1 #endif #ifndef GL_EXT_texture_array #define GL_EXT_texture_array 1 #endif #ifndef GL_EXT_texture_buffer_object #define GL_EXT_texture_buffer_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexBufferEXT (GLenum, GLenum, GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer); #endif #ifndef GL_EXT_texture_compression_latc #define GL_EXT_texture_compression_latc 1 #endif #ifndef GL_EXT_texture_compression_rgtc #define GL_EXT_texture_compression_rgtc 1 #endif #ifndef GL_EXT_texture_shared_exponent #define GL_EXT_texture_shared_exponent 1 #endif #ifndef GL_NV_depth_buffer_float #define GL_NV_depth_buffer_float 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDepthRangedNV (GLdouble, GLdouble); GLAPI void APIENTRY glClearDepthdNV (GLdouble); GLAPI void APIENTRY glDepthBoundsdNV (GLdouble, GLdouble); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFar); typedef void (APIENTRYP PFNGLCLEARDEPTHDNVPROC) (GLdouble depth); typedef void (APIENTRYP PFNGLDEPTHBOUNDSDNVPROC) (GLdouble zmin, GLdouble zmax); #endif #ifndef GL_NV_fragment_program4 #define GL_NV_fragment_program4 1 #endif #ifndef GL_NV_framebuffer_multisample_coverage #define GL_NV_framebuffer_multisample_coverage 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum, GLsizei, GLsizei, GLenum, GLsizei, GLsizei); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); #endif #ifndef GL_EXT_framebuffer_sRGB #define GL_EXT_framebuffer_sRGB 1 #endif #ifndef GL_NV_geometry_shader4 #define GL_NV_geometry_shader4 1 #endif #ifndef GL_NV_parameter_buffer_object #define GL_NV_parameter_buffer_object 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glProgramBufferParametersfvNV (GLenum, GLuint, GLuint, GLsizei, const GLfloat *); GLAPI void APIENTRY glProgramBufferParametersIivNV (GLenum, GLuint, GLuint, GLsizei, const GLint *); GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum, GLuint, GLuint, GLsizei, const GLuint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSFVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLfloat *params); typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLint *params); typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIUIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLuint *params); #endif #ifndef GL_EXT_draw_buffers2 #define GL_EXT_draw_buffers2 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint, GLboolean, GLboolean, GLboolean, GLboolean); GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum, GLuint, GLboolean *); GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum, GLuint, GLint *); GLAPI void APIENTRY glEnableIndexedEXT (GLenum, GLuint); GLAPI void APIENTRY glDisableIndexedEXT (GLenum, GLuint); GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum, GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); #endif #ifndef GL_NV_transform_feedback #define GL_NV_transform_feedback 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum); GLAPI void APIENTRY glEndTransformFeedbackNV (void); GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLuint, const GLint *, GLenum); GLAPI void APIENTRY glBindBufferRangeNV (GLenum, GLuint, GLuint, GLintptr, GLsizeiptr); GLAPI void APIENTRY glBindBufferOffsetNV (GLenum, GLuint, GLuint, GLintptr); GLAPI void APIENTRY glBindBufferBaseNV (GLenum, GLuint, GLuint); GLAPI void APIENTRY glTransformFeedbackVaryingsNV (GLuint, GLsizei, const GLint *, GLenum); GLAPI void APIENTRY glActiveVaryingNV (GLuint, const GLchar *); GLAPI GLint APIENTRY glGetVaryingLocationNV (GLuint, const GLchar *); GLAPI void APIENTRY glGetActiveVaryingNV (GLuint, GLuint, GLsizei, GLsizei *, GLsizei *, GLenum *, GLchar *); GLAPI void APIENTRY glGetTransformFeedbackVaryingNV (GLuint, GLuint, GLint *); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLuint count, const GLint *attribs, GLenum bufferMode); typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC) (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); typedef void (APIENTRYP PFNGLACTIVEVARYINGNVPROC) (GLuint program, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETVARYINGLOCATIONNVPROC) (GLuint program, const GLchar *name); typedef void (APIENTRYP PFNGLGETACTIVEVARYINGNVPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGNVPROC) (GLuint program, GLuint index, GLint *location); #endif #ifndef GL_EXT_bindable_uniform #define GL_EXT_bindable_uniform 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glUniformBufferEXT (GLuint, GLint, GLuint); GLAPI GLint APIENTRY glGetUniformBufferSizeEXT (GLuint, GLint); GLAPI GLintptr APIENTRY glGetUniformOffsetEXT (GLuint, GLint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLUNIFORMBUFFEREXTPROC) (GLuint program, GLint location, GLuint buffer); typedef GLint (APIENTRYP PFNGLGETUNIFORMBUFFERSIZEEXTPROC) (GLuint program, GLint location); typedef GLintptr (APIENTRYP PFNGLGETUNIFORMOFFSETEXTPROC) (GLuint program, GLint location); #endif #ifndef GL_EXT_texture_integer #define GL_EXT_texture_integer 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTexParameterIivEXT (GLenum, GLenum, const GLint *); GLAPI void APIENTRY glTexParameterIuivEXT (GLenum, GLenum, const GLuint *); GLAPI void APIENTRY glGetTexParameterIivEXT (GLenum, GLenum, GLint *); GLAPI void APIENTRY glGetTexParameterIuivEXT (GLenum, GLenum, GLuint *); GLAPI void APIENTRY glClearColorIiEXT (GLint, GLint, GLint, GLint); GLAPI void APIENTRY glClearColorIuiEXT (GLuint, GLuint, GLuint, GLuint); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params); typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params); typedef void (APIENTRYP PFNGLCLEARCOLORIIEXTPROC) (GLint red, GLint green, GLint blue, GLint alpha); typedef void (APIENTRYP PFNGLCLEARCOLORIUIEXTPROC) (GLuint red, GLuint green, GLuint blue, GLuint alpha); #endif #ifndef GL_GREMEDY_frame_terminator #define GL_GREMEDY_frame_terminator 1 #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); #endif /* GL_GLEXT_PROTOTYPES */ typedef void (APIENTRYP PFNGLFRAMETERMINATORGREMEDYPROC) (void); #endif #ifdef __cplusplus } #endif #endif /* GL_GLEXT_LEGACY */ #endif /* NO_SDL_GLEXT */ sdl12-compat-1.2.74/include/SDL/SDL_platform.h0000664000000000000000000001460715125533266015527 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef SDL_platform_h_ #define SDL_platform_h_ /* this was taken from SDL2's zlib-licensed headers. This drops BeOS (not Haiku) and MacOS Classic, but SDL2 doesn't run on them anyhow. Mac OS X target >= 10.6 requirement is dropped too. Send patches. :) */ #if defined(_AIX) #undef __AIX__ #define __AIX__ 1 #endif #if defined(__HAIKU__) #undef __HAIKU__ #define __HAIKU__ 1 #endif #if defined(bsdi) || defined(__bsdi) || defined(__bsdi__) #undef __BSDI__ #define __BSDI__ 1 #endif #if defined(_arch_dreamcast) #undef __DREAMCAST__ #define __DREAMCAST__ 1 #endif #if defined(__FreeBSD__) || defined(__FreeBSD_kernel__) || defined(__DragonFly__) #undef __FREEBSD__ #define __FREEBSD__ 1 #endif #if defined(hpux) || defined(__hpux) || defined(__hpux__) #undef __HPUX__ #define __HPUX__ 1 #endif #if defined(sgi) || defined(__sgi) || defined(__sgi__) || defined(_SGI_SOURCE) #undef __IRIX__ #define __IRIX__ 1 #endif #if (defined(linux) || defined(__linux) || defined(__linux__)) #undef __LINUX__ #define __LINUX__ 1 #endif #if defined(ANDROID) || defined(__ANDROID__) #undef __ANDROID__ #undef __LINUX__ /* do we need to do this? */ #define __ANDROID__ 1 #endif #if defined(__NGAGE__) #undef __NGAGE__ #define __NGAGE__ 1 #endif #if defined(__APPLE__) /* lets us know what version of Mac OS X we're compiling on */ #include #ifndef __has_extension /* Older compilers don't support this */ #define __has_extension(x) 0 #include #undef __has_extension #else #include #endif /* Fix building with older SDKs that don't define these See this for more information: https://stackoverflow.com/questions/12132933/preprocessor-macro-for-os-x-targets */ #ifndef TARGET_OS_MACCATALYST #define TARGET_OS_MACCATALYST 0 #endif #ifndef TARGET_OS_IOS #define TARGET_OS_IOS 0 #endif #ifndef TARGET_OS_IPHONE #define TARGET_OS_IPHONE 0 #endif #ifndef TARGET_OS_TV #define TARGET_OS_TV 0 #endif #ifndef TARGET_OS_SIMULATOR #define TARGET_OS_SIMULATOR 0 #endif #if TARGET_OS_TV #undef __TVOS__ #define __TVOS__ 1 #endif #if TARGET_OS_IPHONE /* if compiling for iOS */ #undef __IPHONEOS__ #define __IPHONEOS__ 1 #undef __MACOSX__ #else /* if not compiling for iOS */ #undef __MACOSX__ #define __MACOSX__ 1 #endif /* TARGET_OS_IPHONE */ #endif /* defined(__APPLE__) */ #if defined(__NetBSD__) #undef __NETBSD__ #define __NETBSD__ 1 #endif #if defined(__OpenBSD__) #undef __OPENBSD__ #define __OPENBSD__ 1 #endif #if defined(__OS2__) || defined(__EMX__) #undef __OS2__ #define __OS2__ 1 #endif #if defined(osf) || defined(__osf) || defined(__osf__) || defined(_OSF_SOURCE) #undef __OSF__ #define __OSF__ 1 #endif #if defined(__QNXNTO__) #undef __QNXNTO__ #define __QNXNTO__ 1 #endif #if defined(riscos) || defined(__riscos) || defined(__riscos__) #undef __RISCOS__ #define __RISCOS__ 1 #endif #if defined(__sun) && defined(__SVR4) #undef __SOLARIS__ #define __SOLARIS__ 1 #endif #if defined(WIN32) || defined(_WIN32) || defined(__CYGWIN__) || defined(__MINGW32__) /* Try to find out if we're compiling for WinRT, GDK or non-WinRT/GDK */ #if defined(_MSC_VER) && defined(__has_include) #if __has_include() #define HAVE_WINAPIFAMILY_H 1 #else #define HAVE_WINAPIFAMILY_H 0 #endif /* If _USING_V110_SDK71_ is defined it means we are using the Windows XP toolset. */ #elif defined(_MSC_VER) && (_MSC_VER >= 1700 && !_USING_V110_SDK71_) /* _MSC_VER == 1700 for Visual Studio 2012 */ #define HAVE_WINAPIFAMILY_H 1 #else #define HAVE_WINAPIFAMILY_H 0 #endif #if HAVE_WINAPIFAMILY_H #include #define WINAPI_FAMILY_WINRT (!WINAPI_FAMILY_PARTITION(WINAPI_PARTITION_DESKTOP) && WINAPI_FAMILY_PARTITION(WINAPI_PARTITION_APP)) #else #define WINAPI_FAMILY_WINRT 0 #endif /* HAVE_WINAPIFAMILY_H */ #if (HAVE_WINAPIFAMILY_H) && defined(WINAPI_FAMILY_PHONE_APP) #define SDL_WINAPI_FAMILY_PHONE (WINAPI_FAMILY == WINAPI_FAMILY_PHONE_APP) #else #define SDL_WINAPI_FAMILY_PHONE 0 #endif #if WINAPI_FAMILY_WINRT #undef __WINRT__ #define __WINRT__ 1 #elif defined(_GAMING_DESKTOP) /* GDK project configuration always defines _GAMING_XXX */ #undef __WINGDK__ #define __WINGDK__ 1 #elif defined(_GAMING_XBOX_XBOXONE) #undef __XBOXONE__ #define __XBOXONE__ 1 #elif defined(_GAMING_XBOX_SCARLETT) #undef __XBOXSERIES__ #define __XBOXSERIES__ 1 #else #undef __WINDOWS__ #define __WINDOWS__ 1 #endif #endif /* defined(WIN32) || defined(_WIN32) || defined(__CYGWIN__) */ #if defined(__WINDOWS__) #undef __WIN32__ #define __WIN32__ 1 #endif /* This is to support generic "any GDK" separate from a platform-specific GDK */ #if defined(__WINGDK__) || defined(__XBOXONE__) || defined(__XBOXSERIES__) #undef __GDK__ #define __GDK__ 1 #endif #if defined(__PSP__) || defined(__psp__) #ifdef __PSP__ #undef __PSP__ #endif #define __PSP__ 1 #endif #if defined(PS2) #define __PS2__ 1 #endif /* The NACL compiler defines __native_client__ and __pnacl__ * Ref: http://www.chromium.org/nativeclient/pnacl/stability-of-the-pnacl-bitcode-abi */ #if defined(__native_client__) #undef __LINUX__ #undef __NACL__ #define __NACL__ 1 #endif #if defined(__pnacl__) #undef __LINUX__ #undef __PNACL__ #define __PNACL__ 1 /* PNACL with newlib supports static linking only */ #define __SDL_NOGETPROCADDR__ #endif #if defined(__vita__) #define __VITA__ 1 #endif #if defined(__3DS__) #undef __3DS__ #define __3DS__ 1 #endif #endif sdl12-compat-1.2.74/include/SDL/SDL_quit.h0000664000000000000000000000245315125533266014661 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_quit_h #define _SDL_quit_h #include "SDL_stdinc.h" #include "SDL_error.h" #define SDL_QuitRequested() (SDL_PumpEvents(), SDL_PeepEvents(NULL,0,SDL_PEEKEVENT,SDL_QUITMASK)) #endif sdl12-compat-1.2.74/include/SDL/SDL_rwops.h0000664000000000000000000000735415125533266015056 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_rwops_h #define _SDL_rwops_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" typedef struct SDL_RWops { int (SDLCALL *seek)(struct SDL_RWops *context, int offset, int whence); int (SDLCALL *read)(struct SDL_RWops *context, void *ptr, int size, int maxnum); int (SDLCALL *write)(struct SDL_RWops *context, const void *ptr, int size, int num); int (SDLCALL *close)(struct SDL_RWops *context); Uint32 type; union { #if defined(__WIN32__) struct { int append; void *h; struct { void *data; int size; int left; } buffer; } win32io; #endif struct { int autoclose; FILE *fp; } stdio; struct { Uint8 *base; Uint8 *here; Uint8 *stop; } mem; struct { void *data1; } unknown; } hidden; } SDL_RWops; extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFP(FILE *fp, int autoclose); extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode); extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromMem(void *mem, int size); extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size); extern DECLSPEC SDL_RWops * SDLCALL SDL_AllocRW(void); extern DECLSPEC void SDLCALL SDL_FreeRW(SDL_RWops *area); extern DECLSPEC Uint16 SDLCALL SDL_ReadLE16(SDL_RWops *src); extern DECLSPEC Uint16 SDLCALL SDL_ReadBE16(SDL_RWops *src); extern DECLSPEC Uint32 SDLCALL SDL_ReadLE32(SDL_RWops *src); extern DECLSPEC Uint32 SDLCALL SDL_ReadBE32(SDL_RWops *src); extern DECLSPEC Uint64 SDLCALL SDL_ReadLE64(SDL_RWops *src); extern DECLSPEC Uint64 SDLCALL SDL_ReadBE64(SDL_RWops *src); extern DECLSPEC int SDLCALL SDL_WriteLE16(SDL_RWops *dst, Uint16 value); extern DECLSPEC int SDLCALL SDL_WriteBE16(SDL_RWops *dst, Uint16 value); extern DECLSPEC int SDLCALL SDL_WriteLE32(SDL_RWops *dst, Uint32 value); extern DECLSPEC int SDLCALL SDL_WriteBE32(SDL_RWops *dst, Uint32 value); extern DECLSPEC int SDLCALL SDL_WriteLE64(SDL_RWops *dst, Uint64 value); extern DECLSPEC int SDLCALL SDL_WriteBE64(SDL_RWops *dst, Uint64 value); #define RW_SEEK_SET 0 #define RW_SEEK_CUR 1 #define RW_SEEK_END 2 #define SDL_RWseek(ctx, offset, whence) (ctx)->seek(ctx, offset, whence) #define SDL_RWtell(ctx) (ctx)->seek(ctx, 0, RW_SEEK_CUR) #define SDL_RWread(ctx, ptr, size, n) (ctx)->read(ctx, ptr, size, n) #define SDL_RWwrite(ctx, ptr, size, n) (ctx)->write(ctx, ptr, size, n) #define SDL_RWclose(ctx) (ctx)->close(ctx) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_stdinc.h0000664000000000000000000002677715125533266015202 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_stdinc_h #define _SDL_stdinc_h #include "SDL_config.h" /* we are running under the assumption that if you have SDL2, you _probably_ have these standard headers. If not, send patches. */ #include #include #include #define SDL_arraysize(array) (sizeof(array)/sizeof(array[0])) #define SDL_TABLESIZE(table) SDL_arraysize(table) #ifdef __cplusplus #define SDL_reinterpret_cast(type, expression) reinterpret_cast(expression) #define SDL_static_cast(type, expression) static_cast(expression) #else #define SDL_reinterpret_cast(type, expression) ((type)(expression)) #define SDL_static_cast(type, expression) ((type)(expression)) #endif typedef enum SDL_bool { SDL_FALSE, SDL_TRUE } SDL_bool; typedef int8_t Sint8; typedef uint8_t Uint8; typedef int16_t Sint16; typedef uint16_t Uint16; typedef int32_t Sint32; typedef uint32_t Uint32; typedef uint64_t Uint64; typedef int64_t Sint64; #define SDL_COMPILE_TIME_ASSERT(name, x) typedef int SDL_dummy_ ## name[(x) * 2 - 1] SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1); SDL_COMPILE_TIME_ASSERT(sint8, sizeof(Sint8) == 1); SDL_COMPILE_TIME_ASSERT(uint16, sizeof(Uint16) == 2); SDL_COMPILE_TIME_ASSERT(sint16, sizeof(Sint16) == 2); SDL_COMPILE_TIME_ASSERT(uint32, sizeof(Uint32) == 4); SDL_COMPILE_TIME_ASSERT(sint32, sizeof(Sint32) == 4); SDL_COMPILE_TIME_ASSERT(uint64, sizeof(Uint64) == 8); SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8); typedef enum SDL_DUMMY_ENUM { DUMMY_ENUM_VALUE } SDL_DUMMY_ENUM; SDL_COMPILE_TIME_ASSERT(enum, sizeof(SDL_DUMMY_ENUM) == sizeof(int)); #ifdef HAVE_SYS_TYPES_H #include #endif #ifdef HAVE_STDIO_H #include #endif #if defined(HAVE_STDLIB_H) #include #elif defined(HAVE_MALLOC_H) #include #endif #ifdef HAVE_STDDEF_H #include #endif #ifdef HAVE_STDARG_H #include #endif #ifdef HAVE_STRING_H #include #endif #ifdef HAVE_STRINGS_H #include #endif #if defined(HAVE_INTTYPES_H) #include #elif defined(HAVE_STDINT_H) #include #endif #ifdef HAVE_CTYPE_H #include #endif #ifdef HAVE_ICONV_H #include #endif #ifdef HAVE_ALLOCA_H #include #endif #include "begin_code.h" /* sdl12-compat always supplies these functions, but the real SDL 1.2 might not, so we try to #define them to be the C runtime equivalents as possible, so things built with these headers will still run against the real SDL 1.2. */ #ifdef HAVE_ICONV #define SDL_iconv_t iconv_t #define SDL_iconv_open iconv_open #define SDL_iconv_close iconv_close #else typedef struct _SDL_iconv_t *SDL_iconv_t; extern DECLSPEC SDL_iconv_t SDLCALL SDL_iconv_open(const char *tocode, const char *fromcode); extern DECLSPEC int SDLCALL SDL_iconv_close(SDL_iconv_t cd); #endif extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t *inbytesleft, char **outbuf, size_t *outbytesleft); extern DECLSPEC char * SDLCALL SDL_iconv_string(const char *tocode, const char *fromcode, const char *inbuf, size_t inbytesleft); #ifdef HAVE_MALLOC #define SDL_malloc malloc #else extern DECLSPEC void * SDLCALL SDL_malloc(size_t size); #endif #ifdef HAVE_CALLOC #define SDL_calloc calloc #else extern DECLSPEC void * SDLCALL SDL_calloc(size_t nmemb, size_t size); #endif #ifdef HAVE_REALLOC #define SDL_realloc realloc #else extern DECLSPEC void * SDLCALL SDL_realloc(void *mem, size_t size); #endif #ifdef HAVE_FREE #define SDL_free free #else extern DECLSPEC void SDLCALL SDL_free(void *mem); #endif #ifdef HAVE_GETENV #define SDL_getenv getenv #else extern DECLSPEC char * SDLCALL SDL_getenv(const char *name); #endif #ifdef HAVE_PUTENV #define SDL_putenv putenv #else extern DECLSPEC int SDLCALL SDL_putenv(const char *variable); #endif #ifdef HAVE_QSORT #define SDL_qsort qsort #else extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size, int (*compare)(const void *, const void *)); #endif #ifdef HAVE_MEMSET #define SDL_memset memset #else extern DECLSPEC void * SDLCALL SDL_memset(void *dst, int c, size_t len); #endif #ifdef HAVE_MEMCPY #define SDL_memcpy memcpy #else extern DECLSPEC void * SDLCALL SDL_memcpy(void *dst, const void *src, size_t len); #endif #ifdef HAVE_REVCPY #define SDL_revcpy revcpy #else extern DECLSPEC void * SDLCALL SDL_revcpy(void *dst, const void *src, size_t len); #endif #ifdef HAVE_MEMCMP #define SDL_memcmp memcmp #else extern DECLSPEC int SDLCALL SDL_memcmp(const void *s1, const void *s2, size_t len); #endif #ifdef HAVE_STRLEN #define SDL_strlen strlen #else extern DECLSPEC size_t SDLCALL SDL_strlen(const char *string); #endif #ifdef HAVE_STRLCPY #define SDL_strlcpy strlcpy #else extern DECLSPEC size_t SDLCALL SDL_strlcpy(char *dst, const char *src, size_t maxlen); #endif #ifdef HAVE_STRLCAT #define SDL_strlcat strlcat #else extern DECLSPEC size_t SDLCALL SDL_strlcat(char *dst, const char *src, size_t maxlen); #endif #ifdef HAVE_STRDUP #define SDL_strdup strdup #else extern DECLSPEC char * SDLCALL SDL_strdup(const char *string); #endif #ifdef HAVE__STRREV #define SDL_strrev _strrev #else extern DECLSPEC char * SDLCALL SDL_strrev(char *string); #endif #ifdef HAVE__STRUPR #define SDL_strupr _strupr #else extern DECLSPEC char * SDLCALL SDL_strupr(char *string); #endif #ifdef HAVE__STRLWR #define SDL_strlwr _strlwr #else extern DECLSPEC char * SDLCALL SDL_strlwr(char *string); #endif #ifdef HAVE_STRCHR #define SDL_strchr strchr #else extern DECLSPEC char * SDLCALL SDL_strchr(const char *string, int c); #endif #ifdef HAVE_STRRCHR #define SDL_strrchr strrchr #else extern DECLSPEC char * SDLCALL SDL_strrchr(const char *string, int c); #endif #ifdef HAVE_STRSTR #define SDL_strstr strstr #else extern DECLSPEC char * SDLCALL SDL_strstr(const char *haystack, const char *needle); #endif #ifdef HAVE__LTOA #define SDL_ltoa _ltoa #else extern DECLSPEC char * SDLCALL SDL_ltoa(long value, char *string, int radix); #endif #ifdef HAVE__ULTOA #define SDL_ultoa _ultoa #else extern DECLSPEC char * SDLCALL SDL_ultoa(unsigned long value, char *string, int radix); #endif #ifdef HAVE_STRTOL #define SDL_strtol strtol #else extern DECLSPEC long SDLCALL SDL_strtol(const char *string, char **endp, int base); #endif #ifdef HAVE_STRTOUL #define SDL_strtoul strtoul #else extern DECLSPEC unsigned long SDLCALL SDL_strtoul(const char *string, char **endp, int base); #endif #ifdef HAVE__I64TOA #define SDL_lltoa _i64toa #else extern DECLSPEC char* SDLCALL SDL_lltoa(Sint64 value, char *string, int radix); #endif #ifdef HAVE__UI64TOA #define SDL_ulltoa _ui64toa #else extern DECLSPEC char* SDLCALL SDL_ulltoa(Uint64 value, char *string, int radix); #endif #ifdef HAVE__STRTOI64 #define SDL_strtoll _strtoi64 #elif defined(HAVE_STRTOLL) #define SDL_strtoll strtoll #else extern DECLSPEC Sint64 SDLCALL SDL_strtoll(const char *string, char **endp, int base); #endif #ifdef HAVE__STRTOUI64 #define SDL_strtoull _strtoui64 #elif defined(HAVE_STRTOULL) #define SDL_strtoull strtoull #else extern DECLSPEC Uint64 SDLCALL SDL_strtoull(const char *string, char **endp, int base); #endif #ifdef HAVE_STRTOD #define SDL_strtod strtod #else extern DECLSPEC double SDLCALL SDL_strtod(const char *string, char **endp); #endif #ifdef HAVE_STRCMP #define SDL_strcmp strcmp #else extern DECLSPEC int SDLCALL SDL_strcmp(const char *str1, const char *str2); #endif #ifdef HAVE_STRNCMP #define SDL_strncmp strncmp #else extern DECLSPEC int SDLCALL SDL_strncmp(const char *str1, const char *str2, size_t maxlen); #endif #ifdef HAVE_STRCASECMP #define SDL_strcasecmp strcasecmp #elif defined(HAVE__STRICMP) #define SDL_strcasecmp _stricmp #else extern DECLSPEC int SDLCALL SDL_strcasecmp(const char *str1, const char *str2); #endif #ifdef HAVE_STRNCASECMP #define SDL_strncasecmp strncasecmp #elif defined(HAVE__STRNICMP) #define SDL_strncasecmp _strnicmp #else extern DECLSPEC int SDLCALL SDL_strncasecmp(const char *str1, const char *str2, size_t maxlen); #endif #ifdef HAVE_SSCANF #define SDL_sscanf sscanf #else extern DECLSPEC int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...); #endif #ifdef HAVE_SNPRINT #define SDL_snprintf snprintf #else extern DECLSPEC int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...); #endif #ifdef HAVE_VSNPRINTF #define SDL_vsnprintf vsnprintf #else extern DECLSPEC int SDLCALL SDL_vsnprintf(char *text, size_t maxlen, const char *fmt, va_list ap); #endif /* taken from SDL2's zlib-licensed headers. */ #define SDL_memset4(dst, val, dwords) do { \ if (dwords > 0) { \ size_t _n = (dwords + 3) / 4; \ Uint32 *_p = SDL_static_cast(Uint32 *, dst); \ const Uint32 _val = (val); \ switch (dwords % 4) { \ case 0: do { *_p++ = _val; /* fallthrough */ \ case 3: *_p++ = _val; /* fallthrough */ \ case 2: *_p++ = _val; /* fallthrough */ \ case 1: *_p++ = _val; /* fallthrough */ \ } while ( --_n ); \ } \ } \ } while (0) #ifdef HAVE_ALLOCA #define SDL_stack_alloc(type, count) (type*)alloca(sizeof(type)*(count)) #define SDL_stack_free(data) #else #define SDL_stack_alloc(type, count) (type*)SDL_malloc(sizeof(type)*(count)) #define SDL_stack_free(data) SDL_free(data) #endif /* we're currently assuming you actually have these parts of the C runtime. Send patches if not. */ #define SDL_abs abs #define SDL_min(x, y) (((x) < (y)) ? (x) : (y)) #define SDL_max(x, y) (((x) > (y)) ? (x) : (y)) #define SDL_isdigit(X) isdigit(X) #define SDL_isspace(X) isspace(X) #define SDL_toupper(X) toupper(X) #define SDL_tolower(X) tolower(X) #define SDL_memcpy4(dst, src, len) SDL_memcpy(dst, src, (len) << 2) #ifdef HAVE_MEMMOVE #define SDL_memmove memmove #else #define SDL_memmove(dst, src, len) do { if ( dst < src ) { SDL_memcpy(dst, src, len); } else { SDL_revcpy(dst, src, len); } } while(0) #endif #define SDL_itoa(value, string, radix) SDL_ltoa((long)value, string, radix) #define SDL_uitoa(value, string, radix) SDL_ultoa((long)value, string, radix) #define SDL_atoi(X) SDL_strtol(X, NULL, 10) #define SDL_atof(X) SDL_strtod(X, NULL) #define SDL_ICONV_ERROR (size_t)-1 #define SDL_ICONV_E2BIG (size_t)-2 #define SDL_ICONV_EILSEQ (size_t)-3 #define SDL_ICONV_EINVAL (size_t)-4 #define SDL_iconv_utf8_locale(S) SDL_iconv_string("", "UTF-8", S, SDL_strlen(S)+1) #define SDL_iconv_utf8_ucs2(S) (Uint16 *)SDL_iconv_string("UCS-2", "UTF-8", S, SDL_strlen(S)+1) #define SDL_iconv_utf8_ucs4(S) (Uint32 *)SDL_iconv_string("UCS-4", "UTF-8", S, SDL_strlen(S)+1) #include "close_code.h" #endif /* _SDL_stdinc_h */ sdl12-compat-1.2.74/include/SDL/SDL_syswm.h0000664000000000000000000000640215125533266015057 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_syswm_h #define _SDL_syswm_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_version.h" #ifndef SDL_PROTOTYPES_ONLY # if defined(__WIN32__) # ifndef WIN32_LEAN_AND_MEAN # define WIN32_LEAN_AND_MEAN # endif # include # include "begin_code.h" struct SDL_SysWMmsg { SDL_version version; HWND hwnd; UINT msg; WPARAM wParam; LPARAM lParam; }; typedef struct SDL_SysWMinfo { SDL_version version; HWND window; HGLRC hglrc; } SDL_SysWMinfo; # include "close_code.h" # elif defined(SDL_VIDEO_DRIVER_X11) # include # include # include "begin_code.h" typedef enum SDL_SYSWM_TYPE { SDL_SYSWM_X11 } SDL_SYSWM_TYPE; struct SDL_SysWMmsg { SDL_version version; SDL_SYSWM_TYPE subsystem; union { XEvent xevent; } event; }; typedef struct SDL_SysWMinfo { SDL_version version; SDL_SYSWM_TYPE subsystem; union { struct { Display *display; Window window; void (*lock_func)(void); void (*unlock_func)(void); Window fswindow; Window wmwindow; Display *gfxdisplay; } x11; } info; } SDL_SysWMinfo; # include "close_code.h" # else # include "begin_code.h" struct SDL_SysWMmsg { SDL_version version; int data; }; typedef struct SDL_SysWMinfo { SDL_version version; int data; } SDL_SysWMinfo; # include "close_code.h" # endif #endif #include "begin_code.h" extern DECLSPEC int SDLCALL SDL_GetWMInfo(SDL_SysWMinfo *info); typedef struct SDL_Window SDL_Window; extern DECLSPEC SDL_Window * SDLCALL SDL12COMPAT_GetWindow(void); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_thread.h0000664000000000000000000000501515125533266015143 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_thread_h #define _SDL_thread_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_mutex.h" #ifdef __OS2__ /* for _beginthread() and _endthread(). */ #include #ifdef __EMX__ #include #endif #endif #include "begin_code.h" typedef struct SDL_Thread SDL_Thread; /* No _beginthread()/_endthread() magic for windows -- only for os2: * Official Windows versions of SDL-1.2 >= 1.2.10 were always built * with HAVE_LIBC, i.e.: *without* SDL_PASSED_BEGINTHREAD_ENDTHREAD * defined, in order to keep binary compatibility with SDL <= 1.2.9. */ #ifdef __OS2__ typedef int (*pfnSDL_CurrentBeginThread)(void (*func)(void *), void *, unsigned, void *arg); typedef void (*pfnSDL_CurrentEndThread)(void); extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread); #define SDL_PASSED_BEGINTHREAD_ENDTHREAD #define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthread, _endthread) #else extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data); #endif extern DECLSPEC Uint32 SDLCALL SDL_ThreadID(void); extern DECLSPEC Uint32 SDLCALL SDL_GetThreadID(SDL_Thread *thread); extern DECLSPEC void SDLCALL SDL_WaitThread(SDL_Thread *thread, int *status); extern DECLSPEC void SDLCALL SDL_KillThread(SDL_Thread *thread); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_timer.h0000664000000000000000000000353015125533266015014 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_timer_h #define _SDL_timer_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "begin_code.h" typedef struct _SDL_TimerID *SDL_TimerID; typedef Uint32 (SDLCALL *SDL_TimerCallback)(Uint32 interval); typedef Uint32 (SDLCALL *SDL_NewTimerCallback)(Uint32 interval, void *param); extern DECLSPEC Uint32 SDLCALL SDL_GetTicks(void); extern DECLSPEC void SDLCALL SDL_Delay(Uint32 ms); extern DECLSPEC int SDLCALL SDL_SetTimer(Uint32 interval, SDL_TimerCallback callback); extern DECLSPEC SDL_TimerID SDLCALL SDL_AddTimer(Uint32 interval, SDL_NewTimerCallback callback, void *param); extern DECLSPEC SDL_bool SDLCALL SDL_RemoveTimer(SDL_TimerID t); #define SDL_TIMESLICE 10 #define TIMER_RESOLUTION 10 #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_types.h0000664000000000000000000000232715125533266015043 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* this is a compatibility header, even in 1.2, that just forwards to SDL_stdinc.h */ #include "SDL_stdinc.h" sdl12-compat-1.2.74/include/SDL/SDL_version.h0000664000000000000000000000363015140471502015351 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_version_h #define _SDL_version_h #include "SDL_stdinc.h" #include "begin_code.h" /* We bumped the patchlevel to 50 for sdl12-compat */ #define SDL_MAJOR_VERSION 1 #define SDL_MINOR_VERSION 2 #define SDL_PATCHLEVEL 74 typedef struct SDL_version { Uint8 major; Uint8 minor; Uint8 patch; } SDL_version; #define SDL_VERSION(X) { \ (X)->major = SDL_MAJOR_VERSION; \ (X)->minor = SDL_MINOR_VERSION; \ (X)->patch = SDL_PATCHLEVEL; \ } #define SDL_VERSIONNUM(X, Y, Z) ((X)*1000 + (Y)*100 + (Z)) #define SDL_COMPILEDVERSION SDL_VERSIONNUM(SDL_MAJOR_VERSION, SDL_MINOR_VERSION, SDL_PATCHLEVEL) #define SDL_VERSION_ATLEAST(X, Y, Z) (SDL_COMPILEDVERSION >= SDL_VERSIONNUM(X, Y, Z)) extern DECLSPEC const SDL_version * SDLCALL SDL_Linked_Version(void); #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/SDL_video.h0000664000000000000000000002410515125533266015003 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _SDL_video_h #define _SDL_video_h #include "SDL_stdinc.h" #include "SDL_error.h" #include "SDL_rwops.h" #include "begin_code.h" #define SDL_ALPHA_OPAQUE 255 #define SDL_ALPHA_TRANSPARENT 0 typedef struct SDL_Rect { Sint16 x; Sint16 y; Uint16 w; Uint16 h; } SDL_Rect; typedef struct SDL_Color { Uint8 r; Uint8 g; Uint8 b; Uint8 unused; } SDL_Color; #define SDL_Colour SDL_Color typedef struct SDL_Palette { int ncolors; SDL_Color *colors; } SDL_Palette; typedef struct SDL_PixelFormat { SDL_Palette *palette; Uint8 BitsPerPixel; Uint8 BytesPerPixel; Uint8 Rloss; Uint8 Gloss; Uint8 Bloss; Uint8 Aloss; Uint8 Rshift; Uint8 Gshift; Uint8 Bshift; Uint8 Ashift; Uint32 Rmask; Uint32 Gmask; Uint32 Bmask; Uint32 Amask; Uint32 colorkey; Uint8 alpha; } SDL_PixelFormat; typedef struct SDL_Surface { Uint32 flags; SDL_PixelFormat *format; int w; int h; Uint16 pitch; void *pixels; int offset; struct private_hwdata *hwdata; SDL_Rect clip_rect; Uint32 unused1; Uint32 locked; void *map; unsigned int format_version; int refcount; } SDL_Surface; typedef int (*SDL_blit)(struct SDL_Surface *src, SDL_Rect *srcrect, struct SDL_Surface *dst, SDL_Rect *dstrect); typedef struct SDL_VideoInfo { Uint32 hw_available:1; Uint32 wm_available:1; Uint32 UnusedBits1:6; Uint32 UnusedBits2:1; Uint32 blit_hw:1; Uint32 blit_hw_CC:1; Uint32 blit_hw_A:1; Uint32 blit_sw:1; Uint32 blit_sw_CC:1; Uint32 blit_sw_A:1; Uint32 blit_fill:1; Uint32 UnusedBits3:16; Uint32 video_mem; SDL_PixelFormat *vfmt; int current_w; int current_h; } SDL_VideoInfo; typedef struct SDL_Overlay { Uint32 format; int w; int h; int planes; Uint16 *pitches; Uint8 **pixels; void *hwfuncs; void *hwdata; Uint32 hw_overlay:1; Uint32 UnusedBits:31; } SDL_Overlay; typedef enum SDL_GLattr { SDL_GL_RED_SIZE, SDL_GL_GREEN_SIZE, SDL_GL_BLUE_SIZE, SDL_GL_ALPHA_SIZE, SDL_GL_BUFFER_SIZE, SDL_GL_DOUBLEBUFFER, SDL_GL_DEPTH_SIZE, SDL_GL_STENCIL_SIZE, SDL_GL_ACCUM_RED_SIZE, SDL_GL_ACCUM_GREEN_SIZE, SDL_GL_ACCUM_BLUE_SIZE, SDL_GL_ACCUM_ALPHA_SIZE, SDL_GL_STEREO, SDL_GL_MULTISAMPLEBUFFERS, SDL_GL_MULTISAMPLESAMPLES, SDL_GL_ACCELERATED_VISUAL, SDL_GL_SWAP_CONTROL } SDL_GLattr; typedef enum SDL_GrabMode { SDL_GRAB_QUERY = -1, SDL_GRAB_OFF = 0, SDL_GRAB_ON = 1, SDL_GRAB_FULLSCREEN } SDL_GrabMode; extern DECLSPEC int SDLCALL SDL_VideoInit(const char *driver_name, Uint32 flags); extern DECLSPEC void SDLCALL SDL_VideoQuit(void); extern DECLSPEC char * SDLCALL SDL_VideoDriverName(char *namebuf, int maxlen); extern DECLSPEC SDL_Surface * SDLCALL SDL_GetVideoSurface(void); extern DECLSPEC const SDL_VideoInfo * SDLCALL SDL_GetVideoInfo(void); extern DECLSPEC int SDLCALL SDL_VideoModeOK(int width, int height, int bpp, Uint32 flags); extern DECLSPEC SDL_Rect ** SDLCALL SDL_ListModes(SDL_PixelFormat *format, Uint32 flags); extern DECLSPEC SDL_Surface * SDLCALL SDL_SetVideoMode(int width, int height, int bpp, Uint32 flags); extern DECLSPEC void SDLCALL SDL_UpdateRects(SDL_Surface *screen, int numrects, SDL_Rect *rects); extern DECLSPEC void SDLCALL SDL_UpdateRect(SDL_Surface *screen, Sint32 x, Sint32 y, Uint32 w, Uint32 h); extern DECLSPEC int SDLCALL SDL_Flip(SDL_Surface *screen); extern DECLSPEC int SDLCALL SDL_SetGamma(float red, float green, float blue); extern DECLSPEC int SDLCALL SDL_SetGammaRamp(const Uint16 *red, const Uint16 *green, const Uint16 *blue); extern DECLSPEC int SDLCALL SDL_GetGammaRamp(Uint16 *red, Uint16 *green, Uint16 *blue); extern DECLSPEC int SDLCALL SDL_SetColors(SDL_Surface *surface, SDL_Color *colors, int firstcolor, int ncolors); extern DECLSPEC int SDLCALL SDL_SetPalette(SDL_Surface *surface, int flags, SDL_Color *colors, int firstcolor, int ncolors); extern DECLSPEC Uint32 SDLCALL SDL_MapRGB(const SDL_PixelFormat * const format, const Uint8 r, const Uint8 g, const Uint8 b); extern DECLSPEC Uint32 SDLCALL SDL_MapRGBA(const SDL_PixelFormat * const format, const Uint8 r, const Uint8 g, const Uint8 b, const Uint8 a); extern DECLSPEC void SDLCALL SDL_GetRGB(Uint32 pixel, const SDL_PixelFormat * const fmt, Uint8 *r, Uint8 *g, Uint8 *b); extern DECLSPEC void SDLCALL SDL_GetRGBA(Uint32 pixel, const SDL_PixelFormat * const fmt, Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a); extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurface(Uint32 flags, int width, int height, int depth, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurfaceFrom(void *pixels, int width, int height, int depth, int pitch, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); extern DECLSPEC void SDLCALL SDL_FreeSurface(SDL_Surface *surface); extern DECLSPEC int SDLCALL SDL_LockSurface(SDL_Surface *surface); extern DECLSPEC void SDLCALL SDL_UnlockSurface(SDL_Surface *surface); extern DECLSPEC SDL_Surface * SDLCALL SDL_LoadBMP_RW(SDL_RWops *src, int freesrc); extern DECLSPEC int SDLCALL SDL_SaveBMP_RW(SDL_Surface *surface, SDL_RWops *dst, int freedst); extern DECLSPEC int SDLCALL SDL_SetColorKey(SDL_Surface *surface, Uint32 flag, Uint32 key); extern DECLSPEC int SDLCALL SDL_SetAlpha(SDL_Surface *surface, Uint32 flag, Uint8 alpha); extern DECLSPEC SDL_bool SDLCALL SDL_SetClipRect(SDL_Surface *surface, const SDL_Rect *rect); extern DECLSPEC void SDLCALL SDL_GetClipRect(SDL_Surface *surface, SDL_Rect *rect); extern DECLSPEC SDL_Surface * SDLCALL SDL_ConvertSurface(SDL_Surface *src, SDL_PixelFormat *fmt, Uint32 flags); extern DECLSPEC int SDLCALL SDL_UpperBlit(SDL_Surface *src, SDL_Rect *srcrect, SDL_Surface *dst, SDL_Rect *dstrect); extern DECLSPEC int SDLCALL SDL_LowerBlit(SDL_Surface *src, SDL_Rect *srcrect, SDL_Surface *dst, SDL_Rect *dstrect); extern DECLSPEC int SDLCALL SDL_FillRect(SDL_Surface *dst, SDL_Rect *dstrect, Uint32 color); extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormat(SDL_Surface *surface); extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormatAlpha(SDL_Surface *surface); extern DECLSPEC SDL_Overlay * SDLCALL SDL_CreateYUVOverlay(int width, int height, Uint32 format, SDL_Surface *display); extern DECLSPEC int SDLCALL SDL_LockYUVOverlay(SDL_Overlay *overlay); extern DECLSPEC void SDLCALL SDL_UnlockYUVOverlay(SDL_Overlay *overlay); extern DECLSPEC int SDLCALL SDL_DisplayYUVOverlay(SDL_Overlay *overlay, SDL_Rect *dstrect); extern DECLSPEC void SDLCALL SDL_FreeYUVOverlay(SDL_Overlay *overlay); extern DECLSPEC int SDLCALL SDL_GL_LoadLibrary(const char *path); extern DECLSPEC void * SDLCALL SDL_GL_GetProcAddress(const char* proc); extern DECLSPEC int SDLCALL SDL_GL_SetAttribute(SDL_GLattr attr, int value); extern DECLSPEC int SDLCALL SDL_GL_GetAttribute(SDL_GLattr attr, int* value); extern DECLSPEC void SDLCALL SDL_GL_SwapBuffers(void); extern DECLSPEC void SDLCALL SDL_GL_UpdateRects(int numrects, SDL_Rect* rects); extern DECLSPEC void SDLCALL SDL_GL_Lock(void); extern DECLSPEC void SDLCALL SDL_GL_Unlock(void); extern DECLSPEC void SDLCALL SDL_WM_SetCaption(const char *title, const char *icon); extern DECLSPEC void SDLCALL SDL_WM_GetCaption(char **title, char **icon); extern DECLSPEC void SDLCALL SDL_WM_SetIcon(SDL_Surface *icon, Uint8 *mask); extern DECLSPEC int SDLCALL SDL_WM_IconifyWindow(void); extern DECLSPEC int SDLCALL SDL_WM_ToggleFullScreen(SDL_Surface *surface); extern DECLSPEC SDL_GrabMode SDLCALL SDL_WM_GrabInput(SDL_GrabMode mode); extern DECLSPEC int SDLCALL SDL_SoftStretch(SDL_Surface *src, SDL_Rect *srcrect, SDL_Surface *dst, SDL_Rect *dstrect); /* this was never in an real SDL-1.2 release, but apparently StepMania was maintaining a fork with this API for literally years. */ #define SDL_REFRESH_DEFAULT 0 extern DECLSPEC void SDLCALL SDL_SetRefreshRate(int rate); #define SDL_SWSURFACE 0x00000000 #define SDL_HWSURFACE 0x00000001 #define SDL_ASYNCBLIT 0x00000004 #define SDL_ANYFORMAT 0x10000000 #define SDL_HWPALETTE 0x20000000 #define SDL_DOUBLEBUF 0x40000000 #define SDL_TRIPLEBUF 0x40000100 #define SDL_FULLSCREEN 0x80000000 #define SDL_OPENGL 0x00000002 #define SDL_OPENGLBLIT 0x0000000A #define SDL_RESIZABLE 0x00000010 #define SDL_NOFRAME 0x00000020 #define SDL_HWACCEL 0x00000100 #define SDL_SRCCOLORKEY 0x00001000 #define SDL_RLEACCELOK 0x00002000 #define SDL_RLEACCEL 0x00004000 #define SDL_SRCALPHA 0x00010000 #define SDL_PREALLOC 0x01000000 #define SDL_MUSTLOCK(surface) (surface->offset || ((surface->flags & (SDL_HWSURFACE|SDL_ASYNCBLIT|SDL_RLEACCEL)) != 0)) #define SDL_YV12_OVERLAY 0x32315659 #define SDL_IYUV_OVERLAY 0x56555949 #define SDL_YUY2_OVERLAY 0x32595559 #define SDL_UYVY_OVERLAY 0x59565955 #define SDL_YVYU_OVERLAY 0x55595659 #define SDL_LOGPAL 0x01 #define SDL_PHYSPAL 0x02 #define SDL_AllocSurface SDL_CreateRGBSurface #define SDL_BlitSurface SDL_UpperBlit #define SDL_LoadBMP(file) SDL_LoadBMP_RW(SDL_RWFromFile(file, "rb"), 1) #define SDL_SaveBMP(surface, file) SDL_SaveBMP_RW(surface, SDL_RWFromFile(file, "wb"), 1) #include "close_code.h" #endif sdl12-compat-1.2.74/include/SDL/begin_code.h0000664000000000000000000000774715125533266015266 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ #ifndef _begin_code_h #define _begin_code_h #ifdef __BUILDING_SDL12_COMPAT__ #error You should not use these headers to build sdl12-compat. Use the real SDL2 headers instead. #endif #ifdef __cplusplus extern "C" { #endif /* In case we need to distinguish. */ #ifndef SDL12_COMPAT_HEADERS #define SDL12_COMPAT_HEADERS 1 #endif /* set up DECLSPEC, SDLCALL, struct packing, __inline__ and NULL... taken from SDL2 zlib-licensed headers or rewritten. */ #ifndef DECLSPEC # if defined(__WIN32__) || defined(__WINRT__) || defined(__CYGWIN__) # ifdef DLL_EXPORT # define DECLSPEC __declspec(dllexport) # else # define DECLSPEC # endif # elif defined(__OS2__) # ifdef BUILD_SDL # define DECLSPEC __declspec(dllexport) # else # define DECLSPEC # endif # else # if defined(__GNUC__) && __GNUC__ >= 4 # define DECLSPEC __attribute__ ((visibility("default"))) # else # define DECLSPEC # endif # endif #endif /* By default SDL uses the C calling convention */ #ifndef SDLCALL #if (defined(__WIN32__) || defined(__WINRT__)) && !defined(__GNUC__) #define SDLCALL __cdecl #elif defined(__OS2__) || defined(__EMX__) #define SDLCALL _System # if defined (__GNUC__) && !defined(_System) # define _System /* for old EMX/GCC compat. */ # endif #else #define SDLCALL #endif #endif /* SDLCALL */ /* Removed DECLSPEC on Symbian OS because SDL cannot be a DLL in EPOC */ #ifdef __SYMBIAN32__ #undef DECLSPEC #define DECLSPEC #endif /* __SYMBIAN32__ */ /* Force structure packing at 4 byte alignment. This is necessary if the header is included in code which has structure packing set to an alternate value, say for loading structures from disk. The packing is reset to the previous value in close_code.h */ #if defined(_MSC_VER) || defined(__MWERKS__) || defined(__BORLANDC__) #ifdef _MSC_VER #pragma warning(disable: 4103) #endif #ifdef __clang__ #pragma clang diagnostic ignored "-Wpragma-pack" #endif #ifdef __BORLANDC__ #pragma nopackwarning #endif #ifdef _M_X64 /* Use 8-byte alignment on 64-bit architectures, so pointers are aligned */ #pragma pack(push,8) #else #pragma pack(push,4) #endif #endif /* Compiler needs structure packing set */ /* modified from SDL2's SDL_INLINE defines */ #ifndef __inline__ #if defined(__GNUC__) || defined(__clang__) #define __inline__ __inline__ #elif defined(_MSC_VER) || defined(__BORLANDC__) || \ defined(__DMC__) || defined(__SC__) || \ defined(__WATCOMC__) || defined(__LCC__) || \ defined(__DECC) || defined(__CC_ARM) #define __inline__ __inline #else #define __inline__ inline #endif #define SDL_INLINE_OKAY #endif /* SDL_INLINE not defined */ #ifndef __APPLE__ /* precompiled headers get upset here, or did 20 years ago... */ #ifndef NULL #ifdef __cplusplus #define NULL 0 #else #define NULL ((void *) 0) #endif #endif #endif #else #error begin_code.h included twice without an end_code.h #endif sdl12-compat-1.2.74/include/SDL/close_code.h0000664000000000000000000000304315125533266015270 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* These headers are from sdl12-compat, and are intended to give just enough functionality to let you build an SDL-1.2-based project without having the real SDL-1.2 available to you. */ /* This file is mostly verbatim close_code.h from SDL2. */ #ifndef _begin_code_h #error close_code.h included without matching begin_code.h #endif #undef _begin_code_h /* Reset structure packing at previous byte alignment */ #if defined(_MSC_VER) || defined(__MWERKS__) || defined(__BORLANDC__) #ifdef __BORLANDC__ #pragma nopackwarning #endif #pragma pack(pop) #endif /* Compiler needs structure packing set */ #ifdef __cplusplus } #endif sdl12-compat-1.2.74/sdl-config.in0000775000000000000000000000346714210037446013336 0ustar00#!/bin/sh # This is a replacement for SDL 1.2's sdl-config script. You only need this # if you are trying to build something uses SDL 1.2. If you have something # already built that you want to drop sdl12-compat into, just replace # the copy of SDL 1.2 with a build of sdl12-compat in the appropriate way. # Copied and modified from SDL2's sdl2-compat. prefix=@CMAKE_INSTALL_PREFIX@ exec_prefix=${prefix} exec_prefix_set=no libdir=@CMAKE_INSTALL_FULL_LIBDIR@ includedir=@CMAKE_INSTALL_FULL_INCLUDEDIR@ @ENABLE_STATIC_FALSE@usage="\ @ENABLE_STATIC_FALSE@Usage: $0 [--prefix[=DIR]] [--exec-prefix[=DIR]] [--version] [--cflags] [--libs]" @ENABLE_STATIC_TRUE@usage="\ @ENABLE_STATIC_TRUE@Usage: $0 [--prefix[=DIR]] [--exec-prefix[=DIR]] [--version] [--cflags] [--libs] [--static-libs]" if test $# -eq 0; then echo "${usage}" 1>&2 exit 1 fi while test $# -gt 0; do case "$1" in -*=*) optarg=`echo "$1" | sed 's/[-_a-zA-Z0-9]*=//'` ;; *) optarg= ;; esac case $1 in --prefix=*) prefix=$optarg if test $exec_prefix_set = no ; then exec_prefix=$optarg fi ;; --prefix) echo $prefix ;; --exec-prefix=*) exec_prefix=$optarg exec_prefix_set=yes ;; --exec-prefix) echo $exec_prefix ;; --version) echo @PROJECT_VERSION@ ;; --cflags) echo -I${includedir}/SDL @SDL_CFLAGS@ ;; @ENABLE_SHARED_TRUE@ --libs) @ENABLE_SHARED_TRUE@ echo -L${libdir} @SDL_RLD_FLAGS@ @SDL_LIBS@ @ENABLE_SHARED_TRUE@ ;; @ENABLE_STATIC_TRUE@@ENABLE_SHARED_TRUE@ --static-libs) @ENABLE_STATIC_TRUE@@ENABLE_SHARED_FALSE@ --libs|--static-libs) @ENABLE_STATIC_TRUE@ echo -L${libdir} @SDL_LIBS@ @SDL_STATIC_LIBS@ @ENABLE_STATIC_TRUE@ ;; *) echo "${usage}" 1>&2 exit 1 ;; esac shift done sdl12-compat-1.2.74/sdl.m40000664000000000000000000001465414544563677012026 0ustar00# Configure paths for SDL # Sam Lantinga 9/21/99 # stolen from Manish Singh # stolen back from Frank Belew # stolen from Manish Singh # Shamelessly stolen from Owen Taylor # serial 3 dnl AM_PATH_SDL([MINIMUM-VERSION, [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND]]]) dnl Test for SDL, and define SDL_CFLAGS and SDL_LIBS dnl AC_DEFUN([AM_PATH_SDL], [dnl dnl Get the cflags and libraries from the sdl-config script dnl AC_ARG_WITH(sdl-prefix,[ --with-sdl-prefix=PFX Prefix where SDL is installed (optional)], sdl_prefix="$withval", sdl_prefix="") AC_ARG_WITH(sdl-exec-prefix,[ --with-sdl-exec-prefix=PFX Exec prefix where SDL is installed (optional)], sdl_exec_prefix="$withval", sdl_exec_prefix="") AC_ARG_ENABLE(sdltest, [ --disable-sdltest Do not try to compile and run a test SDL program], , enable_sdltest=yes) min_sdl_version=ifelse([$1], ,1.2.0,$1) if test "x$sdl_prefix$sdl_exec_prefix" = x ; then PKG_CHECK_MODULES([SDL], [sdl >= $min_sdl_version], [sdl_pc=yes], [sdl_pc=no]) else sdl_pc=no if test x$sdl_exec_prefix != x ; then sdl_config_args="$sdl_config_args --exec-prefix=$sdl_exec_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_exec_prefix/bin/sdl-config fi fi if test x$sdl_prefix != x ; then sdl_config_args="$sdl_config_args --prefix=$sdl_prefix" if test x${SDL_CONFIG+set} != xset ; then SDL_CONFIG=$sdl_prefix/bin/sdl-config fi fi fi if test "x$sdl_pc" = xyes ; then no_sdl="" SDL_CONFIG="$PKG_CONFIG sdl" else as_save_PATH="$PATH" if test "x$prefix" != xNONE && test "$cross_compiling" != yes; then PATH="$prefix/bin:$prefix/usr/bin:$PATH" fi AC_PATH_PROG(SDL_CONFIG, sdl-config, no, [$PATH]) PATH="$as_save_PATH" AC_MSG_CHECKING(for SDL - version >= $min_sdl_version) no_sdl="" if test "$SDL_CONFIG" = "no" ; then no_sdl=yes else SDL_CFLAGS=`$SDL_CONFIG $sdl_config_args --cflags` SDL_LIBS=`$SDL_CONFIG $sdl_config_args --libs` sdl_major_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\1/'` sdl_minor_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\2/'` sdl_micro_version=`$SDL_CONFIG $sdl_config_args --version | \ sed 's/\([[0-9]]*\).\([[0-9]]*\).\([[0-9]]*\)/\3/'` if test "x$enable_sdltest" = "xyes" ; then ac_save_CFLAGS="$CFLAGS" ac_save_CXXFLAGS="$CXXFLAGS" ac_save_LIBS="$LIBS" CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" dnl dnl Now check if the installed SDL is sufficiently new. (Also sanity dnl checks the results of sdl-config to some extent dnl rm -f conf.sdltest AC_RUN_IFELSE([AC_LANG_SOURCE([[ #include #include #include "SDL.h" int main (int argc, char *argv[]) { int major, minor, micro; FILE *fp = fopen("conf.sdltest", "w"); if (fp) fclose(fp); if (sscanf("$min_sdl_version", "%d.%d.%d", &major, &minor, µ) != 3) { printf("%s, bad version string\n", "$min_sdl_version"); exit(1); } if (($sdl_major_version > major) || (($sdl_major_version == major) && ($sdl_minor_version > minor)) || (($sdl_major_version == major) && ($sdl_minor_version == minor) && ($sdl_micro_version >= micro))) { return 0; } else { printf("\n*** 'sdl-config --version' returned %d.%d.%d, but the minimum version\n", $sdl_major_version, $sdl_minor_version, $sdl_micro_version); printf("*** of SDL required is %d.%d.%d. If sdl-config is correct, then it is\n", major, minor, micro); printf("*** best to upgrade to the required version.\n"); printf("*** If sdl-config was wrong, set the environment variable SDL_CONFIG\n"); printf("*** to point to the correct copy of sdl-config, and remove the file\n"); printf("*** config.cache before re-running configure\n"); return 1; } } ]])], [], [no_sdl=yes], [echo $ac_n "cross compiling; assumed OK... $ac_c"]) CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi if test "x$no_sdl" = x ; then AC_MSG_RESULT(yes) else AC_MSG_RESULT(no) fi fi if test "x$no_sdl" = x ; then ifelse([$2], , :, [$2]) else if test "$SDL_CONFIG" = "no" ; then echo "*** The sdl-config script installed by SDL could not be found" echo "*** If SDL was installed in PREFIX, make sure PREFIX/bin is in" echo "*** your path, or set the SDL_CONFIG environment variable to the" echo "*** full path to sdl-config." else if test -f conf.sdltest ; then : else echo "*** Could not run SDL test program, checking why..." CFLAGS="$CFLAGS $SDL_CFLAGS" CXXFLAGS="$CXXFLAGS $SDL_CFLAGS" LIBS="$LIBS $SDL_LIBS" AC_LINK_IFELSE([AC_LANG_PROGRAM([[ #include #include "SDL.h" int main(int argc, char *argv[]) { return 0; } #undef main #define main K_and_R_C_main ]], [[ return 0; ]])], [ echo "*** The test program compiled, but did not run. This usually means" echo "*** that the run-time linker is not finding SDL or finding the wrong" echo "*** version of SDL. If it is not finding SDL, you'll need to set your" echo "*** LD_LIBRARY_PATH environment variable, or edit /etc/ld.so.conf to point" echo "*** to the installed location Also, make sure you have run ldconfig if that" echo "*** is required on your system" echo "***" echo "*** If you have an old version installed, it is best to remove it, although" echo "*** you may also be able to get things to work by modifying LD_LIBRARY_PATH"], [ echo "*** The test program failed to compile or link. See the file config.log for the" echo "*** exact error that occured. This usually means SDL was incorrectly installed" echo "*** or that you have moved SDL since it was installed. In the latter case, you" echo "*** may want to edit the sdl-config script: $SDL_CONFIG" ]) CFLAGS="$ac_save_CFLAGS" CXXFLAGS="$ac_save_CXXFLAGS" LIBS="$ac_save_LIBS" fi fi SDL_CFLAGS="" SDL_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(SDL_CFLAGS) AC_SUBST(SDL_LIBS) rm -f conf.sdltest ]) sdl12-compat-1.2.74/sdl12_compat.pc.in0000664000000000000000000000075414775243035014204 0ustar00# sdl12_compat pkg-config source file prefix=@CMAKE_INSTALL_PREFIX@ exec_prefix=${prefix} libdir=@CMAKE_INSTALL_FULL_LIBDIR@ includedir=@CMAKE_INSTALL_FULL_INCLUDEDIR@ Name: sdl12_compat Description: An SDL-1.2 compatibility layer that uses SDL 2.0 behind the scenes. Version: @PROJECT_VERSION@ Provides: sdl = @PROJECT_VERSION@ Libs: -L${libdir} @SDL_RLD_FLAGS@ @SDL_LIBS@ @ENABLE_STATIC_TRUE@Libs.private: -L${libdir} @SDL_LIBS@ @SDL_STATIC_LIBS@ Cflags: -I${includedir}/SDL @SDL_CFLAGS@ sdl12-compat-1.2.74/src/Makefile.darwin0000664000000000000000000000206115140471502014453 0ustar00# GNU Makefile for Mac OS X to build SDL12-compat. # # change INCLUDES so it points to SDL2 headers directory: INCLUDES = -Iinclude ifeq ($(CROSS),) CC = gcc else CC = $(CROSS)-gcc endif LD = $(CC) CPPFLAGS = -DNDEBUG -D_THREAD_SAFE CPPFLAGS+= -DSDL_DISABLE_IMMINTRIN_H CFLAGS = -mmacosx-version-min=10.6 -fPIC -O3 -Wall LDFLAGS = -mmacosx-version-min=10.6 -dynamiclib -Wl,-undefined,error -Wl,-single_module #LDFLAGS+= -Wl,-headerpad_max_install_names LDFLAGS+= -Wl,-install_name,"/usr/local/lib/$(DYLIB)" LDFLAGS+= -Wl,-compatibility_version,1.0 -Wl,-current_version,12.74 LDLIBS = -Wl,-framework,AppKit # this is needed for x86_64 - cross-gcc might not add it. #LDLIBS += -Wl,-lbundle1.o DYLIB = libSDL-1.2.0.dylib OBJ = SDL12_compat.o SDL12_compat_objc.o .SUFFIXES: .SUFFIXES: .o .c .m all: $(DYLIB) $(DYLIB): $(OBJ) $(LD) -o $@ $(LDFLAGS) $(OBJ) $(LDLIBS) ln -sf $(DYLIB) libSDL.dylib .c.o: $(CC) $(CFLAGS) $(CPPFLAGS) $(INCLUDES) -o $@ -c $< .m.o: $(CC) $(CFLAGS) $(CPPFLAGS) $(INCLUDES) -o $@ -c $< distclean: clean $(RM) *.dylib clean: $(RM) *.o sdl12-compat-1.2.74/src/Makefile.linux0000664000000000000000000000137115140471502014331 0ustar00# GNU Makefile for Linux (Unix) to build SDL12-compat. # # change INCLUDES so it points to SDL2 headers directory: INCLUDES = -Iinclude CC = gcc LD = $(CC) CPPFLAGS = -DNDEBUG -D_THREAD_SAFE -D_REENTRANT CPPFLAGS+= -DSDL_DISABLE_IMMINTRIN_H CFLAGS = -fPIC -O3 -Wall LDFLAGS = -shared -Wl,-soname,libSDL-1.2.so.0 # make sure this is supported: LDFLAGS+= -Wl,--no-undefined LDLIBS = -ldl SHLIB = libSDL-1.2.so.1.2.74 OBJ = SDL12_compat.o .SUFFIXES: .SUFFIXES: .o .c all: $(SHLIB) $(SHLIB): $(OBJ) $(LD) -o $@ $(LDFLAGS) $(OBJ) $(LDLIBS) ln -sf $(SHLIB) libSDL-1.2.so.0 ln -sf libSDL-1.2.so.0 libSDL-1.2.so ln -sf libSDL-1.2.so.0 libSDL.so .c.o: $(CC) $(CFLAGS) $(CPPFLAGS) $(INCLUDES) -o $@ -c $< distclean: clean $(RM) *.so* clean: $(RM) *.o sdl12-compat-1.2.74/src/Makefile.mingw0000664000000000000000000000152714143301146014314 0ustar00# GNU Makefile for Windows to build SDL12-compat. # # change INCLUDES so it points to SDL2 headers directory: INCLUDES = -Iinclude ifeq ($(CROSS),) CC = gcc RC = windres else CC = $(CROSS)-gcc RC = $(CROSS)-windres endif LD = $(CC) CPPFLAGS = -DDLL_EXPORT -DNDEBUG CPPFLAGS+= -DSDL_DISABLE_IMMINTRIN_H CFLAGS = -O3 -Wall LDFLAGS = -nostdlib -shared -Wl,--no-undefined -Wl,--enable-auto-image-base -Wl,--out-implib,$(LIB) LDLIBS = -lkernel32 -luser32 # libgcc is needed for 32 bit (x86) builds: LDLIBS += -static-libgcc -lgcc LIB = libSDL.dll.a DLL = SDL.dll OBJ = SDL12_compat.o version.o .SUFFIXES: .SUFFIXES: .o .c .rc all: $(DLL) $(LIB): $(DLL) $(DLL): $(OBJ) $(LD) -o $@ $(LDFLAGS) $(OBJ) $(LDLIBS) .c.o: $(CC) $(CFLAGS) $(CPPFLAGS) $(INCLUDES) -o $@ -c $< .rc.o: $(RC) -o $@ $< distclean: clean $(RM) $(DLL) $(LIB) clean: $(RM) *.o sdl12-compat-1.2.74/src/Makefile.os20000664000000000000000000000373715113666252013715 0ustar00# OpenWatcom makefile to build SDL for OS/2 # !ifndef %WATCOM !error Environment variable WATCOM is not specified! !endif DLLNAME = SDL12 VERSION = 1.2.73 # change SDL2INC to point to the SDL2 headers SDL2INC = include INCPATH = -I"$(%WATCOM)/h/os2" -I"$(%WATCOM)/h" -I"$(SDL2INC)" LIBNAME = $(DLLNAME) DLLFILE = $(LIBNAME).dll LIBFILE = $(LIBNAME).lib LNKFILE = $(LIBNAME).lnk CFLAGS = -bt=os2 -d0 -zq -bm -5s -fp5 -fpi87 -sg -oeatxhn -ei # max warnings: CFLAGS+= -wx # avoid bogus W200 from cpuid code CFLAGS+= -wcd=200 # newer OpenWatcom versions enable W303 by default CFLAGS+= -wcd=303 # the include paths : CFLAGS+= $(INCPATH) # building dll: CFLAGS+= -bd # for DECLSPEC CFLAGS+= -DBUILD_SDL # misc CFLAGS+= -DNDEBUG -DSDL_DISABLE_IMMINTRIN_H DESCRIPTION = Simple DirectMedia Layer 1.2 object_files= SDL12_compat.obj .extensions: .extensions: .lib .dll .obj .c .asm .c.obj: wcc386 $(CFLAGS) -fo=$^@ $< all: $(DLLFILE) $(LIBFILE) .symbolic $(DLLFILE): compiling_info $(object_files) $(LNKFILE) @echo * Linking: $@ @wlink @$(LNKFILE) $(LIBFILE): $(DLLFILE) @echo * Creating LIB file: $@ wlib -q -b -n -c -pa -s -t -zld -ii -io $* $(DLLFILE) compiling_info : .symbolic @echo * Compiling... $(LNKFILE): @echo * Creating linker file: $@ @%create $@ @%append $@ SYSTEM os2v2_dll INITINSTANCE TERMINSTANCE @%append $@ NAME $(DLLFILE) @for %i in ($(object_files)) do @%append $@ FILE %i @%append $@ OPTION QUIET @%append $@ OPTION IMPF=$^&.exp @%append $@ OPTION MAP=$^&.map @%append $@ OPTION DESCRIPTION '@$#libsdl org:$(VERSION)$#@$(DESCRIPTION)' @%append $@ OPTION ELIMINATE @%append $@ OPTION MANYAUTODATA @%append $@ OPTION OSNAME='OS/2 and eComStation' @%append $@ OPTION SHOWDEAD clean: .SYMBOLIC @echo * Clean: $(LIBNAME) $(VERSION) @if exist *.obj rm *.obj @if exist *.map rm *.map @if exist *.exp rm *.exp @if exist $(LNKFILE) rm $(LNKFILE) distclean: clean .SYMBOLIC @if exist *.err rm *.err @if exist $(DLLFILE) rm $(DLLFILE) @if exist $(LIBFILE) rm $(LIBFILE) sdl12-compat-1.2.74/src/Makefile.vc0000664000000000000000000000146614143301146013605 0ustar00# Makefile for Win32 using MSVC: # nmake /f Makefile.vc # # If you specifically want to build for x86: # nmake /f Makefile.vc CPU=x86 # change INCLUDES so it points to SDL2 headers directory: INCLUDES = -Iinclude CPPFLAGS = -DNDEBUG -DDLL_EXPORT CPPFLAGS = $(CPPFLAGS) -DSDL_DISABLE_IMMINTRIN_H CC = cl LD = link RC = rc CFLAGS = /nologo /O2 /MD /W3 /GS- LDFLAGS = /nologo /DLL /NODEFAULTLIB /RELEASE LDLIBS = kernel32.lib user32.lib !if "$(CPU)" == "x86" CFLAGS = $(CFLAGS) /arch:SSE !endif DLLNAME = SDL.dll IMPNAME = SDL.lib OBJ = SDL12_compat.obj version.res all: $(DLLNAME) $(DLLNAME): $(OBJ) $(LD) /OUT:$@ $(LDFLAGS) $(OBJ) $(LDLIBS) .c.obj: $(CC) $(CFLAGS) $(CPPFLAGS) $(INCLUDES) /Fo$@ -c $< .rc.res: $(RC) /r /Fo$@ $< distclean: clean clean: -del *.obj *.res *.exp *.manifest $(DLLNAME) $(IMPNAME) sdl12-compat-1.2.74/src/Makefile.w320000664000000000000000000000472715113666252013625 0ustar00# OpenWatcom makefile to build SDL for Win32 # !ifndef %WATCOM !error Environment variable WATCOM is not specified! !endif DLLNAME = SDL VERSION = 1.2.73 # change SDL2INC to point to the SDL2 headers SDL2INC = include INCPATH = -I"$(%WATCOM)/h/nt" -I"$(%WATCOM)/h" LIBNAME = $(DLLNAME) DLLFILE = $(LIBNAME).dll LIBFILE = $(LIBNAME).lib LNKFILE = $(LIBNAME).lnk CFLAGS =-bt=nt -d0 -zq -bm -5s -fp5 -fpi87 -sg -oeatxhn -ei # max warnings: CFLAGS+= -wx # avoid bogus W200 from cpuid code CFLAGS+= -wcd=200 # newer OpenWatcom versions enable W303 by default CFLAGS+= -wcd=303 # the include paths : CFLAGS+= $(INCPATH) # misc CFLAGS+= -DNDEBUG -DSDL_DISABLE_IMMINTRIN_H CFLAGS_DLL = $(CFLAGS) # building dll: CFLAGS_DLL+= -bd # the include paths : CFLAGS_DLL+= -I"$(SDL2INC)" # we override the DECLSPEC define in begin_code.h, because we are using # an exports file to remove the _cdecl '_' prefix from the symbol names CFLAGS_DLL+= -DDECLSPEC= CFLAGS_SDLMAIN = $(CFLAGS) # the include paths : CFLAGS_SDLMAIN+= -I"../include/SDL" object_files= SDL12_compat.obj resource_obj= version.res .extensions: .extensions: .lib .dll .obj .c .asm .res .rc .c.obj: wcc386 $(CFLAGS_DLL) -fo=$^@ $< .rc.res: wrc -q -r -bt=nt -I"$(%WATCOM)/h/nt" -fo=$^@ $< all: $(DLLFILE) $(LIBFILE) SDLmain.lib .symbolic $(DLLFILE): compiling_info $(object_files) $(resource_obj) $(LNKFILE) @echo * Linking: $@ @wlink @$(LNKFILE) $(LIBFILE): $(DLLFILE) @echo * Creating LIB file: $@ wlib -q -b -n -c -pa -s -t -zld -ii -io $* @SDL12.lbc SDLmain.lib: SDL_win32_main.obj wlib -q -b -n $@ -+SDL_win32_main.obj SDL_win32_main.obj : SDLmain/win32/SDL_win32_main.c wcc386 $(CFLAGS_SDLMAIN) -fo=$^@ $< compiling_info : .symbolic @echo * Compiling... $(LNKFILE): @echo * Creating linker file: $@ @%create $@ @%append $@ SYSTEM nt_dll INITINSTANCE TERMINSTANCE @%append $@ NAME $(DLLFILE) @for %i in ($(object_files)) do @%append $@ FILE %i @%append $@ EXPORT=SDL12.exports @%append $@ OPTION IMPF=SDL12.lbc @%append $@ OPTION RESOURCE=$(resource_obj) @%append $@ OPTION QUIET @%append $@ OPTION MAP=$^&.map @%append $@ OPTION ELIMINATE @%append $@ OPTION SHOWDEAD clean: .SYMBOLIC @echo * Clean: $(LIBNAME) $(VERSION) @if exist *.obj rm *.obj @if exist *.res rm *.res @if exist *.lbc rm *.lbc @if exist *.map rm *.map @if exist $(LNKFILE) rm $(LNKFILE) distclean: clean .SYMBOLIC @if exist *.err rm *.err @if exist $(DLLFILE) rm $(DLLFILE) @if exist $(LIBFILE) rm $(LIBFILE) @if exist SDLmain.lib rm SDLmain.lib sdl12-compat-1.2.74/src/SDL12.exports0000664000000000000000000003574615045236163013771 0ustar00# Windows exports file for Watcom ++'_SDL_InitSubSystem'.'SDL.dll'.'SDL_InitSubSystem'.'SDL_InitSubSystem' ++'_SDL_Init'.'SDL.dll'.'SDL_Init'.'SDL_Init' ++'_SDL_QuitSubSystem'.'SDL.dll'.'SDL_QuitSubSystem'.'SDL_QuitSubSystem' ++'_SDL_WasInit'.'SDL.dll'.'SDL_WasInit'.'SDL_WasInit' ++'_SDL_Quit'.'SDL.dll'.'SDL_Quit'.'SDL_Quit' ++'_SDL_Linked_Version'.'SDL.dll'.'SDL_Linked_Version'.'SDL_Linked_Version' ++'_SDL_putenv'.'SDL.dll'.'SDL_putenv'.'SDL_putenv' ++'_SDL_getenv'.'SDL.dll'.'SDL_getenv'.'SDL_getenv' ++'_SDL_malloc'.'SDL.dll'.'SDL_malloc'.'SDL_malloc' ++'_SDL_calloc'.'SDL.dll'.'SDL_calloc'.'SDL_calloc' ++'_SDL_realloc'.'SDL.dll'.'SDL_realloc'.'SDL_realloc' ++'_SDL_free'.'SDL.dll'.'SDL_free'.'SDL_free' ++'_SDL_qsort'.'SDL.dll'.'SDL_qsort'.'SDL_qsort' ++'_SDL_iconv_open'.'SDL.dll'.'SDL_iconv_open'.'SDL_iconv_open' ++'_SDL_iconv'.'SDL.dll'.'SDL_iconv'.'SDL_iconv' ++'_SDL_iconv_close'.'SDL.dll'.'SDL_iconv_close'.'SDL_iconv_close' ++'_SDL_iconv_string'.'SDL.dll'.'SDL_iconv_string'.'SDL_iconv_string' ++'_SDL_revcpy'.'SDL.dll'.'SDL_revcpy'.'SDL_revcpy' ++'_SDL_strlcpy'.'SDL.dll'.'SDL_strlcpy'.'SDL_strlcpy' ++'_SDL_strlcat'.'SDL.dll'.'SDL_strlcat'.'SDL_strlcat' ++'_SDL_strcasecmp'.'SDL.dll'.'SDL_strcasecmp'.'SDL_strcasecmp' ++'_SDL_strncasecmp'.'SDL.dll'.'SDL_strncasecmp'.'SDL_strncasecmp' ++'_SDL_strncmp'.'SDL.dll'.'SDL_strncmp'.'SDL_strncmp' ++'_SDL_strrchr'.'SDL.dll'.'SDL_strrchr'.'SDL_strrchr' ++'_SDL_strrev'.'SDL.dll'.'SDL_strrev'.'SDL_strrev' ++'_SDL_strstr'.'SDL.dll'.'SDL_strstr'.'SDL_strstr' ++'_SDL_strchr'.'SDL.dll'.'SDL_strchr'.'SDL_strchr' ++'_SDL_strcmp'.'SDL.dll'.'SDL_strcmp'.'SDL_strcmp' ++'_SDL_strdup'.'SDL.dll'.'SDL_strdup'.'SDL_strdup' ++'_SDL_strlen'.'SDL.dll'.'SDL_strlen'.'SDL_strlen' ++'_SDL_strlwr'.'SDL.dll'.'SDL_strlwr'.'SDL_strlwr' ++'_SDL_strupr'.'SDL.dll'.'SDL_strupr'.'SDL_strupr' ++'_SDL_memcmp'.'SDL.dll'.'SDL_memcmp'.'SDL_memcmp' ++'_SDL_memcpy'.'SDL.dll'.'SDL_memcpy'.'SDL_memcpy' ++'_SDL_memset'.'SDL.dll'.'SDL_memset'.'SDL_memset' ++'_SDL_lltoa'.'SDL.dll'.'SDL_lltoa'.'SDL_lltoa' ++'_SDL_ltoa'.'SDL.dll'.'SDL_ltoa'.'SDL_ltoa' ++'_SDL_strtod'.'SDL.dll'.'SDL_strtod'.'SDL_strtod' ++'_SDL_strtol'.'SDL.dll'.'SDL_strtol'.'SDL_strtol' ++'_SDL_strtoul'.'SDL.dll'.'SDL_strtoul'.'SDL_strtoul' ++'_SDL_ulltoa'.'SDL.dll'.'SDL_ulltoa'.'SDL_ulltoa' ++'_SDL_ultoa'.'SDL.dll'.'SDL_ultoa'.'SDL_ultoa' ++'_SDL_strtoll'.'SDL.dll'.'SDL_strtoll'.'SDL_strtoll' ++'_SDL_strtoull'.'SDL.dll'.'SDL_strtoull'.'SDL_strtoull' ++'_SDL_snprintf'.'SDL.dll'.'SDL_snprintf'.'SDL_snprintf' ++'_SDL_vsnprintf'.'SDL.dll'.'SDL_vsnprintf'.'SDL_vsnprintf' ++'_SDL_sscanf'.'SDL.dll'.'SDL_sscanf'.'SDL_sscanf' ++'_SDL_SetError'.'SDL.dll'.'SDL_SetError'.'SDL_SetError' ++'_SDL_GetError'.'SDL.dll'.'SDL_GetError'.'SDL_GetError' ++'_SDL_ClearError'.'SDL.dll'.'SDL_ClearError'.'SDL_ClearError' ++'_SDL_Error'.'SDL.dll'.'SDL_Error'.'SDL_Error' ++'_SDL_AudioInit'.'SDL.dll'.'SDL_AudioInit'.'SDL_AudioInit' ++'_SDL_AudioDriverName'.'SDL.dll'.'SDL_AudioDriverName'.'SDL_AudioDriverName' ++'_SDL_OpenAudio'.'SDL.dll'.'SDL_OpenAudio'.'SDL_OpenAudio' ++'_SDL_GetAudioStatus'.'SDL.dll'.'SDL_GetAudioStatus'.'SDL_GetAudioStatus' ++'_SDL_PauseAudio'.'SDL.dll'.'SDL_PauseAudio'.'SDL_PauseAudio' ++'_SDL_LockAudio'.'SDL.dll'.'SDL_LockAudio'.'SDL_LockAudio' ++'_SDL_UnlockAudio'.'SDL.dll'.'SDL_UnlockAudio'.'SDL_UnlockAudio' ++'_SDL_CloseAudio'.'SDL.dll'.'SDL_CloseAudio'.'SDL_CloseAudio' ++'_SDL_AudioQuit'.'SDL.dll'.'SDL_AudioQuit'.'SDL_AudioQuit' ++'_SDL_GetAppState'.'SDL.dll'.'SDL_GetAppState'.'SDL_GetAppState' ++'_SDL_ConvertAudio'.'SDL.dll'.'SDL_ConvertAudio'.'SDL_ConvertAudio' ++'_SDL_BuildAudioCVT'.'SDL.dll'.'SDL_BuildAudioCVT'.'SDL_BuildAudioCVT' ++'_SDL_LoadBMP_RW'.'SDL.dll'.'SDL_LoadBMP_RW'.'SDL_LoadBMP_RW' ++'_SDL_SaveBMP_RW'.'SDL.dll'.'SDL_SaveBMP_RW'.'SDL_SaveBMP_RW' ++'_SDL_CDNumDrives'.'SDL.dll'.'SDL_CDNumDrives'.'SDL_CDNumDrives' ++'_SDL_CDName'.'SDL.dll'.'SDL_CDName'.'SDL_CDName' ++'_SDL_CDOpen'.'SDL.dll'.'SDL_CDOpen'.'SDL_CDOpen' ++'_SDL_CDStatus'.'SDL.dll'.'SDL_CDStatus'.'SDL_CDStatus' ++'_SDL_CDPlayTracks'.'SDL.dll'.'SDL_CDPlayTracks'.'SDL_CDPlayTracks' ++'_SDL_CDPlay'.'SDL.dll'.'SDL_CDPlay'.'SDL_CDPlay' ++'_SDL_CDPause'.'SDL.dll'.'SDL_CDPause'.'SDL_CDPause' ++'_SDL_CDResume'.'SDL.dll'.'SDL_CDResume'.'SDL_CDResume' ++'_SDL_CDStop'.'SDL.dll'.'SDL_CDStop'.'SDL_CDStop' ++'_SDL_CDEject'.'SDL.dll'.'SDL_CDEject'.'SDL_CDEject' ++'_SDL_CDClose'.'SDL.dll'.'SDL_CDClose'.'SDL_CDClose' ++'_SDL_CreateCursor'.'SDL.dll'.'SDL_CreateCursor'.'SDL_CreateCursor' ++'_SDL_SetCursor'.'SDL.dll'.'SDL_SetCursor'.'SDL_SetCursor' ++'_SDL_GetCursor'.'SDL.dll'.'SDL_GetCursor'.'SDL_GetCursor' ++'_SDL_FreeCursor'.'SDL.dll'.'SDL_FreeCursor'.'SDL_FreeCursor' ++'_SDL_ShowCursor'.'SDL.dll'.'SDL_ShowCursor'.'SDL_ShowCursor' ++'_SDL_WarpMouse'.'SDL.dll'.'SDL_WarpMouse'.'SDL_WarpMouse' ++'_SDL_PeepEvents'.'SDL.dll'.'SDL_PeepEvents'.'SDL_PeepEvents' ++'_SDL_PumpEvents'.'SDL.dll'.'SDL_PumpEvents'.'SDL_PumpEvents' ++'_SDL_PollEvent'.'SDL.dll'.'SDL_PollEvent'.'SDL_PollEvent' ++'_SDL_WaitEvent'.'SDL.dll'.'SDL_WaitEvent'.'SDL_WaitEvent' ++'_SDL_PushEvent'.'SDL.dll'.'SDL_PushEvent'.'SDL_PushEvent' ++'_SDL_SetEventFilter'.'SDL.dll'.'SDL_SetEventFilter'.'SDL_SetEventFilter' ++'_SDL_GetEventFilter'.'SDL.dll'.'SDL_GetEventFilter'.'SDL_GetEventFilter' ++'_SDL_EventState'.'SDL.dll'.'SDL_EventState'.'SDL_EventState' ++'_SDL_SetGamma'.'SDL.dll'.'SDL_SetGamma'.'SDL_SetGamma' ++'_SDL_SetGammaRamp'.'SDL.dll'.'SDL_SetGammaRamp'.'SDL_SetGammaRamp' ++'_SDL_GetGammaRamp'.'SDL.dll'.'SDL_GetGammaRamp'.'SDL_GetGammaRamp' ++'_SDL_NumJoysticks'.'SDL.dll'.'SDL_NumJoysticks'.'SDL_NumJoysticks' ++'_SDL_JoystickName'.'SDL.dll'.'SDL_JoystickName'.'SDL_JoystickName' ++'_SDL_JoystickOpen'.'SDL.dll'.'SDL_JoystickOpen'.'SDL_JoystickOpen' ++'_SDL_JoystickOpened'.'SDL.dll'.'SDL_JoystickOpened'.'SDL_JoystickOpened' ++'_SDL_JoystickIndex'.'SDL.dll'.'SDL_JoystickIndex'.'SDL_JoystickIndex' ++'_SDL_JoystickNumAxes'.'SDL.dll'.'SDL_JoystickNumAxes'.'SDL_JoystickNumAxes' ++'_SDL_JoystickNumHats'.'SDL.dll'.'SDL_JoystickNumHats'.'SDL_JoystickNumHats' ++'_SDL_JoystickNumBalls'.'SDL.dll'.'SDL_JoystickNumBalls'.'SDL_JoystickNumBalls' ++'_SDL_JoystickNumButtons'.'SDL.dll'.'SDL_JoystickNumButtons'.'SDL_JoystickNumButtons' ++'_SDL_JoystickGetAxis'.'SDL.dll'.'SDL_JoystickGetAxis'.'SDL_JoystickGetAxis' ++'_SDL_JoystickGetHat'.'SDL.dll'.'SDL_JoystickGetHat'.'SDL_JoystickGetHat' ++'_SDL_JoystickGetBall'.'SDL.dll'.'SDL_JoystickGetBall'.'SDL_JoystickGetBall' ++'_SDL_JoystickGetButton'.'SDL.dll'.'SDL_JoystickGetButton'.'SDL_JoystickGetButton' ++'_SDL_JoystickClose'.'SDL.dll'.'SDL_JoystickClose'.'SDL_JoystickClose' ++'_SDL_JoystickUpdate'.'SDL.dll'.'SDL_JoystickUpdate'.'SDL_JoystickUpdate' ++'_SDL_JoystickEventState'.'SDL.dll'.'SDL_JoystickEventState'.'SDL_JoystickEventState' ++'_SDL_EnableUNICODE'.'SDL.dll'.'SDL_EnableUNICODE'.'SDL_EnableUNICODE' ++'_SDL_GetKeyState'.'SDL.dll'.'SDL_GetKeyState'.'SDL_GetKeyState' ++'_SDL_GetModState'.'SDL.dll'.'SDL_GetModState'.'SDL_GetModState' ++'_SDL_SetModState'.'SDL.dll'.'SDL_SetModState'.'SDL_SetModState' ++'_SDL_GetKeyName'.'SDL.dll'.'SDL_GetKeyName'.'SDL_GetKeyName' ++'_SDL_EnableKeyRepeat'.'SDL.dll'.'SDL_EnableKeyRepeat'.'SDL_EnableKeyRepeat' ++'_SDL_GetKeyRepeat'.'SDL.dll'.'SDL_GetKeyRepeat'.'SDL_GetKeyRepeat' ++'_SDL_MixAudio'.'SDL.dll'.'SDL_MixAudio'.'SDL_MixAudio' ++'_SDL_GetMouseState'.'SDL.dll'.'SDL_GetMouseState'.'SDL_GetMouseState' ++'_SDL_GetRelativeMouseState'.'SDL.dll'.'SDL_GetRelativeMouseState'.'SDL_GetRelativeMouseState' ++'_SDL_MapRGB'.'SDL.dll'.'SDL_MapRGB'.'SDL_MapRGB' ++'_SDL_MapRGBA'.'SDL.dll'.'SDL_MapRGBA'.'SDL_MapRGBA' ++'_SDL_GetRGBA'.'SDL.dll'.'SDL_GetRGBA'.'SDL_GetRGBA' ++'_SDL_GetRGB'.'SDL.dll'.'SDL_GetRGB'.'SDL_GetRGB' ++'_SDL_RWFromFile'.'SDL.dll'.'SDL_RWFromFile'.'SDL_RWFromFile' ++'_SDL_RWFromFP'.'SDL.dll'.'SDL_RWFromFP'.'SDL_RWFromFP' ++'_SDL_RWFromMem'.'SDL.dll'.'SDL_RWFromMem'.'SDL_RWFromMem' ++'_SDL_RWFromConstMem'.'SDL.dll'.'SDL_RWFromConstMem'.'SDL_RWFromConstMem' ++'_SDL_AllocRW'.'SDL.dll'.'SDL_AllocRW'.'SDL_AllocRW' ++'_SDL_FreeRW'.'SDL.dll'.'SDL_FreeRW'.'SDL_FreeRW' ++'_SDL_ReadLE16'.'SDL.dll'.'SDL_ReadLE16'.'SDL_ReadLE16' ++'_SDL_ReadBE16'.'SDL.dll'.'SDL_ReadBE16'.'SDL_ReadBE16' ++'_SDL_ReadLE32'.'SDL.dll'.'SDL_ReadLE32'.'SDL_ReadLE32' ++'_SDL_ReadBE32'.'SDL.dll'.'SDL_ReadBE32'.'SDL_ReadBE32' ++'_SDL_ReadLE64'.'SDL.dll'.'SDL_ReadLE64'.'SDL_ReadLE64' ++'_SDL_ReadBE64'.'SDL.dll'.'SDL_ReadBE64'.'SDL_ReadBE64' ++'_SDL_WriteLE16'.'SDL.dll'.'SDL_WriteLE16'.'SDL_WriteLE16' ++'_SDL_WriteBE16'.'SDL.dll'.'SDL_WriteBE16'.'SDL_WriteBE16' ++'_SDL_WriteLE32'.'SDL.dll'.'SDL_WriteLE32'.'SDL_WriteLE32' ++'_SDL_WriteBE32'.'SDL.dll'.'SDL_WriteBE32'.'SDL_WriteBE32' ++'_SDL_WriteLE64'.'SDL.dll'.'SDL_WriteLE64'.'SDL_WriteLE64' ++'_SDL_WriteBE64'.'SDL.dll'.'SDL_WriteBE64'.'SDL_WriteBE64' ++'_SDL_SoftStretch'.'SDL.dll'.'SDL_SoftStretch'.'SDL_SoftStretch' ++'_SDL_CreateRGBSurface'.'SDL.dll'.'SDL_CreateRGBSurface'.'SDL_CreateRGBSurface' ++'_SDL_CreateRGBSurfaceFrom'.'SDL.dll'.'SDL_CreateRGBSurfaceFrom'.'SDL_CreateRGBSurfaceFrom' ++'_SDL_SetColorKey'.'SDL.dll'.'SDL_SetColorKey'.'SDL_SetColorKey' ++'_SDL_SetAlpha'.'SDL.dll'.'SDL_SetAlpha'.'SDL_SetAlpha' ++'_SDL_SetClipRect'.'SDL.dll'.'SDL_SetClipRect'.'SDL_SetClipRect' ++'_SDL_GetClipRect'.'SDL.dll'.'SDL_GetClipRect'.'SDL_GetClipRect' ++'_SDL_LowerBlit'.'SDL.dll'.'SDL_LowerBlit'.'SDL_LowerBlit' ++'_SDL_UpperBlit'.'SDL.dll'.'SDL_UpperBlit'.'SDL_UpperBlit' ++'_SDL_FillRect'.'SDL.dll'.'SDL_FillRect'.'SDL_FillRect' ++'_SDL_LockSurface'.'SDL.dll'.'SDL_LockSurface'.'SDL_LockSurface' ++'_SDL_UnlockSurface'.'SDL.dll'.'SDL_UnlockSurface'.'SDL_UnlockSurface' ++'_SDL_ConvertSurface'.'SDL.dll'.'SDL_ConvertSurface'.'SDL_ConvertSurface' ++'_SDL_FreeSurface'.'SDL.dll'.'SDL_FreeSurface'.'SDL_FreeSurface' ++'_SDL_LoadObject'.'SDL.dll'.'SDL_LoadObject'.'SDL_LoadObject' ++'_SDL_LoadFunction'.'SDL.dll'.'SDL_LoadFunction'.'SDL_LoadFunction' ++'_SDL_UnloadObject'.'SDL.dll'.'SDL_UnloadObject'.'SDL_UnloadObject' ++'_SDL_CreateCond'.'SDL.dll'.'SDL_CreateCond'.'SDL_CreateCond' ++'_SDL_DestroyCond'.'SDL.dll'.'SDL_DestroyCond'.'SDL_DestroyCond' ++'_SDL_CondSignal'.'SDL.dll'.'SDL_CondSignal'.'SDL_CondSignal' ++'_SDL_CondBroadcast'.'SDL.dll'.'SDL_CondBroadcast'.'SDL_CondBroadcast' ++'_SDL_CondWaitTimeout'.'SDL.dll'.'SDL_CondWaitTimeout'.'SDL_CondWaitTimeout' ++'_SDL_CondWait'.'SDL.dll'.'SDL_CondWait'.'SDL_CondWait' ++'_SDL_SetModuleHandle'.'SDL.dll'.'SDL_SetModuleHandle'.'SDL_SetModuleHandle' ++'_SDL_RegisterApp'.'SDL.dll'.'SDL_RegisterApp'.'SDL_RegisterApp' ++'_SDL_UnregisterApp'.'SDL.dll'.'SDL_UnregisterApp'.'SDL_UnregisterApp' ++'_SDL_CreateMutex'.'SDL.dll'.'SDL_CreateMutex'.'SDL_CreateMutex' ++'_SDL_DestroyMutex'.'SDL.dll'.'SDL_DestroyMutex'.'SDL_DestroyMutex' ++'_SDL_mutexP'.'SDL.dll'.'SDL_mutexP'.'SDL_mutexP' ++'_SDL_mutexV'.'SDL.dll'.'SDL_mutexV'.'SDL_mutexV' ++'_SDL_CreateSemaphore'.'SDL.dll'.'SDL_CreateSemaphore'.'SDL_CreateSemaphore' ++'_SDL_DestroySemaphore'.'SDL.dll'.'SDL_DestroySemaphore'.'SDL_DestroySemaphore' ++'_SDL_SemWaitTimeout'.'SDL.dll'.'SDL_SemWaitTimeout'.'SDL_SemWaitTimeout' ++'_SDL_SemTryWait'.'SDL.dll'.'SDL_SemTryWait'.'SDL_SemTryWait' ++'_SDL_SemWait'.'SDL.dll'.'SDL_SemWait'.'SDL_SemWait' ++'_SDL_SemValue'.'SDL.dll'.'SDL_SemValue'.'SDL_SemValue' ++'_SDL_SemPost'.'SDL.dll'.'SDL_SemPost'.'SDL_SemPost' ++'_SDL_ThreadID'.'SDL.dll'.'SDL_ThreadID'.'SDL_ThreadID' ++'_SDL_GetTicks'.'SDL.dll'.'SDL_GetTicks'.'SDL_GetTicks' ++'_SDL_Delay'.'SDL.dll'.'SDL_Delay'.'SDL_Delay' ++'_SDL_CreateThread'.'SDL.dll'.'SDL_CreateThread'.'SDL_CreateThread' ++'_SDL_WaitThread'.'SDL.dll'.'SDL_WaitThread'.'SDL_WaitThread' ++'_SDL_GetThreadID'.'SDL.dll'.'SDL_GetThreadID'.'SDL_GetThreadID' ++'_SDL_KillThread'.'SDL.dll'.'SDL_KillThread'.'SDL_KillThread' ++'_SDL_AddTimer'.'SDL.dll'.'SDL_AddTimer'.'SDL_AddTimer' ++'_SDL_RemoveTimer'.'SDL.dll'.'SDL_RemoveTimer'.'SDL_RemoveTimer' ++'_SDL_SetTimer'.'SDL.dll'.'SDL_SetTimer'.'SDL_SetTimer' ++'_SDL_VideoInit'.'SDL.dll'.'SDL_VideoInit'.'SDL_VideoInit' ++'_SDL_VideoDriverName'.'SDL.dll'.'SDL_VideoDriverName'.'SDL_VideoDriverName' ++'_SDL_GetVideoSurface'.'SDL.dll'.'SDL_GetVideoSurface'.'SDL_GetVideoSurface' ++'_SDL_GetVideoInfo'.'SDL.dll'.'SDL_GetVideoInfo'.'SDL_GetVideoInfo' ++'_SDL_ListModes'.'SDL.dll'.'SDL_ListModes'.'SDL_ListModes' ++'_SDL_VideoModeOK'.'SDL.dll'.'SDL_VideoModeOK'.'SDL_VideoModeOK' ++'_SDL_SetRefreshRate'.'SDL.dll'.'SDL_SetRefreshRate'.'SDL_SetRefreshRate' ++'_SDL_SetVideoMode'.'SDL.dll'.'SDL_SetVideoMode'.'SDL_SetVideoMode' ++'_SDL_DisplayFormat'.'SDL.dll'.'SDL_DisplayFormat'.'SDL_DisplayFormat' ++'_SDL_DisplayFormatAlpha'.'SDL.dll'.'SDL_DisplayFormatAlpha'.'SDL_DisplayFormatAlpha' ++'_SDL_UpdateRect'.'SDL.dll'.'SDL_UpdateRect'.'SDL_UpdateRect' ++'_SDL_UpdateRects'.'SDL.dll'.'SDL_UpdateRects'.'SDL_UpdateRects' ++'_SDL_Flip'.'SDL.dll'.'SDL_Flip'.'SDL_Flip' ++'_SDL_SetPalette'.'SDL.dll'.'SDL_SetPalette'.'SDL_SetPalette' ++'_SDL_SetColors'.'SDL.dll'.'SDL_SetColors'.'SDL_SetColors' ++'_SDL_VideoQuit'.'SDL.dll'.'SDL_VideoQuit'.'SDL_VideoQuit' ++'_SDL_GL_LoadLibrary'.'SDL.dll'.'SDL_GL_LoadLibrary'.'SDL_GL_LoadLibrary' ++'_SDL_GL_GetProcAddress'.'SDL.dll'.'SDL_GL_GetProcAddress'.'SDL_GL_GetProcAddress' ++'_SDL_GL_SetAttribute'.'SDL.dll'.'SDL_GL_SetAttribute'.'SDL_GL_SetAttribute' ++'_SDL_GL_GetAttribute'.'SDL.dll'.'SDL_GL_GetAttribute'.'SDL_GL_GetAttribute' ++'_SDL_GL_SwapBuffers'.'SDL.dll'.'SDL_GL_SwapBuffers'.'SDL_GL_SwapBuffers' ++'_SDL_GL_UpdateRects'.'SDL.dll'.'SDL_GL_UpdateRects'.'SDL_GL_UpdateRects' ++'_SDL_GL_Lock'.'SDL.dll'.'SDL_GL_Lock'.'SDL_GL_Lock' ++'_SDL_GL_Unlock'.'SDL.dll'.'SDL_GL_Unlock'.'SDL_GL_Unlock' ++'_SDL_GL_DisableContext'.'SDL.dll'.'SDL_GL_DisableContext'.'SDL_GL_DisableContext' ++'_SDL_GL_EnableContext_Thread'.'SDL.dll'.'SDL_GL_EnableContext_Thread'.'SDL_GL_EnableContext_Thread' ++'_SDL_WM_SetCaption'.'SDL.dll'.'SDL_WM_SetCaption'.'SDL_WM_SetCaption' ++'_SDL_WM_GetCaption'.'SDL.dll'.'SDL_WM_GetCaption'.'SDL_WM_GetCaption' ++'_SDL_WM_SetIcon'.'SDL.dll'.'SDL_WM_SetIcon'.'SDL_WM_SetIcon' ++'_SDL_WM_GrabInput'.'SDL.dll'.'SDL_WM_GrabInput'.'SDL_WM_GrabInput' ++'_SDL_WM_IconifyWindow'.'SDL.dll'.'SDL_WM_IconifyWindow'.'SDL_WM_IconifyWindow' ++'_SDL_WM_ToggleFullScreen'.'SDL.dll'.'SDL_WM_ToggleFullScreen'.'SDL_WM_ToggleFullScreen' ++'_SDL_GetWMInfo'.'SDL.dll'.'SDL_GetWMInfo'.'SDL_GetWMInfo' ++'_SDL_LoadWAV_RW'.'SDL.dll'.'SDL_LoadWAV_RW'.'SDL_LoadWAV_RW' ++'_SDL_FreeWAV'.'SDL.dll'.'SDL_FreeWAV'.'SDL_FreeWAV' ++'_SDL_CreateYUVOverlay'.'SDL.dll'.'SDL_CreateYUVOverlay'.'SDL_CreateYUVOverlay' ++'_SDL_LockYUVOverlay'.'SDL.dll'.'SDL_LockYUVOverlay'.'SDL_LockYUVOverlay' ++'_SDL_UnlockYUVOverlay'.'SDL.dll'.'SDL_UnlockYUVOverlay'.'SDL_UnlockYUVOverlay' ++'_SDL_DisplayYUVOverlay'.'SDL.dll'.'SDL_DisplayYUVOverlay'.'SDL_DisplayYUVOverlay' ++'_SDL_FreeYUVOverlay'.'SDL.dll'.'SDL_FreeYUVOverlay'.'SDL_FreeYUVOverlay' ++'_SDL_HasRDTSC'.'SDL.dll'.'SDL_HasRDTSC'.'SDL_HasRDTSC' ++'_SDL_HasMMX'.'SDL.dll'.'SDL_HasMMX'.'SDL_HasMMX' ++'_SDL_HasMMXExt'.'SDL.dll'.'SDL_HasMMXExt'.'SDL_HasMMXExt' ++'_SDL_Has3DNow'.'SDL.dll'.'SDL_Has3DNow'.'SDL_Has3DNow' ++'_SDL_Has3DNowExt'.'SDL.dll'.'SDL_Has3DNowExt'.'SDL_Has3DNowExt' ++'_SDL_HasSSE'.'SDL.dll'.'SDL_HasSSE'.'SDL_HasSSE' ++'_SDL_HasSSE2'.'SDL.dll'.'SDL_HasSSE2'.'SDL_HasSSE2' ++'_SDL_HasAltiVec'.'SDL.dll'.'SDL_HasAltiVec'.'SDL_HasAltiVec' ++'_SDL12COMPAT_GetWindow'.'SDL.dll'.'SDL12COMPAT_GetWindow'.'SDL12COMPAT_GetWindow' sdl12-compat-1.2.74/src/SDL12_compat.c0000664000000000000000000127025615140471502014042 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* This file contains functions for backwards compatibility with SDL 1.2 */ #include "SDL20_include_wrapper.h" /* * We report the library version as 1.2.$(SDL12_COMPAT_VERSION). This number * should be way ahead of what SDL-1.2 Classic would report, so apps can * decide if they're running under the compat layer, if they really care. */ #define SDL12_COMPAT_VERSION 74 #include #include #include #if defined(_MSC_VER) && (_MSC_VER < 1600) /* intptr_t already handled by stddef.h. */ #else #include #endif #ifdef _WIN32 #ifndef WIN32_LEAN_AND_MEAN #define WIN32_LEAN_AND_MEAN 1 #endif #include #else #include /* fprintf(), etc. */ #include /* for abort() */ #include #endif /* mingw headers may define these ... */ #undef strtod #undef strcasecmp #undef strncasecmp #undef snprintf #undef vsnprintf #ifdef __linux__ #include /* for readlink() */ #endif #if defined(__unix__) || defined(__APPLE__) #ifndef PATH_MAX #define PATH_MAX 1024 #endif #define SDL12_MAXPATH PATH_MAX #elif defined _WIN32 #define SDL12_MAXPATH MAX_PATH #elif defined __OS2__ #define SDL12_MAXPATH CCHMAXPATH #else #define SDL12_MAXPATH 1024 #endif #ifdef __cplusplus extern "C" { #endif /* on x86 Linux builds, we have the public entry points force stack alignment to 16 bytes on entry. This won't be a massive performance hit, but it might help extremely old binaries that want to call into SDL to not crash in hard-to-diagnose ways. It's not a panacea to the stack alignment problem, but it might help a little. The force_align_arg_pointer attribute requires gcc >= 4.2.x. */ #if defined(__clang__) #define HAVE_FORCE_ALIGN_ARG_POINTER #elif defined(__GNUC__) && (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 2)) #define HAVE_FORCE_ALIGN_ARG_POINTER #endif #if defined(__linux__) && defined(__i386__) && defined(HAVE_FORCE_ALIGN_ARG_POINTER) #define FORCEALIGNATTR __attribute__((force_align_arg_pointer)) #else #define FORCEALIGNATTR #endif #define DECLSPEC12 DECLSPEC FORCEALIGNATTR /** Enable this to have warnings about wrong prototypes in SDL20_syms.h. * It won't compile but it helps to make sure it's sync'ed with SDL2 headers. */ #if 0 #define SDL20_SYM(rc,fn,params,args,ret) \ typedef rc (SDLCALL *SDL20_##fn##_t) params; \ static SDL20_##fn##_t SDL20_##fn = IGNORE_THIS_VERSION_OF_SDL_##fn; #else #define SDL20_SYM(rc,fn,params,args,ret) \ typedef rc (SDLCALL *SDL20_##fn##_t) params; \ static SDL20_##fn##_t SDL20_##fn = NULL; #endif #include "SDL20_syms.h" /* Things that _should_ be binary compatible pass right through... */ #define SDL20_SYM_PASSTHROUGH(rc,fn,params,args,ret) \ DECLSPEC12 rc SDLCALL SDL_##fn params { ret SDL20_##fn args; } #include "SDL20_syms.h" /* these are macros (etc) in the SDL headers, so make our own. */ #define SDL20_OutOfMemory() SDL20_Error(SDL_ENOMEM) #define SDL20_Unsupported() SDL20_Error(SDL_UNSUPPORTED) #define SDL20_InvalidParamError(param) SDL20_SetError("Parameter '%s' is invalid", (param)) #define SDL20_zero(x) SDL20_memset(&(x), 0, sizeof((x))) #define SDL20_zerop(x) SDL20_memset((x), 0, sizeof(*(x))) #define SDL20_zeroa(x) SDL20_memset((x), 0, sizeof((x))) #define SDL_ReportAssertion SDL20_ReportAssertion /* for SDL_assert() : */ #define SDL_enabled_assert(condition) \ do { \ while ( !(condition) ) { \ static struct SDL_AssertData sdl_assert_data = { 0, 0, #condition, 0, 0, 0, 0 }; \ const SDL_AssertState sdl_assert_state = SDL20_ReportAssertion(&sdl_assert_data, SDL_FUNCTION, SDL_FILE, SDL_LINE); \ if (sdl_assert_state == SDL_ASSERTION_RETRY) { \ continue; /* go again. */ \ } else if (sdl_assert_state == SDL_ASSERTION_BREAK) { \ SDL_TriggerBreakpoint(); \ } \ break; /* not retrying. */ \ } \ } while (SDL_NULL_WHILE_LOOP_CONDITION) /* From SDL2.0's SDL_bits.h: a force-inlined function. */ #if defined(__WATCOMC__) && defined(__386__) extern __inline int _SDL20_bsr_watcom(Uint32); #pragma aux _SDL20_bsr_watcom = \ "bsr eax, eax" \ parm [eax] nomemory \ value [eax] \ modify exact [eax] nomemory; #endif SDL_FORCE_INLINE int SDL20_MostSignificantBitIndex32(Uint32 x) { #if defined(__GNUC__) && (__GNUC__ >= 4 || (__GNUC__ == 3 && __GNUC_MINOR__ >= 4)) /* Count Leading Zeroes builtin in GCC. * http://gcc.gnu.org/onlinedocs/gcc-4.3.4/gcc/Other-Builtins.html */ if (x == 0) { return -1; } return 31 - __builtin_clz(x); #elif defined(__WATCOMC__) && defined(__386__) if (x == 0) { return -1; } return _SDL20_bsr_watcom(x); #elif defined(_MSC_VER) unsigned long index; if (_BitScanReverse(&index, x)) { return index; } return -1; #else /* Based off of Bit Twiddling Hacks by Sean Eron Anderson * , released in the public domain. * http://graphics.stanford.edu/~seander/bithacks.html#IntegerLog */ const Uint32 b[] = {0x2, 0xC, 0xF0, 0xFF00, 0xFFFF0000}; const int S[] = {1, 2, 4, 8, 16}; int msbIndex = 0; int i; if (x == 0) { return -1; } for (i = 4; i >= 0; i--) { if (x & b[i]) { x >>= S[i]; msbIndex |= S[i]; } } return msbIndex; #endif } /* SDL_truncf needs SDL >=2.0.14, so copy it here. */ static float SDL20_truncf(float x) { return (x < 0.0f) ? (float)SDL20_ceil(x) : (float)SDL20_floor(x); } #define SDL12_DEFAULT_REPEAT_DELAY 500 #define SDL12_DEFAULT_REPEAT_INTERVAL 30 #define SDL12_INIT_TIMER 0x00000001 #define SDL12_INIT_AUDIO 0x00000010 #define SDL12_INIT_VIDEO 0x00000020 #define SDL12_INIT_CDROM 0x00000100 #define SDL12_INIT_JOYSTICK 0x00000200 #define SDL12_INIT_NOPARACHUTE 0x00100000 #define SDL12_INIT_EVENTTHREAD 0x01000000 #define SDL12_INIT_EVERYTHING 0x0000FFFF #define SDL12_LOGPAL 1 #define SDL12_PHYSPAL 2 #define SDL12_REFRESH_DEFAULT 0 #ifndef SDL_SIMD_ALIGNED #define SDL_SIMD_ALIGNED 0x00000008 #endif typedef struct SDL12_Rect { Sint16 x; Sint16 y; Uint16 w; Uint16 h; } SDL12_Rect; typedef struct SDL12_Palette { int ncolors; SDL_Color *colors; } SDL12_Palette; typedef struct SDL12_PixelFormat { SDL12_Palette *palette; Uint8 BitsPerPixel; Uint8 BytesPerPixel; Uint8 Rloss; Uint8 Gloss; Uint8 Bloss; Uint8 Aloss; Uint8 Rshift; Uint8 Gshift; Uint8 Bshift; Uint8 Ashift; Uint32 Rmask; Uint32 Gmask; Uint32 Bmask; Uint32 Amask; Uint32 colorkey; Uint8 alpha; } SDL12_PixelFormat; typedef struct SDL12_Surface { Uint32 flags; SDL12_PixelFormat *format; int w; int h; Uint16 pitch; void *pixels; int offset; SDL_Surface *surface20; /* the real SDL 1.2 has an opaque pointer to a platform-specific thing here named "hwdata". */ SDL12_Rect clip_rect; Uint32 unused1; Uint32 locked; void *blitmap; unsigned int format_version; int refcount; } SDL12_Surface; #define SDL12_YV12_OVERLAY 0x32315659 #define SDL12_IYUV_OVERLAY 0x56555949 #define SDL12_YUY2_OVERLAY 0x32595559 #define SDL12_UYVY_OVERLAY 0x59565955 #define SDL12_YVYU_OVERLAY 0x55595659 typedef struct SDL12_Overlay { Uint32 format; int w; int h; int planes; Uint16 *pitches; Uint8 **pixels; void *hwfuncs; void *hwdata; Uint32 hw_overlay :1; Uint32 UnusedBits :31; } SDL12_Overlay; typedef struct SDL12_YUVData /* internal struct, not part of public SDL 1.2 API */ { SDL_Texture *texture20; SDL_bool dirty; Uint8 *pixelbuf; Uint8 *pixels[3]; Uint16 pitches[3]; } SDL12_YUVData; typedef struct { Uint32 hw_available :1; Uint32 wm_available :1; Uint32 UnusedBits1 :6; Uint32 UnusedBits2 :1; Uint32 blit_hw :1; Uint32 blit_hw_CC :1; Uint32 blit_hw_A :1; Uint32 blit_sw :1; Uint32 blit_sw_CC :1; Uint32 blit_sw_A :1; Uint32 blit_fill :1; Uint32 UnusedBits3 :16; Uint32 video_mem; SDL12_PixelFormat *vfmt; int current_w; int current_h; } SDL12_VideoInfo; #define SDL12_HWSURFACE 0x00000001 #define SDL12_ASYNCBLIT 0x00000004 #define SDL12_ANYFORMAT 0x10000000 #define SDL12_HWPALETTE 0x20000000 #define SDL12_DOUBLEBUF 0x40000000 #define SDL12_FULLSCREEN 0x80000000 #define SDL12_OPENGL 0x00000002 #define SDL12_OPENGLBLIT 0x0000000A #define SDL12_RESIZABLE 0x00000010 #define SDL12_NOFRAME 0x00000020 #define SDL12_HWACCEL 0x00000100 #define SDL12_SRCCOLORKEY 0x00001000 #define SDL12_RLEACCELOK 0x00002000 #define SDL12_RLEACCEL 0x00004000 #define SDL12_SRCALPHA 0x00010000 #define SDL12_PREALLOC 0x01000000 typedef enum { SDLK12_UNKNOWN = 0, SDLK12_FIRST = 0, SDLK12_BACKSPACE = 8, SDLK12_TAB = 9, SDLK12_CLEAR = 12, SDLK12_RETURN = 13, SDLK12_PAUSE = 19, SDLK12_ESCAPE = 27, SDLK12_SPACE = 32, SDLK12_EXCLAIM = 33, SDLK12_QUOTEDBL = 34, SDLK12_HASH = 35, SDLK12_DOLLAR = 36, SDLK12_AMPERSAND = 38, SDLK12_QUOTE = 39, SDLK12_LEFTPAREN = 40, SDLK12_RIGHTPAREN = 41, SDLK12_ASTERISK = 42, SDLK12_PLUS = 43, SDLK12_COMMA = 44, SDLK12_MINUS = 45, SDLK12_PERIOD = 46, SDLK12_SLASH = 47, SDLK12_0 = 48, SDLK12_1 = 49, SDLK12_2 = 50, SDLK12_3 = 51, SDLK12_4 = 52, SDLK12_5 = 53, SDLK12_6 = 54, SDLK12_7 = 55, SDLK12_8 = 56, SDLK12_9 = 57, SDLK12_COLON = 58, SDLK12_SEMICOLON = 59, SDLK12_LESS = 60, SDLK12_EQUALS = 61, SDLK12_GREATER = 62, SDLK12_QUESTION = 63, SDLK12_AT = 64, SDLK12_LEFTBRACKET = 91, SDLK12_BACKSLASH = 92, SDLK12_RIGHTBRACKET = 93, SDLK12_CARET = 94, SDLK12_UNDERSCORE = 95, SDLK12_BACKQUOTE = 96, SDLK12_a = 97, SDLK12_b = 98, SDLK12_c = 99, SDLK12_d = 100, SDLK12_e = 101, SDLK12_f = 102, SDLK12_g = 103, SDLK12_h = 104, SDLK12_i = 105, SDLK12_j = 106, SDLK12_k = 107, SDLK12_l = 108, SDLK12_m = 109, SDLK12_n = 110, SDLK12_o = 111, SDLK12_p = 112, SDLK12_q = 113, SDLK12_r = 114, SDLK12_s = 115, SDLK12_t = 116, SDLK12_u = 117, SDLK12_v = 118, SDLK12_w = 119, SDLK12_x = 120, SDLK12_y = 121, SDLK12_z = 122, SDLK12_DELETE = 127, SDLK12_WORLD_0 = 160, SDLK12_WORLD_1 = 161, SDLK12_WORLD_2 = 162, SDLK12_WORLD_3 = 163, SDLK12_WORLD_4 = 164, SDLK12_WORLD_5 = 165, SDLK12_WORLD_6 = 166, SDLK12_WORLD_7 = 167, SDLK12_WORLD_8 = 168, SDLK12_WORLD_9 = 169, SDLK12_WORLD_10 = 170, SDLK12_WORLD_11 = 171, SDLK12_WORLD_12 = 172, SDLK12_WORLD_13 = 173, SDLK12_WORLD_14 = 174, SDLK12_WORLD_15 = 175, SDLK12_WORLD_16 = 176, SDLK12_WORLD_17 = 177, SDLK12_WORLD_18 = 178, SDLK12_WORLD_19 = 179, SDLK12_WORLD_20 = 180, SDLK12_WORLD_21 = 181, SDLK12_WORLD_22 = 182, SDLK12_WORLD_23 = 183, SDLK12_WORLD_24 = 184, SDLK12_WORLD_25 = 185, SDLK12_WORLD_26 = 186, SDLK12_WORLD_27 = 187, SDLK12_WORLD_28 = 188, SDLK12_WORLD_29 = 189, SDLK12_WORLD_30 = 190, SDLK12_WORLD_31 = 191, SDLK12_WORLD_32 = 192, SDLK12_WORLD_33 = 193, SDLK12_WORLD_34 = 194, SDLK12_WORLD_35 = 195, SDLK12_WORLD_36 = 196, SDLK12_WORLD_37 = 197, SDLK12_WORLD_38 = 198, SDLK12_WORLD_39 = 199, SDLK12_WORLD_40 = 200, SDLK12_WORLD_41 = 201, SDLK12_WORLD_42 = 202, SDLK12_WORLD_43 = 203, SDLK12_WORLD_44 = 204, SDLK12_WORLD_45 = 205, SDLK12_WORLD_46 = 206, SDLK12_WORLD_47 = 207, SDLK12_WORLD_48 = 208, SDLK12_WORLD_49 = 209, SDLK12_WORLD_50 = 210, SDLK12_WORLD_51 = 211, SDLK12_WORLD_52 = 212, SDLK12_WORLD_53 = 213, SDLK12_WORLD_54 = 214, SDLK12_WORLD_55 = 215, SDLK12_WORLD_56 = 216, SDLK12_WORLD_57 = 217, SDLK12_WORLD_58 = 218, SDLK12_WORLD_59 = 219, SDLK12_WORLD_60 = 220, SDLK12_WORLD_61 = 221, SDLK12_WORLD_62 = 222, SDLK12_WORLD_63 = 223, SDLK12_WORLD_64 = 224, SDLK12_WORLD_65 = 225, SDLK12_WORLD_66 = 226, SDLK12_WORLD_67 = 227, SDLK12_WORLD_68 = 228, SDLK12_WORLD_69 = 229, SDLK12_WORLD_70 = 230, SDLK12_WORLD_71 = 231, SDLK12_WORLD_72 = 232, SDLK12_WORLD_73 = 233, SDLK12_WORLD_74 = 234, SDLK12_WORLD_75 = 235, SDLK12_WORLD_76 = 236, SDLK12_WORLD_77 = 237, SDLK12_WORLD_78 = 238, SDLK12_WORLD_79 = 239, SDLK12_WORLD_80 = 240, SDLK12_WORLD_81 = 241, SDLK12_WORLD_82 = 242, SDLK12_WORLD_83 = 243, SDLK12_WORLD_84 = 244, SDLK12_WORLD_85 = 245, SDLK12_WORLD_86 = 246, SDLK12_WORLD_87 = 247, SDLK12_WORLD_88 = 248, SDLK12_WORLD_89 = 249, SDLK12_WORLD_90 = 250, SDLK12_WORLD_91 = 251, SDLK12_WORLD_92 = 252, SDLK12_WORLD_93 = 253, SDLK12_WORLD_94 = 254, SDLK12_WORLD_95 = 255, SDLK12_KP0 = 256, SDLK12_KP1 = 257, SDLK12_KP2 = 258, SDLK12_KP3 = 259, SDLK12_KP4 = 260, SDLK12_KP5 = 261, SDLK12_KP6 = 262, SDLK12_KP7 = 263, SDLK12_KP8 = 264, SDLK12_KP9 = 265, SDLK12_KP_PERIOD = 266, SDLK12_KP_DIVIDE = 267, SDLK12_KP_MULTIPLY = 268, SDLK12_KP_MINUS = 269, SDLK12_KP_PLUS = 270, SDLK12_KP_ENTER = 271, SDLK12_KP_EQUALS = 272, SDLK12_UP = 273, SDLK12_DOWN = 274, SDLK12_RIGHT = 275, SDLK12_LEFT = 276, SDLK12_INSERT = 277, SDLK12_HOME = 278, SDLK12_END = 279, SDLK12_PAGEUP = 280, SDLK12_PAGEDOWN = 281, SDLK12_F1 = 282, SDLK12_F2 = 283, SDLK12_F3 = 284, SDLK12_F4 = 285, SDLK12_F5 = 286, SDLK12_F6 = 287, SDLK12_F7 = 288, SDLK12_F8 = 289, SDLK12_F9 = 290, SDLK12_F10 = 291, SDLK12_F11 = 292, SDLK12_F12 = 293, SDLK12_F13 = 294, SDLK12_F14 = 295, SDLK12_F15 = 296, SDLK12_NUMLOCK = 300, SDLK12_CAPSLOCK = 301, SDLK12_SCROLLOCK = 302, SDLK12_RSHIFT = 303, SDLK12_LSHIFT = 304, SDLK12_RCTRL = 305, SDLK12_LCTRL = 306, SDLK12_RALT = 307, SDLK12_LALT = 308, SDLK12_RMETA = 309, SDLK12_LMETA = 310, SDLK12_LSUPER = 311, SDLK12_RSUPER = 312, SDLK12_MODE = 313, SDLK12_COMPOSE = 314, SDLK12_HELP = 315, SDLK12_PRINT = 316, SDLK12_SYSREQ = 317, SDLK12_BREAK = 318, SDLK12_MENU = 319, SDLK12_POWER = 320, SDLK12_EURO = 321, SDLK12_UNDO = 322, SDLK12_LAST } SDL12Key; typedef enum { KMOD12_NONE = 0x0000, KMOD12_LSHIFT = 0x0001, KMOD12_RSHIFT = 0x0002, KMOD12_LCTRL = 0x0040, KMOD12_RCTRL = 0x0080, KMOD12_LALT = 0x0100, KMOD12_RALT = 0x0200, KMOD12_LMETA = 0x0400, KMOD12_RMETA = 0x0800, KMOD12_NUM = 0x1000, KMOD12_CAPS = 0x2000, KMOD12_MODE = 0x4000, KMOD12_RESERVED = 0x8000 } SDL12Mod; typedef struct SDL12_keysym { Uint8 scancode; SDL12Key sym; unsigned int mod; /* SDL12Mod */ Uint16 unicode; } SDL12_keysym; #define SDL12_RELEASED 0 #define SDL12_PRESSED 1 #if defined(SDL_VIDEO_DRIVER_X11) /* SDL_VIDEO_DRIVER_X11 refers to the SDL2 headers. */ typedef enum /* this is only used for 1.2 X11 syswm */ { SDL12_SYSWM_X11 } SDL12_SYSWM_TYPE; #endif typedef struct SDL12_SysWMmsg { SDL_version version; #if defined(_WIN32) HWND hwnd; UINT msg; WPARAM wParam; LPARAM lParam; #elif defined(SDL_VIDEO_DRIVER_X11) SDL12_SYSWM_TYPE subsystem; union { XEvent xevent; } event; #else int data; /* unused at the moment. */ #endif } SDL12_SysWMmsg; typedef struct SDL12_SysWMinfo { SDL_version version; #if defined(_WIN32) HWND window; HGLRC hglrc; #elif defined(SDL_VIDEO_DRIVER_X11) SDL12_SYSWM_TYPE subsystem; union { struct { Display *display; Window window; void (*lock_func)(void); void (*unlock_func)(void); Window fswindow; Window wmwindow; Display *gfxdisplay; } x11; } info; #else int data; /* unused at the moment. */ #endif } SDL12_SysWMinfo; typedef enum { SDL12_NOEVENT = 0, SDL12_ACTIVEEVENT, SDL12_KEYDOWN, SDL12_KEYUP, SDL12_MOUSEMOTION, SDL12_MOUSEBUTTONDOWN, SDL12_MOUSEBUTTONUP, SDL12_JOYAXISMOTION, SDL12_JOYBALLMOTION, SDL12_JOYHATMOTION, SDL12_JOYBUTTONDOWN, SDL12_JOYBUTTONUP, SDL12_QUIT, SDL12_SYSWMEVENT, SDL12_EVENT_RESERVEDA, SDL12_EVENT_RESERVEDB, SDL12_VIDEORESIZE, SDL12_VIDEOEXPOSE, SDL12_USEREVENT = 24, SDL12_NUMEVENTS = 32 } SDL12_EventType; #define SDL12_APPMOUSEFOCUS (1<<0) #define SDL12_APPINPUTFOCUS (1<<1) #define SDL12_APPACTIVE (1<<2) typedef struct { Uint8 type; Uint8 gain; Uint8 state; } SDL12_ActiveEvent; typedef struct { Uint8 type; Uint8 which; Uint8 state; SDL12_keysym keysym; } SDL12_KeyboardEvent; typedef struct { Uint8 type; Uint8 which; Uint8 state; Uint16 x, y; Sint16 xrel; Sint16 yrel; } SDL12_MouseMotionEvent; typedef struct { Uint8 type; Uint8 which; Uint8 button; Uint8 state; Uint16 x, y; } SDL12_MouseButtonEvent; typedef struct { Uint8 type; Uint8 which; Uint8 axis; Sint16 value; } SDL12_JoyAxisEvent; typedef struct { Uint8 type; Uint8 which; Uint8 ball; Sint16 xrel; Sint16 yrel; } SDL12_JoyBallEvent; typedef struct { Uint8 type; Uint8 which; Uint8 hat; Uint8 value; } SDL12_JoyHatEvent; typedef struct { Uint8 type; Uint8 which; Uint8 button; Uint8 state; } SDL12_JoyButtonEvent; typedef struct { Uint8 type; int w; int h; } SDL12_ResizeEvent; typedef struct { Uint8 type; } SDL12_ExposeEvent; typedef struct { Uint8 type; } SDL12_QuitEvent; typedef struct { Uint8 type; int code; void *data1; void *data2; } SDL12_UserEvent; typedef struct { Uint8 type; SDL12_SysWMmsg *msg; } SDL12_SysWMEvent; typedef union { Uint8 type; SDL12_ActiveEvent active; SDL12_KeyboardEvent key; SDL12_MouseMotionEvent motion; SDL12_MouseButtonEvent button; SDL12_JoyAxisEvent jaxis; SDL12_JoyBallEvent jball; SDL12_JoyHatEvent jhat; SDL12_JoyButtonEvent jbutton; SDL12_ResizeEvent resize; SDL12_ExposeEvent expose; SDL12_QuitEvent quit; SDL12_UserEvent user; SDL12_SysWMEvent syswm; } SDL12_Event; typedef int (SDLCALL *SDL12_EventFilter)(const SDL12_Event *event12); static int SDLCALL EventFilter20to12(void *data, SDL_Event *event20); typedef Uint32 (SDLCALL *SDL12_TimerCallback)(Uint32 interval); typedef SDL_TimerCallback SDL12_NewTimerCallback; typedef struct { SDL12_Rect area; Sint16 hot_x; Sint16 hot_y; Uint8 *data; Uint8 *mask; Uint8 *save[2]; SDL_Cursor *wm_cursor; /* the real SDL 1.2 has an opaque pointer to a platform-specific cursor here. */ } SDL12_Cursor; typedef enum { SDL12_GRAB_QUERY = -1, SDL12_GRAB_OFF = 0, SDL12_GRAB_ON = 1 } SDL12_GrabMode; typedef enum { SDL12_GL_RED_SIZE, SDL12_GL_GREEN_SIZE, SDL12_GL_BLUE_SIZE, SDL12_GL_ALPHA_SIZE, SDL12_GL_BUFFER_SIZE, SDL12_GL_DOUBLEBUFFER, SDL12_GL_DEPTH_SIZE, SDL12_GL_STENCIL_SIZE, SDL12_GL_ACCUM_RED_SIZE, SDL12_GL_ACCUM_GREEN_SIZE, SDL12_GL_ACCUM_BLUE_SIZE, SDL12_GL_ACCUM_ALPHA_SIZE, SDL12_GL_STEREO, SDL12_GL_MULTISAMPLEBUFFERS, SDL12_GL_MULTISAMPLESAMPLES, SDL12_GL_ACCELERATED_VISUAL, SDL12_GL_SWAP_CONTROL, SDL12_GL_MAX_ATTRIBUTE } SDL12_GLattr; typedef enum { SDL12_CD_TRAYEMPTY, SDL12_CD_STOPPED, SDL12_CD_PLAYING, SDL12_CD_PAUSED, SDL12_CD_ERROR = -1 } SDL12_CDstatus; typedef struct { Uint8 id; Uint8 type; Uint16 unused; Uint32 length; Uint32 offset; } SDL12_CDtrack; typedef struct { int id; SDL12_CDstatus status; int numtracks; int cur_track; int cur_frame; SDL12_CDtrack track[100]; /* in 1.2, this was SDL_MAX_TRACKS+1 */ } SDL12_CD; typedef struct { Uint32 format; int nummodes; SDL12_Rect *modeslist12; SDL12_Rect **modes12; /* ptrs to each item in modeslist, for SDL_ListModes() */ } VideoModeList; typedef struct { char *name; SDL_atomic_t refcount; SDL_JoystickID instance_id; union { SDL_Joystick *joystick; SDL_GameController *controller; } dev; } SDL12_Joystick; struct SDL12_AudioCVT; typedef void (SDLCALL *SDL12_AudioCVTFilter)(struct SDL12_AudioCVT *cvt, Uint16 format); /* this is identical to SDL2, except SDL2 forced the structure packing in some instances, so we can't passthrough without converting the struct. :( */ typedef struct SDL12_AudioCVT { int needed; Uint16 src_format; Uint16 dst_format; double rate_incr; Uint8 *buf; int len; int len_cvt; int len_mult; double len_ratio; SDL12_AudioCVTFilter filters[10]; int filter_index; } SDL12_AudioCVT; #include "SDL_opengl.h" #include "SDL_opengl_glext.h" #define OPENGL_SYM(ext,rc,fn,params,args,ret) typedef rc (GLAPIENTRY *openglfn_##fn##_t) params; #include "SDL20_syms.h" typedef struct OpenGLEntryPoints { SDL_bool SUPPORTS_Core; #define OPENGL_EXT(name) SDL_bool SUPPORTS_##name; #include "SDL20_syms.h" #define OPENGL_SYM(ext,rc,fn,params,args,ret) openglfn_##fn##_t fn; #include "SDL20_syms.h" } OpenGLEntryPoints; typedef struct QueuedOverlayItem { SDL12_Overlay *overlay12; SDL12_Rect dstrect12; struct QueuedOverlayItem *next; } QueuedOverlayItem; typedef struct SDL12_TimerID_Data { SDL_TimerID timer_id; SDL12_NewTimerCallback callback; void *param; struct SDL12_TimerID_Data *next; struct SDL12_TimerID_Data *prev; } SDL12_TimerID_Data; /* This changed from an opaque pointer to an int in 2.0. */ typedef SDL12_TimerID_Data *SDL12_TimerID; #define SDL12_MAXEVENTS 128 typedef struct EventQueueType { SDL12_SysWMmsg syswm_msg; /* save space for a copy of this in case we use it. */ SDL12_Event event12; struct EventQueueType *next; } EventQueueType; static Uint32 InitializedSubsystems20 = 0; static Uint32 LinkedSDL2VersionInt = 0; static SDL_bool IsDummyVideo = SDL_FALSE; static VideoModeList *VideoModes = NULL; static int VideoModesCount = 0; /* this counts items in VideoModeList, not total video modes. */ static SDL12_VideoInfo VideoInfo12; static SDL12_Palette VideoInfoPalette12; static SDL12_PixelFormat VideoInfoVfmt12; static SDL_PixelFormat *VideoInfoVfmt20 = NULL; static SDL_bool VideoWindowGrabWanted = SDL_FALSE; static SDL_bool VideoWindowGrabbed = SDL_FALSE; static SDL_bool VideoCursorHidden = SDL_FALSE; static SDL_bool SetVideoModeInProgress = SDL_FALSE; static SDL_Window *VideoWindow20 = NULL; static SDL_Renderer *VideoRenderer20 = NULL; static SDL_mutex *VideoRendererLock = NULL; static SDL_Texture *VideoTexture20 = NULL; static SDL12_Surface VideoSurface12Location; static SDL12_Surface *VideoSurface12 = NULL; static SDL_Palette *VideoPhysicalPalette20 = NULL; static Uint32 VideoSurfacePresentTicks = 0; static Uint32 VideoSurfaceLastPresentTicks = 0; static SDL_Surface *VideoConvertSurface20 = NULL; static SDL_GLContext VideoGLContext20 = NULL; static QueuedOverlayItem QueuedDisplayOverlays; /* the head node */ static QueuedOverlayItem *QueuedDisplayOverlaysTail = &QueuedDisplayOverlays; static char *WindowTitle = NULL; static char *WindowIconTitle = NULL; static SDL_Surface *VideoIcon20 = NULL; static int EnabledUnicode = 0; static Uint32 KeyRepeatNextTicks = 0; static Uint32 KeyRepeatDelay = 0; static Uint32 KeyRepeatInterval = 0; static SDL12_Event KeyRepeatEvent; /* Windows SDL1.2 never uses translated keyboard layouts for compatibility with DirectInput, which didn't support them. Other platforms (MacOS, Linux) seem to, but with varying levels of bugginess. So default to Translated Layouts on all non-Windows platforms (but have an option to change this, as many apps are buggy with non-US layouts, or provide their own keyboard layout translation, such as DOSBox. */ #if !defined(_WIN32) static SDL_bool TranslateKeyboardLayout = SDL_TRUE; #else static SDL_bool TranslateKeyboardLayout = SDL_FALSE; #endif static int VideoDisplayIndex = 0; static SDL_bool SupportSysWM = SDL_FALSE; static SDL_bool EventThreadEnabled = SDL_FALSE; static SDL_bool CDRomInit = SDL_FALSE; static char *CDRomPath = NULL; static SDL12_CD *CDRomDevice = NULL; static SDL12_EventFilter EventFilter12 = NULL; static SDL12_Cursor *CurrentCursor12 = NULL; static Uint8 EventStates[SDL12_NUMEVENTS]; static int SwapInterval = 0; static float OpenGLBuffersSwapTickInterval = 0.f; static Uint32 OpenGLBuffersLastSwapTicks = 0; static SDL_bool JoysticksAreGameControllers = SDL_FALSE; static SDL12_Joystick *JoystickList = NULL; static int NumJoysticks = 0; static Uint8 KeyState[SDLK12_LAST]; static SDL_bool MouseInputIsRelative = SDL_FALSE; static SDL_Point MousePosition = { 0, 0 }; static struct { /* SDL_FPoint */ float x, y; } MouseRelativeRemainder = { 0.f, 0.f }; static SDL_bool UseMouseRelativeScaling = SDL_FALSE; static OpenGLEntryPoints OpenGLFuncs; static int OpenGLBlitLockCount = 0; static GLuint OpenGLBlitTexture = 0; static SDL_bool WantDebugLogging = SDL_FALSE; static SDL_bool WantScaleMethodNearest = SDL_FALSE; static SDL_bool WantOpenGLScaling = SDL_FALSE; static int OpenGLLogicalScalingWidth = 0; static int OpenGLLogicalScalingHeight = 0; static GLuint OpenGLLogicalScalingFBO = 0; static GLuint OpenGLLogicalScalingColor = 0; static GLuint OpenGLLogicalScalingDepth = 0; static int OpenGLLogicalScalingSamples = 0; static GLuint OpenGLLogicalScalingMultisampleFBO = 0; static GLuint OpenGLLogicalScalingMultisampleColor = 0; static GLuint OpenGLLogicalScalingMultisampleDepth = 0; static GLuint OpenGLCurrentReadFBO = 0; static GLuint OpenGLCurrentDrawFBO = 0; static SDL_bool ForceGLSwapBufferContext = SDL_FALSE; static SDL12_TimerID AddedTimers = NULL; /* we'll protect this with EventQueueMutex for laziness/convenience. */ static SDL_mutex *EventQueueMutex = NULL; static EventQueueType EventQueuePool[SDL12_MAXEVENTS]; static EventQueueType *EventQueueHead = NULL; static EventQueueType *EventQueueTail = NULL; static EventQueueType *EventQueueAvailable = NULL; static unsigned long SetVideoModeThread = 0; static SDL_bool VideoSurfaceUpdatedInBackgroundThread = SDL_FALSE; static SDL_bool AllowThreadedDraws = SDL_FALSE; static SDL_bool AllowThreadedPumps = SDL_FALSE; static SDL_bool WantCompatibilityAudioCVT = SDL_FALSE; static SDL_bool PreserveDestinationAlpha = SDL_TRUE; static int DesiredRefreshRate = SDL12_REFRESH_DEFAULT; static int CurrentRefreshRate = SDL12_REFRESH_DEFAULT; static int ProcessingModalLoop; static SDL_bool HasPendingResizeEvent; static SDL12_Event PendingResizeEvent; /* This is a KEYDOWN event which is being held for a follow-up TEXTINPUT */ static SDL12_Event PendingKeydownEvent; /* SDL_atoi() before SDL2-2.0.17 is non-compliant */ static SDL_INLINE int SDLCALL SDL20_atoi(const char *str) { return SDL20_strtol(str, NULL, 10); } #ifdef __linux__ /* you can use SDL20_atoi once we're past startup. */ static int SDL12COMPAT_atoi(const char *str) { int retval = 0; int multiplier = 1; int signmult = 1; const char *ptr; while (*str == ' ') { str++; } if (*str == '-') { signmult = -1; str++; while (*str == ' ') { str++; } } ptr = str; while (SDL_TRUE) { if ((*ptr < '0') || (*ptr > '9')) { break; } ptr++; } ptr--; while (ptr != str) { retval += ((int) (*ptr - '0')) * multiplier; multiplier *= 10; ptr--; } return (retval + (((int) (*ptr - '0')) * multiplier)) * signmult; } #endif /* __linux__ */ static char * SDL12COMPAT_stpcpy(char *dst, const char *src) { while ((*dst++ = *src++) != '\0') { /**/; } return --dst; } static void SDL12COMPAT_itoa(char *dst, int val) { char *ptr, temp; if (val < 0) { *dst++ = '-'; val = -val; } ptr = dst; do { *ptr++ = '0' + (val % 10); val /= 10; } while (val > 0); *ptr-- = '\0'; /* correct the order of digits */ do { temp = *dst; *dst++ = *ptr; *ptr-- = temp; } while (ptr > dst); } /* you can use SDL20_strlen once we're past startup. */ static int SDL12COMPAT_strlen(const char *str) { volatile int retval = 0; /* volatile prevents gcc from optimizing this into strlen() */ while (str[retval]) { retval++; } return retval; } /* you can use SDL20_strcmp once we're past startup. */ static SDL_bool SDL12COMPAT_strequal(const char *a, const char *b) { for ( ;; ) { const char cha = *a; if (cha != *b) { return SDL_FALSE; } if (!cha) { break; } a++; b++; } return SDL_TRUE; } /* SDL3 (and thus sdl2-compat) will build an SDL_Environment, which isn't useful if the SDL-1.2 app is calling getenv()/setenv() directly, so use system APIs instead. */ /* despite the "unsafe" name (they are NOT thread-safe), these are actually _safe_ to call at startup, since it won't call into SDL2 before everything is properly initialized! */ static char *SDL12COMPAT_getenv_unsafe(const char *name) { #ifdef _WIN32 static char buf[256]; /* overflows will just report as environment variable being unset. But most of our environment vars don't come through here. */ const DWORD rc = GetEnvironmentVariableA(name, buf, (DWORD) sizeof (buf)); return ((rc != 0) && (rc < sizeof (buf))) ? buf : NULL; #else /* we might need other platforms, or a simple `return NULL;` for platforms without an environment table. */ return getenv(name); #endif } static void SDL12COMPAT_setenv_unsafe(const char *name, const char *value) { #ifdef _WIN32 SetEnvironmentVariableA(name, value); #elif defined (__WATCOMC__) setenv(name, value, 1); /* OW19 has no unsetenv(). NULL newvalue passed to setenv() behaves as unsetenv(). */ #else /* we might need other platforms, or a simple `return;` for platforms without an environment table. */ if (value) { setenv(name, value, 1); } else { unsetenv(name); } #endif } static const char *SDL12COMPAT_GetEnvAtStartup(const char *name) { return SDL12COMPAT_getenv_unsafe(name); /* don't talk to SDL2 yet, we aren't set up. Go right to the OS interfaces. */ } static void SDL12COMPAT_SetEnvAtStartup(const char *name, const char *value) { SDL12COMPAT_setenv_unsafe(name, value); /* don't talk to SDL2 yet, we aren't set up. Go right to the OS interfaces. */ } /* log a string using platform-specific code for before SDL2 is fully available. */ static void SDL12COMPAT_LogAtStartup(const char *str) { #ifdef _WIN32 OutputDebugStringA(str); #elif defined(__APPLE__) extern void SDL12COMPAT_NSLog(const char *prefix, const char *text); SDL12COMPAT_NSLog(NULL, str); #else fputs(str, stderr); fputs("\n", stderr); #endif } /* this can't call into SDL20_getenv because things aren't set up yet, so try for platform-specific getenv checks. */ static SDL_bool SDL12COMPAT_CheckDebugLogging(void) { const char *value = SDL12COMPAT_GetEnvAtStartup("SDL12COMPAT_DEBUG_LOGGING"); if (!value) { value = SDL12COMPAT_GetEnvAtStartup("DEBUG_INVOCATION"); } return (value && SDL12COMPAT_strequal(value, "1")) ? SDL_TRUE : SDL_FALSE; } /* Obviously we can't use SDL_LoadObject() to load SDL2. :) */ static char loaderror[256]; #if defined(_WIN32) #define DIRSEP "\\" #define SDL20_LIBNAME "SDL2.dll" /* require SDL2 >= 2.0.12 for SDL_CreateThread binary compatibility */ #define SDL20_REQUIRED_VER SDL_VERSIONNUM(2,0,12) static HMODULE Loaded_SDL20 = NULL; #define LoadSDL20Library() ((Loaded_SDL20 = LoadLibraryA(SDL20_LIBNAME)) != NULL) #define LookupSDL20Sym(sym) (void *)GetProcAddress(Loaded_SDL20, sym) #define CloseSDL20Library() { if (Loaded_SDL20) { FreeLibrary(Loaded_SDL20); Loaded_SDL20 = NULL; } } #elif defined(__OS2__) #include #define DIRSEP "\\" #define SDL20_LIBNAME "SDL2.dll" #define SDL20_LIBNAME2 "SDL2" /* if loading from LIBPATH */ #define SDL20_REQUIRED_VER SDL_VERSIONNUM(2,0,7) static HMODULE Loaded_SDL20 = NULLHANDLE; static SDL_bool LoadSDL20Library(void) { char err[256]; if (DosLoadModule(err, sizeof(err), SDL20_LIBNAME, &Loaded_SDL20) != 0) { if (DosLoadModule(err, sizeof(err), SDL20_LIBNAME2, &Loaded_SDL20) != 0) { return SDL_FALSE; } } return SDL_TRUE; } static void *LookupSDL20Sym (const char *symname) { PFN fp; if (DosQueryProcAddr(Loaded_SDL20, 0, symname, &fp) != 0) return NULL; return (void *)fp; } static void CloseSDL20Library(void) { if (Loaded_SDL20 != NULLHANDLE) { DosFreeModule(Loaded_SDL20); Loaded_SDL20 = NULLHANDLE; } } #elif defined(__APPLE__) #include #include #include #define SDL20_LIBNAME "libSDL2-2.0.0.dylib" /* SDL2 cmake'ry is (was?) messy: */ #define SDL20_LIBNAME2 "libSDL2-2.0.dylib" #define SDL20_FRAMEWORK "SDL2.framework/Versions/A/SDL2" #define SDL20_REQUIRED_VER SDL_VERSIONNUM(2,0,7) static void *Loaded_SDL20 = NULL; #define LookupSDL20Sym(sym) dlsym(Loaded_SDL20, sym) #define CloseSDL20Library() { if (Loaded_SDL20) { dlclose(Loaded_SDL20); Loaded_SDL20 = NULL; } } static SDL_bool LoadSDL20Library(void) { /* I don't know if this is the _right_ order to try, but this seems reasonable */ static const char * const dylib_locations[] = { "@loader_path/" SDL20_LIBNAME, /* MyApp.app/Contents/MacOS/libSDL2-2.0.0.dylib */ "@loader_path/" SDL20_LIBNAME2, /* MyApp.app/Contents/MacOS/libSDL2-2.0.dylib */ "@loader_path/../Frameworks/" SDL20_FRAMEWORK, /* MyApp.app/Contents/Frameworks/SDL2.framework */ "@executable_path/" SDL20_LIBNAME, /* MyApp.app/Contents/MacOS/libSDL2-2.0.0.dylib */ "@executable_path/" SDL20_LIBNAME2, /* MyApp.app/Contents/MacOS/libSDL2-2.0.dylib */ "@executable_path/../Frameworks/" SDL20_FRAMEWORK, /* MyApp.app/Contents/Frameworks/SDL2.framework */ NULL, /* /Users/username/Library/Frameworks/SDL2.framework */ "/Library/Frameworks" SDL20_FRAMEWORK, /* /Library/Frameworks/SDL2.framework */ SDL20_LIBNAME, /* oh well, anywhere the system can see the .dylib (/usr/local/lib or whatever) */ SDL20_LIBNAME2 }; int i; for (i = 0; i < (int) SDL_arraysize(dylib_locations); i++) { const char *location = dylib_locations[i]; if (location) { Loaded_SDL20 = dlopen(location, RTLD_LOCAL|RTLD_NOW); } else { /* hack to mean "try homedir" */ const char *homedir = NULL; struct passwd *pwent = getpwuid(getuid()); if (pwent) { homedir = pwent->pw_dir; } if (!homedir) { homedir = SDL12COMPAT_getenv_unsafe("HOME"); } if (homedir) { char framework[512]; const int rc = snprintf(framework, sizeof (framework), "%s/Library/Frameworks/" SDL20_FRAMEWORK, homedir); if ((rc > 0) && (rc < (int) sizeof(framework))) { Loaded_SDL20 = dlopen(framework, RTLD_LOCAL|RTLD_NOW); } } } if (Loaded_SDL20) { return SDL_TRUE; } } return SDL_FALSE; /* didn't find it anywhere reasonable. :( */ } #elif defined(__unix__) #include #define SDL20_LIBNAME "libSDL2-2.0.so.0" #define SDL20_REQUIRED_VER SDL_VERSIONNUM(2,0,7) static void *Loaded_SDL20 = NULL; #define LoadSDL20Library() ((Loaded_SDL20 = dlopen(SDL20_LIBNAME, RTLD_LOCAL|RTLD_NOW)) != NULL) #define LookupSDL20Sym(sym) dlsym(Loaded_SDL20, sym) #define CloseSDL20Library() { if (Loaded_SDL20) { dlclose(Loaded_SDL20); Loaded_SDL20 = NULL; } } #else #error Please define your platform. #endif #ifndef DIRSEP #define DIRSEP "/" #endif static void * LoadSDL20Symbol(const char *fn, int *okay) { void *retval = NULL; if (*okay) { /* only bother trying if we haven't previously failed. */ retval = LookupSDL20Sym(fn); if (retval == NULL) { char *p = SDL12COMPAT_stpcpy(loaderror, fn); SDL12COMPAT_stpcpy(p, " missing in SDL2 library."); *okay = 0; } } return retval; } static void UnloadSDL20(void) { #define SDL20_SYM(rc,fn,params,args,ret) SDL20_##fn = NULL; #include "SDL20_syms.h" CloseSDL20Library(); } typedef struct QuirkEntryType { const char *exe_name; const char *hint_name; const char *hint_value; } QuirkEntryType; static QuirkEntryType quirks[] = { #if defined(__unix__) /* freedroid use RLE-encoded surfaces, where SDL-1.2 didn't preserve destination alpha. This works around an sdl12-compat incompatibility. */ {"freedroid", "SDL12COMPAT_PRESERVE_DEST_ALPHA", "0"}, /* Awesomenauts uses Cg, and does weird things with the GL context. */ {"Awesomenauts.bin.x86", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"Awesomenauts.bin.x86", "SDL12COMPAT_FORCE_GL_SWAPBUFFER_CONTEXT", "1"}, /* Braid uses Cg, which uses glXGetProcAddress(). */ {"braid", "SDL12COMPAT_OPENGL_SCALING", "0"}, /* Closure uses Cg, and doesn't render anything with OpenGL scaling. */ {"Closure.bin.x86", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"Closure.bin.x86_64", "SDL12COMPAT_OPENGL_SCALING", "0"}, /* GOG's DOSBox builds have architecture-specific filenames. */ {"dosbox", "SDL12COMPAT_USE_KEYBOARD_LAYOUT", "0"}, {"dosbox_i686", "SDL12COMPAT_USE_KEYBOARD_LAYOUT", "0"}, {"dosbox_x86_64", "SDL12COMPAT_USE_KEYBOARD_LAYOUT", "0"}, /* Cave Story's original doukutsu.bin misuses audio. */ /* The later doukutsu_32bits and doukutsu_64bits work fine, however. */ {"doukutsu.bin", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, /* Tucnak's 1.2 target wants to render and run its event loop from background threads, which upsets OpenGL. Force software renderer and x11. If you want Wayland, etc, use tuknak's existing SDL2 target. */ {"tucnak", "SDL_VIDEODRIVER", "x11"}, {"tucnak", "SDL_RENDER_DRIVER", "software"}, {"tucnak", "SDL_FRAMEBUFFER_ACCELERATION", "false"}, /* looks for X11 display and does unnecessary X11 things. Causes problems with SDL2/x11. */ /* also has some issue with audio conversion I didn't look more closely at. */ {"fillets", "SDL12COMPAT_ALLOW_SYSWM", "0"}, {"fillets", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, /* Hyperspace Delivery Boy relies on the exact imprecision of the format conversion in some earlier versions of SDL 1.2. It also recommends 16-bit in the README, so force it. */ {"hdb", "SDL12COMPAT_MAX_BPP", "16"}, /* Mark of the Ninja doesn't work with OpenGL scaling */ {"ninja-bin32", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"ninja-bin64", "SDL12COMPAT_OPENGL_SCALING", "0"}, /* Misuses SDL_AudioCVT */ {"pink-pony", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, {"pink-pony.bin", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, /* doesn't render with GL scaling enabled */ {"scorched3d", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"scorched3dc", "SDL12COMPAT_OPENGL_SCALING", "0"}, /* Trine (the old Humble Bundle version from 2011) doesn't render in-game with GL scaling enabled. */ {"trine-bin32", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"trine-bin64", "SDL12COMPAT_OPENGL_SCALING", "0"}, /* Trine (the old Humble Bundle version from 2011)'s launcher needs X11, and needs XInitThreads _before_ GTK+ gets in there. */ {"trine-launcher32", "SDL_VIDEODRIVER", "x11"}, {"trine-launcher32", "SDL12COMPAT_FORCE_XINITTHREADS", "1"}, {"trine-launcher64", "SDL_VIDEODRIVER", "x11"}, {"trine-launcher64", "SDL12COMPAT_FORCE_XINITTHREADS", "1"}, /* boswars has a bug where SDL_AudioCVT must not require extra buffer space. See Issue #232. */ {"boswars", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, /* Loki HOMM3 */ {"heroes3.dynamic", "SDL12COMPAT_COMPATIBILITY_AUDIOCVT", "1"}, /* grafx2 tries to do all sorts of stuff by talking directly to the X server, causing problems. */ {"grafx2", "SDL12COMPAT_ALLOW_SYSWM", "0"}, /* The 32-bit Steam build only of Multiwinia Quits but doesn't re-Init */ {"multiwinia.bin.x86", "SDL12COMPAT_NO_QUIT_VIDEO", "1"}, /* SimCity 3000 tries to call SDL_DestroyMutex after we have been unloaded */ {"sc3u.dynamic", "SDL12COMPAT_NO_UNLOAD", "1"}, /* Loki Soldier of Fortune - Sliding/ice-skating when moving if framerate is too high */ {"sof-bin", "SDL12COMPAT_SYNC_TO_VBLANK", "1"}, {"sof-bin", "SDL12COMPAT_MAX_FPS", "120"}, /* Loki Unreal Tournament '99 runs at hyperspeed if the framerate is too high. Force it to vsync. You should use the newer OldUnreal binaries with SDL2 instead! */ {"ut-bin", "SDL12COMPAT_SYNC_TO_VBLANK", "1"}, {"ut-bin", "SDL12COMPAT_MAX_FPS", "120"}, /* Jamestown (the old Humble Bundle version from 2011) doesn't render in-game with GL scaling enabled. */ {"Jamestown-x86", "SDL12COMPAT_OPENGL_SCALING", "0"}, {"Jamestown-amd64", "SDL12COMPAT_OPENGL_SCALING", "0"}, #else /* TODO: Add any quirks needed for this system. */ /* A dummy entry to keep compilers happy. */ {"", "", "0"} #endif }; #ifdef __linux__ static void OS_GetExeName(char *buf, const unsigned maxpath) { int ret; buf[0] = '\0'; ret = readlink("/proc/self/exe", buf, maxpath); (void)ret; } #elif defined(_WIN32) static void OS_GetExeName(char *buf, const unsigned maxpath) { buf[0] = '\0'; GetModuleFileNameA(NULL, buf, maxpath); } #elif defined(__OS2__) static void OS_GetExeName(char *buf, const unsigned maxpath) { PPIB pib; DosGetInfoBlocks(NULL, &pib); buf[0] = '\0'; DosQueryModuleName(pib->pib_hmte, maxpath, buf); } #elif defined(__APPLE__) || defined(__FREEBSD__) static void OS_GetExeName(char *buf, const unsigned maxpath) { const char *progname = getprogname(); if (progname != NULL) { strlcpy(buf, progname, maxpath); } else { buf[0] = '\0'; } } #else #warning Please implement this for your platform. static void OS_GetExeName(char *buf, const unsigned maxpath) { buf[0] = '\0'; (void)maxpath; } #endif static const char * SDL12Compat_GetExeName(void) { static const char *exename = NULL; if (exename == NULL) { static char path_buf[SDL12_MAXPATH]; static char *base_path; OS_GetExeName(path_buf, SDL12_MAXPATH); base_path = SDL20_strrchr(path_buf, *DIRSEP); if (base_path) { /* We have a '\\' component. */ exename = base_path + 1; } else { /* No slashes, return the whole module filanem. */ exename = path_buf; } } return exename; } static const char * SDL12Compat_GetHint(const char *name) { return SDL12COMPAT_getenv_unsafe(name); } static SDL_bool SDL12Compat_GetHintBoolean(const char *name, SDL_bool default_value) { const char *val = SDL12Compat_GetHint(name); if (!val) { return default_value; } return (SDL20_atoi(val) != 0) ? SDL_TRUE : SDL_FALSE; } static float SDL12Compat_GetHintFloat(const char *name, float default_value) { const char *val = SDL12Compat_GetHint(name); if (!val) { return default_value; } return (float) SDL20_atof(val); } static int SDL12Compat_GetHintInt(const char *name, int default_value) { const char *val = SDL12Compat_GetHint(name); if (!val) { return default_value; } return SDL20_atoi(val); } /* DO NOT USE SDL2 FUNCTIONS IN HERE! */ static void SDL12Compat_ApplyQuirks(SDL_bool force_x11) { const char *exe_name = SDL12Compat_GetExeName(); int i; if (WantDebugLogging) { const char *lead = "sdl12-compat: This app appears to be named:"; char msg[256]; if ((SDL12COMPAT_strlen(lead) + SDL12COMPAT_strlen(exe_name) + 2) <= (int) (sizeof (msg))) { char *p = msg; p = SDL12COMPAT_stpcpy(p, lead); p = SDL12COMPAT_stpcpy(p, " "); p = SDL12COMPAT_stpcpy(p, exe_name); SDL12COMPAT_LogAtStartup(msg); } else { SDL12COMPAT_LogAtStartup(lead); SDL12COMPAT_LogAtStartup(exe_name); } } #ifdef __linux__ if (force_x11) { const char *videodriver_env = SDL12COMPAT_GetEnvAtStartup("SDL_VIDEODRIVER"); if (videodriver_env && !SDL12COMPAT_strequal(videodriver_env, "x11")) { if (WantDebugLogging) { SDL12COMPAT_LogAtStartup("sdl12-compat: This app looks like it requires X11, but the SDL_VIDEODRIVER environment variable is currently set to:"); SDL12COMPAT_LogAtStartup(""); SDL12COMPAT_LogAtStartup(videodriver_env); SDL12COMPAT_LogAtStartup(""); SDL12COMPAT_LogAtStartup("If you have issues, try setting SDL_VIDEODRIVER=x11"); } } else { if (WantDebugLogging) { SDL12COMPAT_LogAtStartup("sdl12-compat: We are forcing this app to use X11, because it probably talks to an X server directly, outside of SDL. If possible, this app should be fixed, to be compatible with Wayland, etc."); } SDL12COMPAT_SetEnvAtStartup("SDL_VIDEODRIVER", "x11"); } } #else (void)force_x11; #endif if (*exe_name == '\0') { return; } for (i = 0; i < (int) SDL_arraysize(quirks); i++) { if (SDL12COMPAT_strequal(exe_name, quirks[i].exe_name)) { const char *var = SDL12COMPAT_GetEnvAtStartup(quirks[i].hint_name); if (!var) { if (WantDebugLogging) { char msg[256]; char *p = msg; p = SDL12COMPAT_stpcpy(p, "sdl12-compat: Applying compatibility quirk "); p = SDL12COMPAT_stpcpy(p, quirks[i].hint_name); p = SDL12COMPAT_stpcpy(p, "=\""); p = SDL12COMPAT_stpcpy(p, quirks[i].hint_value); p = SDL12COMPAT_stpcpy(p, "\"."); SDL12COMPAT_LogAtStartup(msg); } SDL12COMPAT_SetEnvAtStartup(quirks[i].hint_name, quirks[i].hint_value); } else { if (WantDebugLogging) { char msg[256]; char varbuf[32]; char *p = msg; int j; /* copy the start of untrusted string var to a small array to prevent buffer overflows */ for (j = 0; j < ((int) SDL_arraysize(varbuf)); j++) { varbuf[j] = var[j]; if (var[j] == 0) { break; } } if (j == SDL_arraysize(varbuf)) { /* truncate and terminate the string if necessary. */ SDL12COMPAT_stpcpy(varbuf + (SDL_arraysize(varbuf) - 6), "[...]"); } p = SDL12COMPAT_stpcpy(p, "sdl12-compat: Not applying compatibility quirk "); p = SDL12COMPAT_stpcpy(p, quirks[i].hint_name); p = SDL12COMPAT_stpcpy(p, "=\""); p = SDL12COMPAT_stpcpy(p, quirks[i].hint_value); p = SDL12COMPAT_stpcpy(p, "\" due to environment variable override (\""); p = SDL12COMPAT_stpcpy(p, varbuf); p = SDL12COMPAT_stpcpy(p, "\")."); SDL12COMPAT_LogAtStartup(msg); } } } } } /* DO NOT CALL THINGS THAT USE SDL ALLOCATORS HERE. It runs before main(), so app-supplied allocators are not set at this point. This means no SDL_Log, no hint subsystem, nothing that might call SDL_SetError! In fact, favor code in this file, using platform-specific #ifdefs, to calling into SDL2 at all, if you can help it. */ static int LoadSDL20(void) { int okay = 1; if (!Loaded_SDL20) { SDL_bool force_x11 = SDL_FALSE; #ifdef __linux__ void *global_symbols = dlopen(NULL, RTLD_LOCAL|RTLD_NOW); /* Use linked libraries to detect what quirks we are likely to need */ if (global_symbols != NULL) { if (dlsym(global_symbols, "glxewInit") != NULL) { /* GLEW (e.g. Frogatto, SLUDGE) */ force_x11 = SDL_TRUE; } else if (dlsym(global_symbols, "cgGLEnableProgramProfiles") != NULL) { /* NVIDIA Cg (e.g. Awesomenauts, Braid) */ force_x11 = SDL_TRUE; } else if (dlsym(global_symbols, "_Z7ssgInitv") != NULL) { /* ::ssgInit(void) in plib (e.g. crrcsim) */ force_x11 = SDL_TRUE; } dlclose(global_symbols); } #endif WantDebugLogging = SDL12COMPAT_CheckDebugLogging(); okay = LoadSDL20Library(); if (!okay) { SDL12COMPAT_stpcpy(loaderror, "sdl12-compat: Failed loading SDL2 library."); } else { #define SDL20_SYM(rc,fn,params,args,ret) SDL20_##fn = (SDL20_##fn##_t) LoadSDL20Symbol("SDL_" #fn, &okay); #include "SDL20_syms.h" if (okay) { char sdl2verstr[16]; char sdl2reqverstr[16]; char sdl12compatverstr[16]; SDL_version v; SDL_version reqv; char *p; SDL20_GetVersion(&v); reqv.major = (SDL20_REQUIRED_VER / 1000); reqv.minor = ((SDL20_REQUIRED_VER % 1000) / 100); reqv.patch = (SDL20_REQUIRED_VER % 100); #define SETVERSTR(str, major, minor, micro) { \ char value[16]; \ p = str; \ SDL12COMPAT_itoa(value, major); p = SDL12COMPAT_stpcpy(p, value); *p++ = '.'; \ SDL12COMPAT_itoa(value, minor); p = SDL12COMPAT_stpcpy(p, value); *p++ = '.'; \ SDL12COMPAT_itoa(value, micro); p = SDL12COMPAT_stpcpy(p, value); \ } SETVERSTR(sdl2verstr, v.major, v.minor, v.patch); SETVERSTR(sdl2reqverstr, reqv.major, reqv.minor, reqv.patch); SETVERSTR(sdl12compatverstr, 1, 2, SDL12_COMPAT_VERSION); #undef SETVERSTR LinkedSDL2VersionInt = SDL_VERSIONNUM(v.major, v.minor, v.patch); okay = (LinkedSDL2VersionInt >= SDL20_REQUIRED_VER); if (!okay) { p = loaderror; p = SDL12COMPAT_stpcpy(p, "sdl12-compat "); p = SDL12COMPAT_stpcpy(p, sdl12compatverstr); p = SDL12COMPAT_stpcpy(p, ": SDL2 library is too old (have "); p = SDL12COMPAT_stpcpy(p, sdl2verstr); p = SDL12COMPAT_stpcpy(p, ", but need at least "); p = SDL12COMPAT_stpcpy(p, sdl2reqverstr); p = SDL12COMPAT_stpcpy(p, ")."); } else { if (WantDebugLogging) { char debugmsg[128]; /* can't use SDL log or malloc, just write to a stack buffer and do a simple platform-specific logging. */ p = debugmsg; p = SDL12COMPAT_stpcpy(p, "sdl12-compat "); p = SDL12COMPAT_stpcpy(p, sdl12compatverstr); p = SDL12COMPAT_stpcpy(p, ", "); #if defined(__DATE__) && defined(__TIME__) p = SDL12COMPAT_stpcpy(p, "built on " __DATE__ " at " __TIME__ ", "); #endif p = SDL12COMPAT_stpcpy(p, "talking to SDL2 "); p = SDL12COMPAT_stpcpy(p, sdl2verstr); SDL12COMPAT_LogAtStartup(debugmsg); } SDL12Compat_ApplyQuirks(force_x11); /* Apply and maybe print a list of any enabled quirks. */ #ifdef __linux__ { const char *envvar = SDL12COMPAT_GetEnvAtStartup("SDL_VIDEODRIVER"); if (envvar && SDL12COMPAT_strequal(envvar, "x11")) { envvar = SDL12COMPAT_GetEnvAtStartup("SDL12COMPAT_FORCE_XINITTHREADS"); if (envvar && (SDL12COMPAT_atoi(envvar) != 0)) { void *lib = dlopen("libX11.so.6", RTLD_GLOBAL|RTLD_NOW); if (lib) { int (*pXInitThreads)(void) = (int(*)(void)) dlsym(lib, "XInitThreads"); if (pXInitThreads) { pXInitThreads(); } /* leave the library open, so the XInitThreads sticks. */ } } } } #endif } } if (!okay) { UnloadSDL20(); } } } return okay; } #if defined(_WIN32) static void error_dialog(const char *errorMsg) { MessageBoxA(NULL, errorMsg, "Error", MB_OK | MB_SETFOREGROUND | MB_ICONSTOP); } #elif defined(__APPLE__) extern void error_dialog(const char *errorMsg); #else static void error_dialog(const char *errorMsg) { fprintf(stderr, "%s\n", errorMsg); } #endif #if defined(__GNUC__) && !defined(_WIN32) static void dllinit(void) __attribute__((constructor)); static void dllinit(void) { if (!LoadSDL20()) { error_dialog(loaderror); abort(); } } static void dllquit(void) __attribute__((destructor)); static void dllquit(void) { if (!SDL12Compat_GetHintBoolean("SDL12COMPAT_NO_UNLOAD", SDL_FALSE)) { UnloadSDL20(); } } #elif defined(_WIN32) && (defined(_MSC_VER) || defined(__MINGW32__) || defined(__WATCOMC__)) #if defined(_MSC_VER) && !defined(__FLTUSED__) #define __FLTUSED__ __declspec(selectany) int _fltused = 1; #endif #if defined(__MINGW32__) #define _DllMainCRTStartup DllMainCRTStartup #endif #if defined(__WATCOMC__) #define _DllMainCRTStartup LibMain #endif BOOL WINAPI _DllMainCRTStartup(HANDLE dllhandle, DWORD reason, LPVOID reserved) { (void) dllhandle; (void) reserved; switch (reason) { case DLL_PROCESS_DETACH: UnloadSDL20(); break; case DLL_PROCESS_ATTACH: /* init once for each new process */ if (!LoadSDL20()) { error_dialog(loaderror); #if 0 TerminateProcess(GetCurrentProcess(), 42); ExitProcess(42); #endif return FALSE; } break; case DLL_THREAD_ATTACH: /* thread-specific init. */ case DLL_THREAD_DETACH: /* thread-specific cleanup */ break; } return TRUE; } #elif defined(__WATCOMC__) && defined(__OS2__) unsigned _System LibMain(unsigned hmod, unsigned termination) { (void)hmod; if (termination) { UnloadSDL20(); } else if (!LoadSDL20()) { error_dialog(loaderror); return 0; } return 1; } #else #error Please define an init procedure for your platform. #endif /* Forward declarations */ DECLSPEC12 void SDLCALL SDL_CloseAudio(void); DECLSPEC12 void SDLCALL SDL_PumpEvents(void); #ifdef _WIN32 /* SDL_main functions: * SDL2 doesn't define SDL_MAIN_NEEDED for _WIN32, * therefore no need to call SDL_SetMainReady(). */ DECLSPEC12 void SDLCALL SDL_SetModuleHandle(void *handle) { (void) handle;/* handled internally by SDL2 - nothing to do.. */ } #endif DECLSPEC12 const SDL_version * SDLCALL SDL_Linked_Version(void) { static const SDL_version version = { 1, 2, SDL12_COMPAT_VERSION }; return &version; } DECLSPEC12 int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...) { int retval; va_list ap; va_start(ap, fmt); retval = (int) SDL20_vsscanf(text, fmt, ap); va_end(ap); return retval; } DECLSPEC12 int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...) { int retval; va_list ap; va_start(ap, fmt); retval = (int) SDL20_vsnprintf(text, maxlen, fmt, ap); va_end(ap); return retval; } DECLSPEC12 void * SDLCALL SDL_revcpy(void *_dst, const void *_src, size_t len) { if (len > 0) { Uint8 *dst = (((Uint8 *) _dst) + len) - 1; const Uint8 *src = (((const Uint8 *) _src) + len) - 1; size_t i; for (i = 0; i < len; i++, src--, dst--) { *dst = *src; } } return _dst; } /* SDL2 doesn't have MMXExt / 3dNowExt. */ #if (defined(__GNUC__) || defined(__llvm__)) && defined(__i386__) #define cpuid(func, a, b, c, d) \ __asm__ __volatile__ ( \ " pushl %%ebx \n" \ " xorl %%ecx,%%ecx \n" \ " cpuid \n" \ " movl %%ebx, %%esi \n" \ " popl %%ebx \n" : \ "=a" (a), "=S" (b), "=c" (c), "=d" (d) : "a" (func)) #elif (defined(__GNUC__) || defined(__llvm__)) && defined(__x86_64__) #define cpuid(func, a, b, c, d) \ __asm__ __volatile__ ( \ " pushq %%rbx \n" \ " xorq %%rcx,%%rcx \n" \ " cpuid \n" \ " movq %%rbx, %%rsi \n" \ " popq %%rbx \n" : \ "=a" (a), "=S" (b), "=c" (c), "=d" (d) : "a" (func)) #elif (defined(_MSC_VER) && defined(_M_IX86)) || defined(__WATCOMC__) #define cpuid(func, a, b, c, d) \ __asm { \ __asm mov eax, func \ __asm xor ecx, ecx \ __asm cpuid \ __asm mov a, eax \ __asm mov b, ebx \ __asm mov c, ecx \ __asm mov d, edx \ } #elif defined(_MSC_VER) && defined(_M_X64) #include #define cpuid(func, a, b, c, d) \ { \ int CPUInfo[4]; \ __cpuid(CPUInfo, func); \ a = CPUInfo[0]; \ b = CPUInfo[1]; \ c = CPUInfo[2]; \ d = CPUInfo[3]; \ } #else #define cpuid(func, a, b, c, d) \ do { a = b = c = d = 0; (void) a; (void) b; (void) c; (void) d; } while (0) #endif static int cpu_ext_features = -1; static int get_cpu_ext_features(void) { if (cpu_ext_features < 0) { cpu_ext_features = 0; if (SDL20_HasMMX()) { int a, b, c, d; cpuid(0x80000000, a, b, c, d); if ((unsigned int)a >= 0x80000001) { cpuid(0x80000001, a, b, c, d); cpu_ext_features = d; } } } return cpu_ext_features; } DECLSPEC12 SDL_bool SDLCALL SDL_HasMMXExt(void) { return (get_cpu_ext_features() & 0x00400000)? SDL_TRUE : SDL_FALSE; } DECLSPEC12 SDL_bool SDLCALL SDL_Has3DNowExt(void) { return (get_cpu_ext_features() & 0x40000000)? SDL_TRUE : SDL_FALSE; } /* SDL 1.2 has no concept of joystick hotplug, so you only have access to sticks seen during SDL_Init() and if one of them is unplugged, all you can do is fail to open it, or stop reporting new input. Also, we optionally let the app see SDL2 Game Controllers as SDL 1.2 joysticks, which gives them a stable button/axis layout and can deal with other hardware quirks. */ static SDL_bool BogusJoystick(SDL12_Joystick *stick12) { const int device_index = (int) (stick12 - JoystickList); if (!stick12 || (device_index < 0) || (device_index >= NumJoysticks)) { SDL20_SetError("Invalid SDL_Joystick"); return SDL_TRUE; } return SDL_FALSE; } static SDL_bool BogusJoystickIndex(const int device_index) { if ((device_index < 0) || (device_index >= NumJoysticks)) { SDL20_SetError("Invalid SDL_Joystick"); return SDL_TRUE; } return SDL_FALSE; } static int FindJoystick12IndexByInstanceId(const SDL_JoystickID instance_id) { int i; for (i = 0; i < NumJoysticks; i++) { if (JoystickList[i].instance_id == instance_id) { return (SDL20_AtomicGet(&JoystickList[i].refcount) > 0) ? i : -1; } } return -1; } static void Init12Joystick(void) { int numsticks20; int i; JoysticksAreGameControllers = SDL12Compat_GetHintBoolean("SDL12COMPAT_USE_GAME_CONTROLLERS", SDL_FALSE); NumJoysticks = 0; SDL20_LockJoysticks(); numsticks20 = SDL20_NumJoysticks(); if (numsticks20 > 255) { numsticks20 = 255; /* it has to fit in a Uint8 for the joystick events. */ } JoystickList = (SDL12_Joystick *) ((numsticks20 > 0) ? SDL20_calloc(numsticks20, sizeof (SDL12_Joystick)) : NULL); if (JoystickList != NULL) { for (i = 0; i < numsticks20; i++) { const char *name; SDL_bool opened; if (JoysticksAreGameControllers && !SDL20_IsGameController(i)) { continue; } name = JoysticksAreGameControllers ? SDL20_GameControllerNameForIndex(i) : SDL20_JoystickNameForIndex(i); if (!name) { name = JoysticksAreGameControllers ? "Generic SDL2 Game Controller" : "Generic SDL2 Joystick"; } JoystickList[NumJoysticks].name = SDL20_strdup(name); if (!JoystickList[NumJoysticks].name) { continue; } if (JoysticksAreGameControllers) { JoystickList[NumJoysticks].dev.controller = SDL20_GameControllerOpen(i); opened = JoystickList[NumJoysticks].dev.controller != NULL ? SDL_TRUE : SDL_FALSE; } else { JoystickList[NumJoysticks].dev.joystick = SDL20_JoystickOpen(i); opened = JoystickList[NumJoysticks].dev.joystick != NULL ? SDL_TRUE : SDL_FALSE; } if (!opened) { SDL20_free(JoystickList[NumJoysticks].name); JoystickList[NumJoysticks].name = NULL; } JoystickList[NumJoysticks].instance_id = SDL20_JoystickGetDeviceInstanceID(i); NumJoysticks++; } } SDL20_UnlockJoysticks(); if ((NumJoysticks == 0) && (JoystickList)) { SDL20_free(JoystickList); JoystickList = NULL; } else if (NumJoysticks < numsticks20) { /* shrink the array if possible. */ void *ptr = SDL20_realloc(JoystickList, sizeof (*JoystickList) * NumJoysticks); if (ptr) { JoystickList = (SDL12_Joystick *) ptr; } } } static void Quit12Joystick(void) { int i; for (i = 0; i < NumJoysticks; i++) { SDL12_Joystick *stick12 = &JoystickList[i]; if (JoysticksAreGameControllers) { SDL20_GameControllerClose(stick12->dev.controller); } else { SDL20_JoystickClose(stick12->dev.joystick); } SDL20_free(stick12->name); } SDL20_free(JoystickList); JoystickList = NULL; NumJoysticks = 0; } DECLSPEC12 int SDLCALL SDL_NumJoysticks(void) { return NumJoysticks; } DECLSPEC12 int SDLCALL SDL_JoystickNumAxes(SDL12_Joystick *stick12) { if (BogusJoystick(stick12)) { return -1; } return JoysticksAreGameControllers ? (SDL_CONTROLLER_AXIS_MAX + 1) : SDL20_JoystickNumAxes(stick12->dev.joystick); } DECLSPEC12 int SDLCALL SDL_JoystickNumBalls(SDL12_Joystick *stick12) { if (BogusJoystick(stick12)) { return -1; } return JoysticksAreGameControllers ? 0 : SDL20_JoystickNumBalls(stick12->dev.joystick); } DECLSPEC12 int SDLCALL SDL_JoystickNumHats(SDL12_Joystick *stick12) { if (BogusJoystick(stick12)) { return -1; } return JoysticksAreGameControllers ? 0 : SDL20_JoystickNumHats(stick12->dev.joystick); } DECLSPEC12 int SDLCALL SDL_JoystickNumButtons(SDL12_Joystick *stick12) { if (BogusJoystick(stick12)) { return -1; } return JoysticksAreGameControllers ? (SDL_CONTROLLER_BUTTON_MAX + 1) : SDL20_JoystickNumButtons(stick12->dev.joystick); } DECLSPEC12 void SDLCALL SDL_JoystickUpdate(void) { if (JoysticksAreGameControllers) { SDL20_GameControllerUpdate(); } else { SDL20_JoystickUpdate(); } } DECLSPEC12 int SDLCALL SDL_JoystickEventState(int state) { switch (state) { case SDL_DISABLE: case SDL_ENABLE: if (JoysticksAreGameControllers) { SDL20_JoystickEventState(state); return SDL20_GameControllerEventState(state); } SDL20_GameControllerEventState(state); return SDL20_JoystickEventState(state); default: /* everything else is treated as SDL_QUERY */ /* we turn joystick and controller event state off together, so we only have to query one. */ return SDL20_JoystickEventState(SDL_QUERY); } } DECLSPEC12 Sint16 SDLCALL SDL_JoystickGetAxis(SDL12_Joystick *stick12, int axis) { if (BogusJoystick(stick12)) { return 0; } return JoysticksAreGameControllers ? SDL20_GameControllerGetAxis(stick12->dev.controller, axis) : SDL20_JoystickGetAxis(stick12->dev.joystick, axis); } DECLSPEC12 Uint8 SDLCALL SDL_JoystickGetHat(SDL12_Joystick *stick12, int hat) { if (BogusJoystick(stick12)) { return 0; } return JoysticksAreGameControllers ? 0 : SDL20_JoystickGetHat(stick12->dev.joystick, hat); } DECLSPEC12 int SDLCALL SDL_JoystickGetBall(SDL12_Joystick *stick12, int ball, int *dx, int *dy) { if (BogusJoystick(stick12)) { return 0; } if (JoysticksAreGameControllers) { if (dx) { *dx = 0; } if (dy) { *dy = 0; } return SDL20_SetError("No joystick balls available"); } return SDL20_JoystickGetBall(stick12->dev.joystick, ball, dx, dy); } DECLSPEC12 Uint8 SDLCALL SDL_JoystickGetButton(SDL12_Joystick *stick12, int button) { if (BogusJoystick(stick12)) { return 0; } return JoysticksAreGameControllers ? SDL20_GameControllerGetButton(stick12->dev.controller, button) : SDL20_JoystickGetButton(stick12->dev.joystick, button); } DECLSPEC12 SDL12_Joystick * SDLCALL SDL_JoystickOpen(int device_index) { if (BogusJoystickIndex(device_index)) { return NULL; } /* multiple opens just increments a refcount and returns the same object in SDL 1.2 Classic. */ SDL20_AtomicAdd(&JoystickList[device_index].refcount, 1); return &JoystickList[device_index]; } DECLSPEC12 void SDLCALL SDL_JoystickClose(SDL12_Joystick *stick12) { if (!BogusJoystick(stick12)) { /* we don't actually close anything here, just drop the refcount. */ if (SDL20_AtomicAdd(&stick12->refcount, -1) == 0) { SDL20_AtomicAdd(&stick12->refcount, 1); /* whoops, wasn't open, bounce it back to zero. */ } } } DECLSPEC12 const char * SDLCALL SDL_JoystickName(int device_index) { return BogusJoystickIndex(device_index) ? NULL : JoystickList[device_index].name; } DECLSPEC12 int SDLCALL SDL_JoystickIndex(SDL12_Joystick *stick12) { return BogusJoystick(stick12) ? -1 : (int) (stick12 - JoystickList); } DECLSPEC12 int SDLCALL SDL_JoystickOpened(int device_index) { if (BogusJoystickIndex(device_index)) { return 0; /* SDL 1.2 classic doesn't return an error here, either. */ } return SDL20_AtomicGet(&JoystickList[device_index].refcount) ? 1 : 0; } static SDL_PixelFormatEnum BPPToPixelFormat(unsigned bpp) { #if !SDL_VERSION_ATLEAST(2,0,14) #define SDL_PIXELFORMAT_XRGB8888 SDL_PIXELFORMAT_RGB888 #endif switch (bpp) { case 8: return SDL_PIXELFORMAT_INDEX8; case 16: return SDL_PIXELFORMAT_RGB565; case 24: return SDL_PIXELFORMAT_BGR24; case 32: return SDL_PIXELFORMAT_XRGB8888; default: SDL20_SetError("Unsupported bits-per-pixel"); return SDL_PIXELFORMAT_UNKNOWN; } } static SDL_PixelFormat * PixelFormat12to20(SDL_PixelFormat *format20, SDL_Palette *palette20, const SDL12_PixelFormat *format12) { if (format12->palette) { palette20->ncolors = format12->palette->ncolors; palette20->colors = format12->palette->colors; palette20->version = 1; palette20->refcount = 1; format20->palette = palette20; } else { format20->palette = NULL; } format20->format = SDL20_MasksToPixelFormatEnum(format12->BitsPerPixel, format12->Rmask, format12->Gmask, format12->Bmask, format12->Amask); format20->BitsPerPixel = format12->BitsPerPixel; format20->BytesPerPixel = format12->BytesPerPixel; /* Paletted surfaces shouldn't have masks in SDL 2.0 */ if (format12->palette) { format20->Rmask = 0; format20->Gmask = 0; format20->Bmask = 0; format20->Amask = 0; format20->Rloss = 8; format20->Gloss = 8; format20->Bloss = 8; format20->Aloss = 8; format20->Rshift = 0; format20->Gshift = 0; format20->Bshift = 0; format20->Ashift = 0; } else { format20->Rmask = format12->Rmask; format20->Gmask = format12->Gmask; format20->Bmask = format12->Bmask; format20->Amask = format12->Amask; format20->Rloss = format12->Rloss; format20->Gloss = format12->Gloss; format20->Bloss = format12->Bloss; format20->Aloss = format12->Aloss; format20->Rshift = format12->Rshift; format20->Gshift = format12->Gshift; format20->Bshift = format12->Bshift; format20->Ashift = format12->Ashift; } format20->refcount = 1; format20->next = NULL; return format20; } static SDL12_PixelFormat * PixelFormat20to12(SDL12_PixelFormat *format12, SDL12_Palette *palette12, const SDL_PixelFormat *format20) { if (format20->palette) { palette12->ncolors = format20->palette->ncolors; palette12->colors = format20->palette->colors; format12->palette = palette12; } else { format12->palette = NULL; } format12->BitsPerPixel = format20->BitsPerPixel; format12->BytesPerPixel = format20->BytesPerPixel; format12->Rloss = format20->Rloss; format12->Gloss = format20->Gloss; format12->Bloss = format20->Bloss; format12->Aloss = format20->Aloss; format12->Rshift = format20->Rshift; format12->Gshift = format20->Gshift; format12->Bshift = format20->Bshift; format12->Ashift = format20->Ashift; format12->Rmask = format20->Rmask; format12->Gmask = format20->Gmask; format12->Bmask = format20->Bmask; format12->Amask = format20->Amask; format12->colorkey = 0; /* this is a surface, not pixelformat, properties in SDL2. */ format12->alpha = 255; /* this is a surface, not pixelformat, properties in SDL2. */ return format12; } static int GetVideoDisplay(void) { const char *variable; variable = SDL12COMPAT_getenv_unsafe("SDL_VIDEO_FULLSCREEN_DISPLAY"); if (!variable) { variable = SDL12COMPAT_getenv_unsafe("SDL_VIDEO_FULLSCREEN_HEAD"); } if (variable) { int preferred_display = SDL20_atoi(variable); if (preferred_display < 0 || preferred_display >= SDL20_GetNumVideoDisplays()) { return 0; } return SDL20_atoi(variable); } return 0; } /* returns true if mode1 should sort before mode2 */ static int VidModeSizeGreater(SDL12_Rect *mode1, SDL12_Rect *mode2) { if (mode1->w > mode2->w) { return 1; } if (mode2->w > mode1->w) { return 0; } return (mode1->h > mode2->h); } static int AddVidModeToList(VideoModeList *vmode, SDL12_Rect *mode, const Uint16 maxw, const Uint16 maxh) { void *ptr = NULL; int i; if ((maxw && (mode->w > maxw)) || (maxh && (mode->h > maxh))) { return 0; /* clamp this one out as too big. */ } /* make sure we don't have this one already (with a different refresh rate, etc). */ for (i = 0; i < vmode->nummodes; i++) { if ((vmode->modeslist12[i].w == mode->w) && (vmode->modeslist12[i].h == mode->h)) { break; } } if (i < vmode->nummodes) { return 0; /* already have this one. */ } ptr = SDL20_realloc(vmode->modeslist12, sizeof (SDL12_Rect) * (vmode->nummodes + 1)); if (ptr == NULL) { return SDL20_OutOfMemory(); } vmode->modeslist12 = (SDL12_Rect *) ptr; SDL20_memcpy(&vmode->modeslist12[vmode->nummodes], mode, sizeof(vmode->modeslist12[vmode->nummodes])); vmode->nummodes++; return 0; } /* A list of fake video modes which are included. */ static SDL12_Rect fake_modes[] = { { 0, 0, 7680, 4320 }, { 0, 0, 6144, 3160 }, { 0, 0, 5120, 2880 }, { 0, 0, 4096, 2304 }, { 0, 0, 3840, 2160 }, { 0, 0, 3200, 1800 }, { 0, 0, 2880, 1600 }, { 0, 0, 2560, 1600 }, { 0, 0, 2048, 1536 }, { 0, 0, 1920, 1440 }, { 0, 0, 1920, 1200 }, { 0, 0, 1920, 1080 }, { 0, 0, 1680, 1050 }, { 0, 0, 1600, 1200 }, { 0, 0, 1600, 900 }, { 0, 0, 1440, 1080 }, { 0, 0, 1440, 900 }, { 0, 0, 1400, 1050 }, { 0, 0, 1368, 768 }, { 0, 0, 1280, 1024 }, { 0, 0, 1280, 960 }, { 0, 0, 1280, 800 }, { 0, 0, 1280, 720 }, { 0, 0, 1152, 864 }, { 0, 0, 1024, 768 }, { 0, 0, 864, 486 }, { 0, 0, 800, 600 }, { 0, 0, 720, 480 }, { 0, 0, 640, 480 } }; /* This sets up VideoModes and VideoModesCount. You end up with arrays by pixel format, each with a value that 1.2's SDL_ListModes() can return. */ static int Init12VidModes(void) { const int total = SDL20_GetNumDisplayModes(VideoDisplayIndex); const char *maxmodestr; const unsigned max_bpp = SDL12Compat_GetHintInt("SDL12COMPAT_MAX_BPP", 32); VideoModeList *vmode = NULL; void *ptr = NULL; int i, j; SDL12_Rect prev_mode = { 0, 0, 0, 0 }, current_mode = { 0, 0, 0, 0 }; /* We only want to enable fake modes if OpenGL Logical Scaling is enabled. */ const SDL_bool use_fake_modes = SDL12Compat_GetHintBoolean("SDL12COMPAT_OPENGL_SCALING", SDL_TRUE); Uint16 maxw = 0; Uint16 maxh = 0; if (VideoModesCount > 0) { return 0; /* already did this. */ } PreserveDestinationAlpha = SDL12Compat_GetHintBoolean("SDL12COMPAT_PRESERVE_DEST_ALPHA", SDL_TRUE); WantOpenGLScaling = use_fake_modes; SDL_assert(VideoModes == NULL); maxmodestr = SDL12Compat_GetHint("SDL12COMPAT_MAX_VIDMODE"); if (maxmodestr) { unsigned int w = 0, h = 0; SDL_sscanf(maxmodestr, "%ux%u", &w, &h); if (w > 0xFFFF) w = 0xFFFF; if (h > 0xFFFF) h = 0xFFFF; maxw = w; maxh = h; } for (i = 0; i < total; ++i) { SDL_DisplayMode mode; if (SDL20_GetDisplayMode(VideoDisplayIndex, i, &mode) < 0) { continue; } if ((mode.w == 0) && (mode.h == 0)) { /* SDL2 has a bug in its dummy driver before 2.0.16 that causes it to report a bogus video mode. */ if (IsDummyVideo && (LinkedSDL2VersionInt <= SDL_VERSIONNUM(2, 0, 15))) { mode.w = 1024; mode.h = 768; mode.format = SDL_PIXELFORMAT_RGB888; } } if ((mode.w <= 0) || (mode.h <= 0)) { continue; /* bogus mode for whatever reason, ignore it. */ } if (mode.w > 65535 || mode.h > 65535) { continue; /* can't fit to 16-bits for SDL12_Rect */ } if (SDL_BITSPERPIXEL(mode.format) > max_bpp) { /* If we see any mode > max_bpp, reduce its bpp. */ mode.format = BPPToPixelFormat(max_bpp); } if (!vmode || (mode.format != vmode->format)) { /* SDL20_GetDisplayMode() sorts on bpp first. We know when to change arrays. */ ptr = (VideoModeList *) SDL20_realloc(VideoModes, sizeof (VideoModeList) * (VideoModesCount+1)); if (!ptr) { return SDL20_OutOfMemory(); } VideoModes = (VideoModeList *) ptr; vmode = &VideoModes[VideoModesCount]; vmode->format = mode.format; vmode->nummodes = 0; vmode->modeslist12 = NULL; vmode->modes12 = NULL; VideoModesCount++; } current_mode.w = mode.w; current_mode.h = mode.h; /* Attempt to add all of the fake modes. */ if (use_fake_modes) { for (j = 0; j < (int) SDL_arraysize(fake_modes); ++j) { if (VidModeSizeGreater(&prev_mode, &fake_modes[j]) && VidModeSizeGreater(&fake_modes[j], ¤t_mode)) { if (AddVidModeToList(vmode, &fake_modes[j], maxw, maxh)) { return SDL20_OutOfMemory(); } } } } if (AddVidModeToList(vmode, ¤t_mode, maxw, maxh)) { return SDL20_OutOfMemory(); } prev_mode.w = mode.w; prev_mode.h = mode.h; } /* we need to try to add fake modes to the end of the list once there are no more real modes */ if (use_fake_modes) { for (i = 0; i < (int) SDL_arraysize(fake_modes); ++i) { if (VidModeSizeGreater(&prev_mode, &fake_modes[i])) { if (AddVidModeToList(vmode, &fake_modes[i], maxw, maxh)) { return SDL20_OutOfMemory(); } } } } /* link up modes12 for SDL_ListModes()'s use... */ for (i = 0, vmode = VideoModes; i < VideoModesCount; i++, vmode++) { const int nummodes = vmode->nummodes; vmode->modes12 = (SDL12_Rect **) SDL20_calloc(sizeof (SDL12_Rect *), nummodes + 1); if (vmode->modes12 == NULL) { return SDL20_OutOfMemory(); } for (j = 0; j < nummodes; j++) { vmode->modes12[j] = &vmode->modeslist12[j]; } } QueuedDisplayOverlays.next = NULL; QueuedDisplayOverlaysTail = &QueuedDisplayOverlays; return 0; } /* we should have a default cursor */ #include "default_cursor.h" DECLSPEC12 void SDLCALL SDL_FreeCursor(SDL12_Cursor *); static int HasWmAvailable(const char *driver) { /* This is not perfect, but this emcompasses everything that SDL 2.22.0 offers. Most things are console or framebuffer targets, so it's easier to list things that are actual GUI user interfaces here. */ static const char * const gui_targets[] = { #ifdef _WIN32 "windows", "winrt", #endif #ifdef __APPLE__ "cocoa", #endif #ifdef __OS2__ "DIVE", "VMAN", #endif #ifdef __HAIKU__ "haiku", #endif #ifdef __QNX__ "qnx", /* I _think_ this has a window manager... */ #endif "x11", "wayland" /* just assume anything can MAYBE have these, even if they wouldn't. */ }; int i; for (i = 0; i < (int) SDL_arraysize(gui_targets); i++) { if (SDL20_strcasecmp(driver, gui_targets[i]) == 0) { return 1; } } return 0; } DECLSPEC12 int SDLCALL SDL_EnableKeyRepeat(int delay, int interval); static int Init12Video(void) { const char *driver = SDL20_GetCurrentVideoDriver(); const char *scale_method_env = SDL12Compat_GetHint("SDL12COMPAT_SCALE_METHOD"); const unsigned max_bpp = SDL12Compat_GetHintInt("SDL12COMPAT_MAX_BPP", 32); SDL_DisplayMode mode; int i; AllowThreadedDraws = SDL12Compat_GetHintBoolean("SDL12COMPAT_ALLOW_THREADED_DRAWS", SDL_TRUE); AllowThreadedPumps = SDL12Compat_GetHintBoolean("SDL12COMPAT_ALLOW_THREADED_PUMPS", SDL_TRUE); WantScaleMethodNearest = (scale_method_env && !SDL20_strcmp(scale_method_env, "nearest")) ? SDL_TRUE : SDL_FALSE; /* Only override this if the env var is set, as the default is platform-specific. */ TranslateKeyboardLayout = SDL12Compat_GetHintBoolean("SDL12COMPAT_USE_KEYBOARD_LAYOUT", TranslateKeyboardLayout); IsDummyVideo = ((driver != NULL) && (SDL20_strcmp(driver, "dummy") == 0)) ? SDL_TRUE : SDL_FALSE; EventQueueMutex = SDL20_CreateMutex(); if (EventQueueMutex == NULL) { return -1; } for (i = 0; i < SDL12_MAXEVENTS-1; i++) { EventQueuePool[i].next = &EventQueuePool[i+1]; } EventQueuePool[SDL12_MAXEVENTS-1].next = NULL; EventQueueHead = EventQueueTail = NULL; EventQueueAvailable = EventQueuePool; SDL20_memset(&PendingKeydownEvent, 0, sizeof(SDL12_Event)); SDL20_memset(EventStates, SDL_ENABLE, sizeof (EventStates)); /* on by default */ EventStates[SDL12_SYSWMEVENT] = SDL_IGNORE; /* off by default. */ #if defined(SDL_VIDEO_DRIVER_WINDOWS) SDL20_EventState(SDL_SYSWMEVENT, SDL_ENABLE); #else SDL20_EventState(SDL_SYSWMEVENT, SDL_IGNORE); #endif #if defined(SDL_VIDEO_DRIVER_WINDOWS) SupportSysWM = (SDL20_strcmp(driver, "windows") == 0) ? SDL_TRUE : SDL_FALSE; #elif defined(SDL_VIDEO_DRIVER_X11) SupportSysWM = (SDL20_strcmp(driver, "x11") == 0) ? SDL_TRUE : SDL_FALSE; #else SupportSysWM = SDL_FALSE; #endif if (!SDL12Compat_GetHintBoolean("SDL12COMPAT_ALLOW_SYSWM", SDL_TRUE)) { SupportSysWM = SDL_FALSE; } SDL_EnableKeyRepeat(0, 0); SDL20_DelEventWatch(EventFilter20to12, NULL); SDL20_AddEventWatch(EventFilter20to12, NULL); VideoDisplayIndex = GetVideoDisplay(); SwapInterval = 0; VideoWindowGrabWanted = SDL_FALSE; VideoWindowGrabbed = SDL_FALSE; VideoCursorHidden = SDL_FALSE; SDL20_ShowCursor(1); if (Init12VidModes() < 0) { return -1; } SDL20_StopTextInput(); if (SDL20_GetDesktopDisplayMode(VideoDisplayIndex, &mode) == 0) { if (SDL_BITSPERPIXEL(mode.format) > max_bpp) { VideoInfoVfmt20 = SDL20_AllocFormat(BPPToPixelFormat(max_bpp)); } else { VideoInfoVfmt20 = SDL20_AllocFormat(mode.format); } VideoInfo12.vfmt = PixelFormat20to12(&VideoInfoVfmt12, &VideoInfoPalette12, VideoInfoVfmt20); VideoInfo12.current_w = mode.w; VideoInfo12.current_h = mode.h; VideoInfo12.wm_available = HasWmAvailable(driver); VideoInfo12.video_mem = 1024 * 256; /* good enough. */ } return 0; } DECLSPEC12 int SDLCALL SDL_VideoInit(const char *driver, Uint32 flags) { int retval; (void) flags; /* unused. */ retval = SDL20_VideoInit(driver); if (retval != -1) { retval = Init12Video(); if (retval == -1) { SDL20_VideoQuit(); } } return retval; } static void Init12Audio(void) { WantCompatibilityAudioCVT = SDL12Compat_GetHintBoolean("SDL12COMPAT_COMPATIBILITY_AUDIOCVT", SDL_FALSE); } static void InitializeCDSubsystem(void); static void QuitCDSubsystem(void); DECLSPEC12 int SDLCALL SDL_InitSubSystem(Uint32 sdl12flags) { const char *videodriver = SDL12COMPAT_getenv_unsafe("SDL_VIDEODRIVER"); const char *audiodriver = SDL12COMPAT_getenv_unsafe("SDL_AUDIODRIVER"); Uint32 sdl20flags = 0; int rc; #ifdef __WINDOWS__ /* DOSBox (and probably other things), try to force the "windib" video backend, but it doesn't exist in SDL2. Force to "windows" instead. */ if (videodriver && (SDL20_strcmp(videodriver, "windib") == 0 || SDL20_strcmp(videodriver, "directx") == 0)) { videodriver = "windows"; } #endif #ifdef __MACOSX__ extern void sdl12_compat_macos_init(void); sdl12_compat_macos_init(); #endif /* note that currently we ignore SDL12_INIT_NOPARACHUTE, since there _isn't_ a parachute in SDL2, and mostly it was meant to deal with X11's XVidMode leaving the display resolution busted if the app didn't call SDL_Quit() before leaving...but most sdl12-compat cases (except OpenGL rendering without logical scaling) use FULLSCREEN_DESKTOP for fullscreen modes, and modern X11 doesn't have this problem, so we're ignoring the parachute until a reasonable need arises. */ #define SETFLAG(flag) { \ const Uint32 f12 = SDL12_INIT_##flag; \ const Uint32 f20 = SDL_INIT_##flag; \ if ((sdl12flags & f12) && ((InitializedSubsystems20 & f20) == 0)) { \ sdl20flags |= f20; \ } \ } SETFLAG(TIMER); SETFLAG(AUDIO); SETFLAG(VIDEO); SETFLAG(JOYSTICK); SETFLAG(NOPARACHUTE); #undef SETFLAG /* There's no CDROM in 2.0, but we fake it. */ if (sdl12flags & SDL12_INIT_CDROM) { /* this never reports failure, even if there's a legit problem. You just won't see any drives. */ InitializeCDSubsystem(); } /* In SDL3 (via sdl2-compat), these will ignore changes to environment variables after startup, but SDL-1.2 apps might change envvars on the fly, so we need to manually force these into SDL2 hints. */ if (videodriver) { SDL20_SetHintWithPriority(SDL_HINT_VIDEODRIVER, videodriver, SDL_HINT_OVERRIDE); } if (audiodriver) { SDL20_SetHintWithPriority(SDL_HINT_AUDIODRIVER, audiodriver, SDL_HINT_OVERRIDE); } rc = SDL20_Init(sdl20flags); if ((rc == 0) && (sdl20flags & SDL_INIT_VIDEO)) { if (Init12Video() < 0) { rc = -1; } /* SDL_INIT_EVENTTHREAD takes effect when SDL_INIT_VIDEO is also set */ EventThreadEnabled = (sdl12flags & SDL12_INIT_EVENTTHREAD) ? SDL_TRUE : SDL_FALSE; } if ((rc == 0) && (sdl20flags & SDL_INIT_AUDIO)) { Init12Audio(); } if ((rc == 0) && (sdl20flags & SDL_INIT_JOYSTICK)) { Init12Joystick(); /* if this fails, we just won't report any sticks. */ } InitializedSubsystems20 |= sdl20flags; return rc; } DECLSPEC12 int SDLCALL SDL_Init(Uint32 sdl12flags) { return SDL_InitSubSystem(sdl12flags); /* there's no difference betwee Init and InitSubSystem in SDL2. */ } static void InitFlags12to20(const Uint32 flags12, Uint32 *_flags20, Uint32 *_extraflags) { Uint32 flags20 = 0; Uint32 extraflags = 0; #define SETFLAG(flag) if (flags12 & SDL12_INIT_##flag) flags20 |= SDL_INIT_##flag SETFLAG(TIMER); SETFLAG(AUDIO); SETFLAG(VIDEO); SETFLAG(JOYSTICK); SETFLAG(NOPARACHUTE); #undef SETFLAG if ((flags12 & SDL12_INIT_CDROM) && (CDRomInit)) { extraflags |= SDL12_INIT_CDROM; } *_flags20 = flags20; *_extraflags = extraflags; } static Uint32 InitFlags20to12(const Uint32 flags20) { Uint32 flags12 = 0; #define SETFLAG(flag) if (flags20 & SDL_INIT_##flag) flags12 |= SDL12_INIT_##flag SETFLAG(TIMER); SETFLAG(AUDIO); SETFLAG(VIDEO); SETFLAG(JOYSTICK); SETFLAG(NOPARACHUTE); #undef SETFLAG return flags12; } DECLSPEC12 Uint32 SDLCALL SDL_WasInit(Uint32 sdl12flags) { Uint32 sdl20flags, extraflags; InitFlags12to20(sdl12flags, &sdl20flags, &extraflags); return InitFlags20to12(SDL20_WasInit(sdl20flags)) | extraflags; } static void FreeSurfaceContents(SDL12_Surface *surface12) { if (surface12->surface20) { SDL20_FreeSurface(surface12->surface20); surface12->surface20 = NULL; } if (surface12->format) { SDL20_free(surface12->format->palette); SDL20_free(surface12->format); surface12->format = NULL; } } static SDL12_Surface *EndVidModeCreate(void); static void Quit12Video(void) { int i; SDL_EnableKeyRepeat(0, 0); SDL20_FreeSurface(VideoIcon20); VideoIcon20 = NULL; EndVidModeCreate(); /* clean-up static data. */ for (i = 0; i < VideoModesCount; i++) { SDL20_free(VideoModes[i].modeslist12); SDL20_free(VideoModes[i].modes12); } SDL20_free(VideoModes); SDL20_FreeFormat(VideoInfoVfmt20); SDL20_zero(VideoInfo12); VideoInfoVfmt20 = NULL; EventFilter12 = NULL; EventQueueAvailable = EventQueueHead = EventQueueTail = NULL; SDL20_memset(&PendingKeydownEvent, 0, sizeof(SDL12_Event)); SDL_FreeCursor(CurrentCursor12); VideoModes = NULL; VideoModesCount = 0; AllowThreadedDraws = SDL_FALSE; AllowThreadedPumps = SDL_FALSE; if (EventQueueMutex) { SDL20_DestroyMutex(EventQueueMutex); EventQueueMutex = NULL; } /* Shutdown the fake event thread. */ EventThreadEnabled = SDL_FALSE; } DECLSPEC12 void SDLCALL SDL_QuitSubSystem(Uint32 sdl12flags) { Uint32 sdl20flags, extraflags; /* Some games (notably the Steam build of Multiwinia), will * SDL_Quit(SDL_INIT_VIDEO) on resolution change, and never call * SDL_Init() again before creating their new window. */ if (SDL12Compat_GetHintBoolean("SDL12COMPAT_NO_QUIT_VIDEO", SDL_FALSE)) { sdl12flags &= ~SDL12_INIT_VIDEO; } InitFlags12to20(sdl12flags, &sdl20flags, &extraflags); if (extraflags & SDL12_INIT_CDROM) { QuitCDSubsystem(); } if (sdl12flags & SDL12_INIT_AUDIO) { SDL_CloseAudio(); } if (sdl12flags & SDL12_INIT_VIDEO) { Quit12Video(); } if (sdl12flags & SDL12_INIT_JOYSTICK) { Quit12Joystick(); } SDL20_QuitSubSystem(sdl20flags); if ((SDL20_WasInit(0) == 0) && (!CDRomInit)) { SDL20_Quit(); } InitializedSubsystems20 &= ~sdl20flags; InitializedSubsystems20 &= ~SDL_INIT_NOPARACHUTE; /* SDL2 accepts this flag but ignores it. */ } DECLSPEC12 void SDLCALL SDL_Quit(void) { SDL_bool noquitvideo = SDL12Compat_GetHintBoolean("SDL12COMPAT_NO_QUIT_VIDEO", SDL_FALSE); SDL_QuitSubSystem(SDL_WasInit(0) | SDL12_INIT_CDROM); SDL_assert((InitializedSubsystems20 == 0) || (noquitvideo && (InitializedSubsystems20 == SDL_INIT_VIDEO))); } DECLSPEC12 void SDLCALL SDL_Error(SDL_errorcode error) { SDL20_Error(error); } DECLSPEC12 void SDLCALL SDL_SetError(const char *fmt, ...) { char ch; char *str = NULL; size_t len = 0; va_list ap; va_start(ap, fmt); len = SDL20_vsnprintf(&ch, 1, fmt, ap); va_end(ap); str = (char *) SDL20_malloc(len + 1); if (!str) { SDL20_OutOfMemory(); } else { va_start(ap, fmt); SDL20_vsnprintf(str, len + 1, fmt, ap); va_end(ap); SDL20_SetError("%s", str); SDL20_free(str); } } DECLSPEC12 const char * SDLCALL SDL_GetError(void) { if (SDL20_GetError == NULL) { static const char noload_errstr[] = "SDL2 library isn't loaded."; return noload_errstr; } return SDL20_GetError(); } static const char * GetDriverName(const char *name, char *namebuf, int maxlen) { if (name) { if (namebuf) { SDL20_strlcpy(namebuf, name, maxlen); return namebuf; } return name; } return NULL; } DECLSPEC12 const char * SDLCALL SDL_AudioDriverName(char *namebuf, int maxlen) { return GetDriverName(SDL20_GetCurrentAudioDriver(), namebuf, maxlen); } DECLSPEC12 const char * SDLCALL SDL_VideoDriverName(char *namebuf, int maxlen) { #ifdef __WINDOWS__ const char *val = SDL12COMPAT_getenv_unsafe("SDL_VIDEODRIVER"); if (val) { /* give them back what they requested: */ if (SDL20_strcmp(val, "windib") == 0 || SDL20_strcmp(val, "directx") == 0) { return GetDriverName(val, namebuf, maxlen); } } val = SDL20_GetCurrentVideoDriver(); if (val && SDL20_strcmp(val, "windows") == 0) { /* Windows apps may use SDL_VideoDriverName() to check accelerated * vs unaccelerated display by using directx and windib. * https://github.com/libsdl-org/sdl12-compat/issues/223 */ val = "directx"; } return GetDriverName(val, namebuf, maxlen); #else return GetDriverName(SDL20_GetCurrentVideoDriver(), namebuf, maxlen); #endif } /* you MUST hold EventQueueMutex before calling this! */ static int SDL_PollEvent_locked(SDL12_Event *event12) { EventQueueType *next; SDL_PumpEvents(); /* this will run our filter and build our 1.2 queue. */ if (EventQueueHead == NULL) { return 0; /* no events at the moment. */ } if (event12 != NULL) { SDL20_memcpy(event12, &EventQueueHead->event12, sizeof (SDL12_Event)); next = EventQueueHead->next; EventQueueHead->next = EventQueueAvailable; EventQueueAvailable = EventQueueHead; EventQueueHead = next; if (!next) { EventQueueTail = NULL; } } return 1; } DECLSPEC12 int SDLCALL SDL_PollEvent(SDL12_Event *event12) { int retval; if (!EventQueueMutex) { return 0; } SDL20_LockMutex(EventQueueMutex); retval = SDL_PollEvent_locked(event12); SDL20_UnlockMutex(EventQueueMutex); return retval; } /* you MUST hold EventQueueMutex before calling this! */ static int SDL_PushEvent_locked(SDL12_Event *event12) { EventQueueType *item = EventQueueAvailable; if (item == NULL) { return -1; /* no space available at the moment. */ } EventQueueAvailable = item->next; if (EventQueueTail) { EventQueueTail->next = item; EventQueueTail = item; } else { EventQueueHead = EventQueueTail = item; } item->next = NULL; SDL20_memcpy(&item->event12, event12, sizeof (SDL12_Event)); if (event12->type == SDL12_SYSWMEVENT) { /* make a copy of the data here */ SDL20_memcpy(&item->syswm_msg, event12->syswm.msg, sizeof (SDL12_SysWMmsg)); item->event12.syswm.msg = &item->syswm_msg; } return 0; } DECLSPEC12 int SDLCALL SDL_PushEvent(SDL12_Event *event12) { int retval; if (!EventQueueMutex) { return SDL20_SetError("SDL not initialized"); } SDL20_LockMutex(EventQueueMutex); retval = SDL_PushEvent_locked(event12); SDL20_UnlockMutex(EventQueueMutex); return retval; } /* you MUST hold EventQueueMutex before calling this! */ static int SDL_PeepEvents_locked(SDL12_Event *events12, int numevents, SDL_eventaction action, Uint32 mask) { SDL12_Event dummy_event; /* We don't actually implement an event thread in sdl12-compat, but some * games will only call SDL_PeepEvents(), which doesn't otherwise pump * events, and get stuck when they've consumed all the events. * * Just pumping the event loop here simulates an event thread well enough * for most things. */ if (EventThreadEnabled) { SDL_PumpEvents(); } if (action == SDL_ADDEVENT) { int i; for (i = 0; i < numevents; i++) { if (SDL_PushEvent(&events12[i]) < 0) { break; /* out of space for more events. */ } } return i; } if (!events12) { action = SDL_PEEKEVENT; numevents = 1; events12 = &dummy_event; } if ((action == SDL_PEEKEVENT) || (action == SDL_GETEVENT)) { const SDL_bool is_get = (action == SDL_GETEVENT)? SDL_TRUE : SDL_FALSE; EventQueueType *prev = NULL; EventQueueType *item = EventQueueHead; EventQueueType *next = NULL; int chosen = 0; while (chosen < numevents) { EventQueueType *nextPrev = item; if (!item) { break; /* no more events at the moment. */ } next = item->next; /* copy, since we might overwrite item->next */ if (mask & (1<event12.type)) { SDL20_memcpy(&events12[chosen++], &item->event12, sizeof (SDL12_Event)); if (is_get) { /* remove from list? */ if (prev != NULL) { prev->next = next; } if (item == EventQueueHead) { EventQueueHead = next; } if (item == EventQueueTail) { EventQueueTail = prev; } /* put it back in the free pool. */ item->next = EventQueueAvailable; EventQueueAvailable = item; nextPrev = prev; /* previous item doesn't change. */ } } item = next; prev = nextPrev; } return chosen; } return 0; } DECLSPEC12 int SDLCALL SDL_PeepEvents(SDL12_Event *events12, int numevents, SDL_eventaction action, Uint32 mask) { int retval; if (!EventQueueMutex) { return SDL20_SetError("SDL not initialized"); } SDL20_LockMutex(EventQueueMutex); retval = SDL_PeepEvents_locked(events12, numevents, action, mask); SDL20_UnlockMutex(EventQueueMutex); return retval; } DECLSPEC12 int SDLCALL SDL_WaitEvent(SDL12_Event *event12) { if (!EventQueueMutex) { return SDL20_SetError("SDL not initialized"); } /* the 1.2 entry point for PollEvent will grab/release the EventQueueMutex */ while (!SDL_PollEvent(event12)) { SDL20_Delay(10); } return 1; } static SDL_bool PushEventIfNotFiltered(SDL12_Event *event12) { SDL_bool retval = SDL_FALSE; if (event12->type != SDL12_NOEVENT) { SDL_assert(EventQueueMutex != NULL); SDL20_LockMutex(EventQueueMutex); if (EventStates[event12->type] != SDL_IGNORE) { if ((!EventFilter12) || (EventFilter12(event12))) { retval = (SDL_PushEvent(event12) == 0)? SDL_TRUE : SDL_FALSE; } } SDL20_UnlockMutex(EventQueueMutex); } return retval; } DECLSPEC12 Uint8 SDLCALL SDL_EventState(Uint8 type, int state) { Uint8 retval = 0; /* the values of "state" match between 1.2 and 2.0 */ if (EventQueueMutex) { SDL12_Event e; SDL20_LockMutex(EventQueueMutex); retval = EventStates[type]; if (state != SDL_QUERY) { EventStates[type] = state; if ((type == SDL12_SYSWMEVENT) && SupportSysWM) { /* we only enable syswm in SDL2 if it makes sense. */ SDL20_EventState(SDL_SYSWMEVENT, state); } } if (state == SDL_IGNORE) { /* drop existing events of this type. */ while (SDL_PeepEvents(&e, 1, SDL_GETEVENT, (1< real_aspect) { /* We want a wider aspect ratio than is available - letterbox it */ const float scale = ((float) physical_width) / OpenGLLogicalScalingWidth; dstrect.x = 0; dstrect.w = physical_width; dstrect.h = (int)SDL20_floor(OpenGLLogicalScalingHeight * scale); dstrect.y = (physical_height - dstrect.h) / 2; } else { /* We want a narrower aspect ratio than is available - use side-bars */ const float scale = ((float)physical_height) / OpenGLLogicalScalingHeight; dstrect.y = 0; dstrect.h = physical_height; dstrect.w = (int)SDL20_floor(OpenGLLogicalScalingWidth * scale); dstrect.x = (physical_width - dstrect.w) / 2; } return dstrect; } /* Scale a point (e.g. absolute mouse position) to the logical scaling size */ static void AdjustOpenGLLogicalScalingPoint(int *x, int *y) { SDL_Rect viewport; int physical_w, physical_h; float scale_x, scale_y; int adjusted_x, adjusted_y; /* Don't adjust anything if we're not using Logical Scaling */ if (!OpenGLLogicalScalingFBO || !VideoWindow20) { return; } /* we want to scale based on the window size, which is dpi-scaled */ SDL20_GetWindowSize(VideoWindow20, &physical_w, &physical_h); viewport = GetOpenGLLogicalScalingViewport(physical_w, physical_h); scale_x = (float)OpenGLLogicalScalingWidth / viewport.w; scale_y = (float)OpenGLLogicalScalingHeight / viewport.h; adjusted_x = (int) ((*x - viewport.x) * scale_x); adjusted_y = (int) ((*y - viewport.y) * scale_y); /* Clamp the result to the visible window */ *x = SDL_max(SDL_min(adjusted_x, OpenGLLogicalScalingWidth), 0); *y = SDL_max(SDL_min(adjusted_y, OpenGLLogicalScalingHeight), 0); } /* Scale a vector (e.g. relative mouse movement) to the logical scaling size */ static void AdjustOpenGLLogicalScalingVector(int *x, int *y, float *rx, float *ry) { SDL_Rect viewport; int physical_w, physical_h; float scale_x, scale_y; float float_x, float_y; float trunc_x, trunc_y; /* Don't adjust anything if we're not using Logical Scaling */ if (!OpenGLLogicalScalingFBO || !VideoWindow20) { return; } /* we want to scale based on the window size, which is dpi-scaled */ SDL20_GetWindowSize(VideoWindow20, &physical_w, &physical_h); viewport = GetOpenGLLogicalScalingViewport(physical_w, physical_h); scale_x = (float)OpenGLLogicalScalingWidth / viewport.w; scale_y = (float)OpenGLLogicalScalingHeight / viewport.h; float_x = *x * scale_x + (rx ? *rx : 0.f); float_y = *y * scale_y + (ry ? *ry : 0.f); trunc_x = SDL20_truncf(float_x); trunc_y = SDL20_truncf(float_y); *x = (int)trunc_x; *y = (int)trunc_y; if (rx) { *rx = float_x - trunc_x; } if (ry) { *ry = float_y - trunc_y; } } static Uint8 MouseButtonState20to12(const Uint32 state20) { Uint8 retval = (state20 & 0x7); /* left, right, and middle will match. */ /* the X[12] buttons are different in 1.2; mousewheel was in the way. */ if (state20 & SDL_BUTTON(SDL_BUTTON_X1)) { retval |= (1<<5); } if (state20 & SDL_BUTTON(SDL_BUTTON_X2)) { retval |= (1<<6); } return retval; } DECLSPEC12 Uint8 SDLCALL SDL_GetMouseState(int *x, int *y) { const Uint8 buttons = MouseButtonState20to12(SDL20_GetMouseState(x, y)); if (x) { *x = MousePosition.x; } if (y) { *y = MousePosition.y; } return buttons; } DECLSPEC12 Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y) { return MouseButtonState20to12(SDL20_GetRelativeMouseState(x, y)); } DECLSPEC12 char * SDLCALL SDL_GetKeyName(SDL12Key key) { switch (key) { #define CASESDLK12TONAME(k, n) case k: return (char *) n CASESDLK12TONAME(SDLK12_BACKSPACE, "backspace"); CASESDLK12TONAME(SDLK12_TAB, "tab"); CASESDLK12TONAME(SDLK12_CLEAR, "clear"); CASESDLK12TONAME(SDLK12_RETURN, "return"); CASESDLK12TONAME(SDLK12_PAUSE, "pause"); CASESDLK12TONAME(SDLK12_ESCAPE, "escape"); CASESDLK12TONAME(SDLK12_SPACE, "space"); CASESDLK12TONAME(SDLK12_EXCLAIM, "!"); CASESDLK12TONAME(SDLK12_QUOTEDBL, "\""); CASESDLK12TONAME(SDLK12_HASH, "#"); CASESDLK12TONAME(SDLK12_DOLLAR, "$"); CASESDLK12TONAME(SDLK12_AMPERSAND, "&"); CASESDLK12TONAME(SDLK12_QUOTE, "'"); CASESDLK12TONAME(SDLK12_LEFTPAREN, "("); CASESDLK12TONAME(SDLK12_RIGHTPAREN, ")"); CASESDLK12TONAME(SDLK12_ASTERISK, "*"); CASESDLK12TONAME(SDLK12_PLUS, "+"); CASESDLK12TONAME(SDLK12_COMMA, ","); CASESDLK12TONAME(SDLK12_MINUS, "-"); CASESDLK12TONAME(SDLK12_PERIOD, "."); CASESDLK12TONAME(SDLK12_SLASH, "/"); CASESDLK12TONAME(SDLK12_0, "0"); CASESDLK12TONAME(SDLK12_1, "1"); CASESDLK12TONAME(SDLK12_2, "2"); CASESDLK12TONAME(SDLK12_3, "3"); CASESDLK12TONAME(SDLK12_4, "4"); CASESDLK12TONAME(SDLK12_5, "5"); CASESDLK12TONAME(SDLK12_6, "6"); CASESDLK12TONAME(SDLK12_7, "7"); CASESDLK12TONAME(SDLK12_8, "8"); CASESDLK12TONAME(SDLK12_9, "9"); CASESDLK12TONAME(SDLK12_COLON, ":"); CASESDLK12TONAME(SDLK12_SEMICOLON, ");"); CASESDLK12TONAME(SDLK12_LESS, "<"); CASESDLK12TONAME(SDLK12_EQUALS, "="); CASESDLK12TONAME(SDLK12_GREATER, ">"); CASESDLK12TONAME(SDLK12_QUESTION, "?"); CASESDLK12TONAME(SDLK12_AT, "@"); CASESDLK12TONAME(SDLK12_LEFTBRACKET, "["); CASESDLK12TONAME(SDLK12_BACKSLASH, "\\"); CASESDLK12TONAME(SDLK12_RIGHTBRACKET, "]"); CASESDLK12TONAME(SDLK12_CARET, "^"); CASESDLK12TONAME(SDLK12_UNDERSCORE, "_"); CASESDLK12TONAME(SDLK12_BACKQUOTE, "`"); CASESDLK12TONAME(SDLK12_a, "a"); CASESDLK12TONAME(SDLK12_b, "b"); CASESDLK12TONAME(SDLK12_c, "c"); CASESDLK12TONAME(SDLK12_d, "d"); CASESDLK12TONAME(SDLK12_e, "e"); CASESDLK12TONAME(SDLK12_f, "f"); CASESDLK12TONAME(SDLK12_g, "g"); CASESDLK12TONAME(SDLK12_h, "h"); CASESDLK12TONAME(SDLK12_i, "i"); CASESDLK12TONAME(SDLK12_j, "j"); CASESDLK12TONAME(SDLK12_k, "k"); CASESDLK12TONAME(SDLK12_l, "l"); CASESDLK12TONAME(SDLK12_m, "m"); CASESDLK12TONAME(SDLK12_n, "n"); CASESDLK12TONAME(SDLK12_o, "o"); CASESDLK12TONAME(SDLK12_p, "p"); CASESDLK12TONAME(SDLK12_q, "q"); CASESDLK12TONAME(SDLK12_r, "r"); CASESDLK12TONAME(SDLK12_s, "s"); CASESDLK12TONAME(SDLK12_t, "t"); CASESDLK12TONAME(SDLK12_u, "u"); CASESDLK12TONAME(SDLK12_v, "v"); CASESDLK12TONAME(SDLK12_w, "w"); CASESDLK12TONAME(SDLK12_x, "x"); CASESDLK12TONAME(SDLK12_y, "y"); CASESDLK12TONAME(SDLK12_z, "z"); CASESDLK12TONAME(SDLK12_DELETE, "delete"); CASESDLK12TONAME(SDLK12_WORLD_0, "world 0"); CASESDLK12TONAME(SDLK12_WORLD_1, "world 1"); CASESDLK12TONAME(SDLK12_WORLD_2, "world 2"); CASESDLK12TONAME(SDLK12_WORLD_3, "world 3"); CASESDLK12TONAME(SDLK12_WORLD_4, "world 4"); CASESDLK12TONAME(SDLK12_WORLD_5, "world 5"); CASESDLK12TONAME(SDLK12_WORLD_6, "world 6"); CASESDLK12TONAME(SDLK12_WORLD_7, "world 7"); CASESDLK12TONAME(SDLK12_WORLD_8, "world 8"); CASESDLK12TONAME(SDLK12_WORLD_9, "world 9"); CASESDLK12TONAME(SDLK12_WORLD_10, "world 10"); CASESDLK12TONAME(SDLK12_WORLD_11, "world 11"); CASESDLK12TONAME(SDLK12_WORLD_12, "world 12"); CASESDLK12TONAME(SDLK12_WORLD_13, "world 13"); CASESDLK12TONAME(SDLK12_WORLD_14, "world 14"); CASESDLK12TONAME(SDLK12_WORLD_15, "world 15"); CASESDLK12TONAME(SDLK12_WORLD_16, "world 16"); CASESDLK12TONAME(SDLK12_WORLD_17, "world 17"); CASESDLK12TONAME(SDLK12_WORLD_18, "world 18"); CASESDLK12TONAME(SDLK12_WORLD_19, "world 19"); CASESDLK12TONAME(SDLK12_WORLD_20, "world 20"); CASESDLK12TONAME(SDLK12_WORLD_21, "world 21"); CASESDLK12TONAME(SDLK12_WORLD_22, "world 22"); CASESDLK12TONAME(SDLK12_WORLD_23, "world 23"); CASESDLK12TONAME(SDLK12_WORLD_24, "world 24"); CASESDLK12TONAME(SDLK12_WORLD_25, "world 25"); CASESDLK12TONAME(SDLK12_WORLD_26, "world 26"); CASESDLK12TONAME(SDLK12_WORLD_27, "world 27"); CASESDLK12TONAME(SDLK12_WORLD_28, "world 28"); CASESDLK12TONAME(SDLK12_WORLD_29, "world 29"); CASESDLK12TONAME(SDLK12_WORLD_30, "world 30"); CASESDLK12TONAME(SDLK12_WORLD_31, "world 31"); CASESDLK12TONAME(SDLK12_WORLD_32, "world 32"); CASESDLK12TONAME(SDLK12_WORLD_33, "world 33"); CASESDLK12TONAME(SDLK12_WORLD_34, "world 34"); CASESDLK12TONAME(SDLK12_WORLD_35, "world 35"); CASESDLK12TONAME(SDLK12_WORLD_36, "world 36"); CASESDLK12TONAME(SDLK12_WORLD_37, "world 37"); CASESDLK12TONAME(SDLK12_WORLD_38, "world 38"); CASESDLK12TONAME(SDLK12_WORLD_39, "world 39"); CASESDLK12TONAME(SDLK12_WORLD_40, "world 40"); CASESDLK12TONAME(SDLK12_WORLD_41, "world 41"); CASESDLK12TONAME(SDLK12_WORLD_42, "world 42"); CASESDLK12TONAME(SDLK12_WORLD_43, "world 43"); CASESDLK12TONAME(SDLK12_WORLD_44, "world 44"); CASESDLK12TONAME(SDLK12_WORLD_45, "world 45"); CASESDLK12TONAME(SDLK12_WORLD_46, "world 46"); CASESDLK12TONAME(SDLK12_WORLD_47, "world 47"); CASESDLK12TONAME(SDLK12_WORLD_48, "world 48"); CASESDLK12TONAME(SDLK12_WORLD_49, "world 49"); CASESDLK12TONAME(SDLK12_WORLD_50, "world 50"); CASESDLK12TONAME(SDLK12_WORLD_51, "world 51"); CASESDLK12TONAME(SDLK12_WORLD_52, "world 52"); CASESDLK12TONAME(SDLK12_WORLD_53, "world 53"); CASESDLK12TONAME(SDLK12_WORLD_54, "world 54"); CASESDLK12TONAME(SDLK12_WORLD_55, "world 55"); CASESDLK12TONAME(SDLK12_WORLD_56, "world 56"); CASESDLK12TONAME(SDLK12_WORLD_57, "world 57"); CASESDLK12TONAME(SDLK12_WORLD_58, "world 58"); CASESDLK12TONAME(SDLK12_WORLD_59, "world 59"); CASESDLK12TONAME(SDLK12_WORLD_60, "world 60"); CASESDLK12TONAME(SDLK12_WORLD_61, "world 61"); CASESDLK12TONAME(SDLK12_WORLD_62, "world 62"); CASESDLK12TONAME(SDLK12_WORLD_63, "world 63"); CASESDLK12TONAME(SDLK12_WORLD_64, "world 64"); CASESDLK12TONAME(SDLK12_WORLD_65, "world 65"); CASESDLK12TONAME(SDLK12_WORLD_66, "world 66"); CASESDLK12TONAME(SDLK12_WORLD_67, "world 67"); CASESDLK12TONAME(SDLK12_WORLD_68, "world 68"); CASESDLK12TONAME(SDLK12_WORLD_69, "world 69"); CASESDLK12TONAME(SDLK12_WORLD_70, "world 70"); CASESDLK12TONAME(SDLK12_WORLD_71, "world 71"); CASESDLK12TONAME(SDLK12_WORLD_72, "world 72"); CASESDLK12TONAME(SDLK12_WORLD_73, "world 73"); CASESDLK12TONAME(SDLK12_WORLD_74, "world 74"); CASESDLK12TONAME(SDLK12_WORLD_75, "world 75"); CASESDLK12TONAME(SDLK12_WORLD_76, "world 76"); CASESDLK12TONAME(SDLK12_WORLD_77, "world 77"); CASESDLK12TONAME(SDLK12_WORLD_78, "world 78"); CASESDLK12TONAME(SDLK12_WORLD_79, "world 79"); CASESDLK12TONAME(SDLK12_WORLD_80, "world 80"); CASESDLK12TONAME(SDLK12_WORLD_81, "world 81"); CASESDLK12TONAME(SDLK12_WORLD_82, "world 82"); CASESDLK12TONAME(SDLK12_WORLD_83, "world 83"); CASESDLK12TONAME(SDLK12_WORLD_84, "world 84"); CASESDLK12TONAME(SDLK12_WORLD_85, "world 85"); CASESDLK12TONAME(SDLK12_WORLD_86, "world 86"); CASESDLK12TONAME(SDLK12_WORLD_87, "world 87"); CASESDLK12TONAME(SDLK12_WORLD_88, "world 88"); CASESDLK12TONAME(SDLK12_WORLD_89, "world 89"); CASESDLK12TONAME(SDLK12_WORLD_90, "world 90"); CASESDLK12TONAME(SDLK12_WORLD_91, "world 91"); CASESDLK12TONAME(SDLK12_WORLD_92, "world 92"); CASESDLK12TONAME(SDLK12_WORLD_93, "world 93"); CASESDLK12TONAME(SDLK12_WORLD_94, "world 94"); CASESDLK12TONAME(SDLK12_WORLD_95, "world 95"); CASESDLK12TONAME(SDLK12_KP0, "[0]"); CASESDLK12TONAME(SDLK12_KP1, "[1]"); CASESDLK12TONAME(SDLK12_KP2, "[2]"); CASESDLK12TONAME(SDLK12_KP3, "[3]"); CASESDLK12TONAME(SDLK12_KP4, "[4]"); CASESDLK12TONAME(SDLK12_KP5, "[5]"); CASESDLK12TONAME(SDLK12_KP6, "[6]"); CASESDLK12TONAME(SDLK12_KP7, "[7]"); CASESDLK12TONAME(SDLK12_KP8, "[8]"); CASESDLK12TONAME(SDLK12_KP9, "[9]"); CASESDLK12TONAME(SDLK12_KP_PERIOD, "[.]"); CASESDLK12TONAME(SDLK12_KP_DIVIDE, "[/]"); CASESDLK12TONAME(SDLK12_KP_MULTIPLY, "[*]"); CASESDLK12TONAME(SDLK12_KP_MINUS, "[-]"); CASESDLK12TONAME(SDLK12_KP_PLUS, "[+]"); CASESDLK12TONAME(SDLK12_KP_ENTER, "enter"); CASESDLK12TONAME(SDLK12_KP_EQUALS, "equals"); CASESDLK12TONAME(SDLK12_UP, "up"); CASESDLK12TONAME(SDLK12_DOWN, "down"); CASESDLK12TONAME(SDLK12_RIGHT, "right"); CASESDLK12TONAME(SDLK12_LEFT, "left"); CASESDLK12TONAME(SDLK12_INSERT, "insert"); CASESDLK12TONAME(SDLK12_HOME, "home"); CASESDLK12TONAME(SDLK12_END, "end"); CASESDLK12TONAME(SDLK12_PAGEUP, "page up"); CASESDLK12TONAME(SDLK12_PAGEDOWN, "page down"); CASESDLK12TONAME(SDLK12_F1, "f1"); CASESDLK12TONAME(SDLK12_F2, "f2"); CASESDLK12TONAME(SDLK12_F3, "f3"); CASESDLK12TONAME(SDLK12_F4, "f4"); CASESDLK12TONAME(SDLK12_F5, "f5"); CASESDLK12TONAME(SDLK12_F6, "f6"); CASESDLK12TONAME(SDLK12_F7, "f7"); CASESDLK12TONAME(SDLK12_F8, "f8"); CASESDLK12TONAME(SDLK12_F9, "f9"); CASESDLK12TONAME(SDLK12_F10, "f10"); CASESDLK12TONAME(SDLK12_F11, "f11"); CASESDLK12TONAME(SDLK12_F12, "f12"); CASESDLK12TONAME(SDLK12_F13, "f13"); CASESDLK12TONAME(SDLK12_F14, "f14"); CASESDLK12TONAME(SDLK12_F15, "f15"); CASESDLK12TONAME(SDLK12_NUMLOCK, "numlock"); CASESDLK12TONAME(SDLK12_CAPSLOCK, "caps lock"); CASESDLK12TONAME(SDLK12_SCROLLOCK, "scroll lock"); CASESDLK12TONAME(SDLK12_RSHIFT, "right shift"); CASESDLK12TONAME(SDLK12_LSHIFT, "left shift"); CASESDLK12TONAME(SDLK12_RCTRL, "right ctrl"); CASESDLK12TONAME(SDLK12_LCTRL, "left ctrl"); CASESDLK12TONAME(SDLK12_RALT, "right alt"); CASESDLK12TONAME(SDLK12_LALT, "left alt"); CASESDLK12TONAME(SDLK12_RMETA, "right meta"); CASESDLK12TONAME(SDLK12_LMETA, "left meta"); CASESDLK12TONAME(SDLK12_LSUPER, "left super"); /* "Windows" keys */ CASESDLK12TONAME(SDLK12_RSUPER, "right super"); CASESDLK12TONAME(SDLK12_MODE, "alt gr"); CASESDLK12TONAME(SDLK12_COMPOSE, "compose"); CASESDLK12TONAME(SDLK12_HELP, "help"); CASESDLK12TONAME(SDLK12_PRINT, "print screen"); CASESDLK12TONAME(SDLK12_SYSREQ, "sys req"); CASESDLK12TONAME(SDLK12_BREAK, "break"); CASESDLK12TONAME(SDLK12_MENU, "menu"); CASESDLK12TONAME(SDLK12_POWER, "power"); CASESDLK12TONAME(SDLK12_EURO, "euro"); CASESDLK12TONAME(SDLK12_UNDO, "undo"); #undef CASESDLK12TONAME default: break; } return (char *) "unknown key"; } static SDL12Key Keysym20to12(const SDL_Keycode keysym20) { if (((int) keysym20) <= 255) { /* (most of) low-ASCII maps directly, * and so does the Latin-1 range (128-255) */ if (keysym20 == SDLK_PAUSE) { return SDLK12_PAUSE; } if (keysym20 == SDLK_CLEAR) { return SDLK12_CLEAR; } return (SDL12Key) keysym20; } switch (keysym20) { #define CASEKEYSYM20TO12(k20, k12) case SDLK_##k20: return SDLK12_##k12 CASEKEYSYM20TO12(KP_0, KP0); CASEKEYSYM20TO12(KP_1, KP1); CASEKEYSYM20TO12(KP_2, KP2); CASEKEYSYM20TO12(KP_3, KP3); CASEKEYSYM20TO12(KP_4, KP4); CASEKEYSYM20TO12(KP_5, KP5); CASEKEYSYM20TO12(KP_6, KP6); CASEKEYSYM20TO12(KP_7, KP7); CASEKEYSYM20TO12(KP_8, KP8); CASEKEYSYM20TO12(KP_9, KP9); CASEKEYSYM20TO12(NUMLOCKCLEAR, NUMLOCK); CASEKEYSYM20TO12(SCROLLLOCK, SCROLLOCK); CASEKEYSYM20TO12(RGUI, RMETA); CASEKEYSYM20TO12(LGUI, LMETA); CASEKEYSYM20TO12(PRINTSCREEN, PRINT); CASEKEYSYM20TO12(APPLICATION, MENU); #undef CASEKEYSYM20TO12 #define CASEKEYSYM20TO12(k) case SDLK_##k: return SDLK12_##k CASEKEYSYM20TO12(CLEAR); CASEKEYSYM20TO12(PAUSE); CASEKEYSYM20TO12(KP_PERIOD); CASEKEYSYM20TO12(KP_DIVIDE); CASEKEYSYM20TO12(KP_MULTIPLY); CASEKEYSYM20TO12(KP_MINUS); CASEKEYSYM20TO12(KP_PLUS); CASEKEYSYM20TO12(KP_ENTER); CASEKEYSYM20TO12(KP_EQUALS); CASEKEYSYM20TO12(UP); CASEKEYSYM20TO12(DOWN); CASEKEYSYM20TO12(RIGHT); CASEKEYSYM20TO12(LEFT); CASEKEYSYM20TO12(INSERT); CASEKEYSYM20TO12(HOME); CASEKEYSYM20TO12(END); CASEKEYSYM20TO12(PAGEUP); CASEKEYSYM20TO12(PAGEDOWN); CASEKEYSYM20TO12(F1); CASEKEYSYM20TO12(F2); CASEKEYSYM20TO12(F3); CASEKEYSYM20TO12(F4); CASEKEYSYM20TO12(F5); CASEKEYSYM20TO12(F6); CASEKEYSYM20TO12(F7); CASEKEYSYM20TO12(F8); CASEKEYSYM20TO12(F9); CASEKEYSYM20TO12(F10); CASEKEYSYM20TO12(F11); CASEKEYSYM20TO12(F12); CASEKEYSYM20TO12(F13); CASEKEYSYM20TO12(F14); CASEKEYSYM20TO12(F15); CASEKEYSYM20TO12(CAPSLOCK); CASEKEYSYM20TO12(RSHIFT); CASEKEYSYM20TO12(LSHIFT); CASEKEYSYM20TO12(RCTRL); CASEKEYSYM20TO12(LCTRL); CASEKEYSYM20TO12(RALT); CASEKEYSYM20TO12(LALT); CASEKEYSYM20TO12(MODE); CASEKEYSYM20TO12(HELP); CASEKEYSYM20TO12(SYSREQ); CASEKEYSYM20TO12(MENU); CASEKEYSYM20TO12(POWER); CASEKEYSYM20TO12(UNDO); #undef CASEKEYSYM20TO12 /* Map the "World Keys" (SDLK_WORLD_0 = 0xA0 to SDLK_WORLD_95 = 0xFF). * In SDL2 they're the UCS-4 (32bit unicode) code for the key, * in SDL1.2 (on X11 at least) they were the X11_KeySym & 0xFF, * if (X11_KeySym >> 8)) was either 0 to 8 or 0x0A or 0x0C or 0x0E * So map all those used UCS-4 codes to the corresponding SDLK12_WORLD_* codes * Note that the Latin-1 range (keysym20 <= 255) is already handled at the top of this function * Luckily X11's keysymdef.h lists both the values of the constants and their UCS4-value, like * #define XK_Aogonek 0x01a1 / * U+0104 LATIN CAPITAL LETTER A WITH OGONEK * / * So I'm using that as a reference for our mappings, which only use * the lowest byte of the XK_* value, because of X11_KeySym & 0xFF in SDL1.2 * * case UCS4_code: return (SDL12Key)lowest_byte_of_corresponding_X11_KeySym; */ /* Latin-2 */ case 0x0104: return (SDL12Key)0xa1; case 0x02D8: return (SDL12Key)0xa2; case 0x0141: return (SDL12Key)0xa3; case 0x013D: return (SDL12Key)0xa5; case 0x015A: return (SDL12Key)0xa6; case 0x0160: return (SDL12Key)0xa9; case 0x015E: return (SDL12Key)0xaa; case 0x0164: return (SDL12Key)0xab; case 0x0179: return (SDL12Key)0xac; case 0x017D: return (SDL12Key)0xae; case 0x017B: return (SDL12Key)0xaf; case 0x0105: return (SDL12Key)0xb1; case 0x02DB: return (SDL12Key)0xb2; case 0x0142: return (SDL12Key)0xb3; case 0x013E: return (SDL12Key)0xb5; case 0x015B: return (SDL12Key)0xb6; case 0x02C7: return (SDL12Key)0xb7; case 0x0161: return (SDL12Key)0xb9; case 0x015F: return (SDL12Key)0xba; case 0x0165: return (SDL12Key)0xbb; case 0x017A: return (SDL12Key)0xbc; case 0x02DD: return (SDL12Key)0xbd; case 0x017E: return (SDL12Key)0xbe; case 0x017C: return (SDL12Key)0xbf; case 0x0154: return (SDL12Key)0xc0; case 0x0102: return (SDL12Key)0xc3; case 0x0139: return (SDL12Key)0xc5; case 0x0106: return (SDL12Key)0xc6; case 0x010C: return (SDL12Key)0xc8; case 0x0118: return (SDL12Key)0xca; case 0x011A: return (SDL12Key)0xcc; case 0x010E: return (SDL12Key)0xcf; case 0x0110: return (SDL12Key)0xd0; case 0x0143: return (SDL12Key)0xd1; case 0x0147: return (SDL12Key)0xd2; case 0x0150: return (SDL12Key)0xd5; case 0x0158: return (SDL12Key)0xd8; case 0x016E: return (SDL12Key)0xd9; case 0x0170: return (SDL12Key)0xdb; case 0x0162: return (SDL12Key)0xde; case 0x0155: return (SDL12Key)0xe0; case 0x0103: return (SDL12Key)0xe3; case 0x013A: return (SDL12Key)0xe5; case 0x0107: return (SDL12Key)0xe6; case 0x010D: return (SDL12Key)0xe8; case 0x0119: return (SDL12Key)0xea; case 0x011B: return (SDL12Key)0xec; case 0x010F: return (SDL12Key)0xef; case 0x0111: return (SDL12Key)0xf0; case 0x0144: return (SDL12Key)0xf1; case 0x0148: return (SDL12Key)0xf2; case 0x0151: return (SDL12Key)0xf5; case 0x0159: return (SDL12Key)0xf8; case 0x016F: return (SDL12Key)0xf9; case 0x0171: return (SDL12Key)0xfb; case 0x0163: return (SDL12Key)0xfe; case 0x02D9: return (SDL12Key)0xff; /* Latin-3 */ case 0x0126: return (SDL12Key)0xa1; case 0x0124: return (SDL12Key)0xa6; case 0x0130: return (SDL12Key)0xa9; case 0x011E: return (SDL12Key)0xab; case 0x0134: return (SDL12Key)0xac; case 0x0127: return (SDL12Key)0xb1; case 0x0125: return (SDL12Key)0xb6; case 0x0131: return (SDL12Key)0xb9; case 0x011F: return (SDL12Key)0xbb; case 0x0135: return (SDL12Key)0xbc; case 0x010A: return (SDL12Key)0xc5; case 0x0108: return (SDL12Key)0xc6; case 0x0120: return (SDL12Key)0xd5; case 0x011C: return (SDL12Key)0xd8; case 0x016C: return (SDL12Key)0xdd; case 0x015C: return (SDL12Key)0xde; case 0x010B: return (SDL12Key)0xe5; case 0x0109: return (SDL12Key)0xe6; case 0x0121: return (SDL12Key)0xf5; case 0x011D: return (SDL12Key)0xf8; case 0x016D: return (SDL12Key)0xfd; case 0x015D: return (SDL12Key)0xfe; /* Latin 4 */ case 0x0138: return (SDL12Key)0xa2; case 0x0156: return (SDL12Key)0xa3; case 0x0128: return (SDL12Key)0xa5; case 0x013B: return (SDL12Key)0xa6; case 0x0112: return (SDL12Key)0xaa; case 0x0122: return (SDL12Key)0xab; case 0x0166: return (SDL12Key)0xac; case 0x0157: return (SDL12Key)0xb3; case 0x0129: return (SDL12Key)0xb5; case 0x013C: return (SDL12Key)0xb6; case 0x0113: return (SDL12Key)0xba; case 0x0123: return (SDL12Key)0xbb; case 0x0167: return (SDL12Key)0xbc; case 0x014A: return (SDL12Key)0xbd; case 0x014B: return (SDL12Key)0xbf; case 0x0100: return (SDL12Key)0xc0; case 0x012E: return (SDL12Key)0xc7; case 0x0116: return (SDL12Key)0xcc; case 0x012A: return (SDL12Key)0xcf; case 0x0145: return (SDL12Key)0xd1; case 0x014C: return (SDL12Key)0xd2; case 0x0136: return (SDL12Key)0xd3; case 0x0172: return (SDL12Key)0xd9; case 0x0168: return (SDL12Key)0xdd; case 0x016A: return (SDL12Key)0xde; case 0x0101: return (SDL12Key)0xe0; case 0x012F: return (SDL12Key)0xe7; case 0x0117: return (SDL12Key)0xec; case 0x012B: return (SDL12Key)0xef; case 0x0146: return (SDL12Key)0xf1; case 0x014D: return (SDL12Key)0xf2; case 0x0137: return (SDL12Key)0xf3; case 0x0173: return (SDL12Key)0xf9; case 0x0169: return (SDL12Key)0xfd; case 0x016B: return (SDL12Key)0xfe; /* Katakana */ case 0x203E: return (SDL12Key)0x7e; case 0x3002: return (SDL12Key)0xa1; case 0x300C: return (SDL12Key)0xa2; case 0x300D: return (SDL12Key)0xa3; case 0x3001: return (SDL12Key)0xa4; case 0x30FB: return (SDL12Key)0xa5; case 0x30F2: return (SDL12Key)0xa6; case 0x30A1: return (SDL12Key)0xa7; case 0x30A3: return (SDL12Key)0xa8; case 0x30A5: return (SDL12Key)0xa9; case 0x30A7: return (SDL12Key)0xaa; case 0x30A9: return (SDL12Key)0xab; case 0x30E3: return (SDL12Key)0xac; case 0x30E5: return (SDL12Key)0xad; case 0x30E7: return (SDL12Key)0xae; case 0x30C3: return (SDL12Key)0xaf; case 0x30FC: return (SDL12Key)0xb0; case 0x30A2: return (SDL12Key)0xb1; case 0x30A4: return (SDL12Key)0xb2; case 0x30A6: return (SDL12Key)0xb3; case 0x30A8: return (SDL12Key)0xb4; case 0x30AA: return (SDL12Key)0xb5; case 0x30AB: return (SDL12Key)0xb6; case 0x30AD: return (SDL12Key)0xb7; case 0x30AF: return (SDL12Key)0xb8; case 0x30B1: return (SDL12Key)0xb9; case 0x30B3: return (SDL12Key)0xba; case 0x30B5: return (SDL12Key)0xbb; case 0x30B7: return (SDL12Key)0xbc; case 0x30B9: return (SDL12Key)0xbd; case 0x30BB: return (SDL12Key)0xbe; case 0x30BD: return (SDL12Key)0xbf; case 0x30BF: return (SDL12Key)0xc0; case 0x30C1: return (SDL12Key)0xc1; case 0x30C4: return (SDL12Key)0xc2; case 0x30C6: return (SDL12Key)0xc3; case 0x30C8: return (SDL12Key)0xc4; case 0x30CA: return (SDL12Key)0xc5; case 0x30CB: return (SDL12Key)0xc6; case 0x30CC: return (SDL12Key)0xc7; case 0x30CD: return (SDL12Key)0xc8; case 0x30CE: return (SDL12Key)0xc9; case 0x30CF: return (SDL12Key)0xca; case 0x30D2: return (SDL12Key)0xcb; case 0x30D5: return (SDL12Key)0xcc; case 0x30D8: return (SDL12Key)0xcd; case 0x30DB: return (SDL12Key)0xce; case 0x30DE: return (SDL12Key)0xcf; case 0x30DF: return (SDL12Key)0xd0; case 0x30E0: return (SDL12Key)0xd1; case 0x30E1: return (SDL12Key)0xd2; case 0x30E2: return (SDL12Key)0xd3; case 0x30E4: return (SDL12Key)0xd4; case 0x30E6: return (SDL12Key)0xd5; case 0x30E8: return (SDL12Key)0xd6; case 0x30E9: return (SDL12Key)0xd7; case 0x30EA: return (SDL12Key)0xd8; case 0x30EB: return (SDL12Key)0xd9; case 0x30EC: return (SDL12Key)0xda; case 0x30ED: return (SDL12Key)0xdb; case 0x30EF: return (SDL12Key)0xdc; case 0x30F3: return (SDL12Key)0xdd; case 0x309B: return (SDL12Key)0xde; case 0x309C: return (SDL12Key)0xdf; /* Arabic */ case 0x060C: return (SDL12Key)0xac; case 0x061B: return (SDL12Key)0xbb; case 0x061F: return (SDL12Key)0xbf; case 0x0621: return (SDL12Key)0xc1; case 0x0622: return (SDL12Key)0xc2; case 0x0623: return (SDL12Key)0xc3; case 0x0624: return (SDL12Key)0xc4; case 0x0625: return (SDL12Key)0xc5; case 0x0626: return (SDL12Key)0xc6; case 0x0627: return (SDL12Key)0xc7; case 0x0628: return (SDL12Key)0xc8; case 0x0629: return (SDL12Key)0xc9; case 0x062A: return (SDL12Key)0xca; case 0x062B: return (SDL12Key)0xcb; case 0x062C: return (SDL12Key)0xcc; case 0x062D: return (SDL12Key)0xcd; case 0x062E: return (SDL12Key)0xce; case 0x062F: return (SDL12Key)0xcf; case 0x0630: return (SDL12Key)0xd0; case 0x0631: return (SDL12Key)0xd1; case 0x0632: return (SDL12Key)0xd2; case 0x0633: return (SDL12Key)0xd3; case 0x0634: return (SDL12Key)0xd4; case 0x0635: return (SDL12Key)0xd5; case 0x0636: return (SDL12Key)0xd6; case 0x0637: return (SDL12Key)0xd7; case 0x0638: return (SDL12Key)0xd8; case 0x0639: return (SDL12Key)0xd9; case 0x063A: return (SDL12Key)0xda; case 0x0640: return (SDL12Key)0xe0; case 0x0641: return (SDL12Key)0xe1; case 0x0642: return (SDL12Key)0xe2; case 0x0643: return (SDL12Key)0xe3; case 0x0644: return (SDL12Key)0xe4; case 0x0645: return (SDL12Key)0xe5; case 0x0646: return (SDL12Key)0xe6; case 0x0647: return (SDL12Key)0xe7; case 0x0648: return (SDL12Key)0xe8; case 0x0649: return (SDL12Key)0xe9; case 0x064A: return (SDL12Key)0xea; case 0x064B: return (SDL12Key)0xeb; case 0x064C: return (SDL12Key)0xec; case 0x064D: return (SDL12Key)0xed; case 0x064E: return (SDL12Key)0xee; case 0x064F: return (SDL12Key)0xef; case 0x0650: return (SDL12Key)0xf0; case 0x0651: return (SDL12Key)0xf1; case 0x0652: return (SDL12Key)0xf2; /* Cyrillic */ case 0x0452: return (SDL12Key)0xa1; case 0x0453: return (SDL12Key)0xa2; case 0x0451: return (SDL12Key)0xa3; case 0x0454: return (SDL12Key)0xa4; case 0x0455: return (SDL12Key)0xa5; case 0x0456: return (SDL12Key)0xa6; case 0x0457: return (SDL12Key)0xa7; case 0x0458: return (SDL12Key)0xa8; case 0x0459: return (SDL12Key)0xa9; case 0x045A: return (SDL12Key)0xaa; case 0x045B: return (SDL12Key)0xab; case 0x045C: return (SDL12Key)0xac; case 0x0491: return (SDL12Key)0xad; case 0x045E: return (SDL12Key)0xae; case 0x045F: return (SDL12Key)0xaf; case 0x2116: return (SDL12Key)0xb0; case 0x0402: return (SDL12Key)0xb1; case 0x0403: return (SDL12Key)0xb2; case 0x0401: return (SDL12Key)0xb3; case 0x0404: return (SDL12Key)0xb4; case 0x0405: return (SDL12Key)0xb5; case 0x0406: return (SDL12Key)0xb6; case 0x0407: return (SDL12Key)0xb7; case 0x0408: return (SDL12Key)0xb8; case 0x0409: return (SDL12Key)0xb9; case 0x040A: return (SDL12Key)0xba; case 0x040B: return (SDL12Key)0xbb; case 0x040C: return (SDL12Key)0xbc; case 0x0490: return (SDL12Key)0xbd; case 0x040E: return (SDL12Key)0xbe; case 0x040F: return (SDL12Key)0xbf; case 0x044E: return (SDL12Key)0xc0; case 0x0430: return (SDL12Key)0xc1; case 0x0431: return (SDL12Key)0xc2; case 0x0446: return (SDL12Key)0xc3; case 0x0434: return (SDL12Key)0xc4; case 0x0435: return (SDL12Key)0xc5; case 0x0444: return (SDL12Key)0xc6; case 0x0433: return (SDL12Key)0xc7; case 0x0445: return (SDL12Key)0xc8; case 0x0438: return (SDL12Key)0xc9; case 0x0439: return (SDL12Key)0xca; case 0x043A: return (SDL12Key)0xcb; case 0x043B: return (SDL12Key)0xcc; case 0x043C: return (SDL12Key)0xcd; case 0x043D: return (SDL12Key)0xce; case 0x043E: return (SDL12Key)0xcf; case 0x043F: return (SDL12Key)0xd0; case 0x044F: return (SDL12Key)0xd1; case 0x0440: return (SDL12Key)0xd2; case 0x0441: return (SDL12Key)0xd3; case 0x0442: return (SDL12Key)0xd4; case 0x0443: return (SDL12Key)0xd5; case 0x0436: return (SDL12Key)0xd6; case 0x0432: return (SDL12Key)0xd7; case 0x044C: return (SDL12Key)0xd8; case 0x044B: return (SDL12Key)0xd9; case 0x0437: return (SDL12Key)0xda; case 0x0448: return (SDL12Key)0xdb; case 0x044D: return (SDL12Key)0xdc; case 0x0449: return (SDL12Key)0xdd; case 0x0447: return (SDL12Key)0xde; case 0x044A: return (SDL12Key)0xdf; case 0x042E: return (SDL12Key)0xe0; case 0x0410: return (SDL12Key)0xe1; case 0x0411: return (SDL12Key)0xe2; case 0x0426: return (SDL12Key)0xe3; case 0x0414: return (SDL12Key)0xe4; case 0x0415: return (SDL12Key)0xe5; case 0x0424: return (SDL12Key)0xe6; case 0x0413: return (SDL12Key)0xe7; case 0x0425: return (SDL12Key)0xe8; case 0x0418: return (SDL12Key)0xe9; case 0x0419: return (SDL12Key)0xea; case 0x041A: return (SDL12Key)0xeb; case 0x041B: return (SDL12Key)0xec; case 0x041C: return (SDL12Key)0xed; case 0x041D: return (SDL12Key)0xee; case 0x041E: return (SDL12Key)0xef; case 0x041F: return (SDL12Key)0xf0; case 0x042F: return (SDL12Key)0xf1; case 0x0420: return (SDL12Key)0xf2; case 0x0421: return (SDL12Key)0xf3; case 0x0422: return (SDL12Key)0xf4; case 0x0423: return (SDL12Key)0xf5; case 0x0416: return (SDL12Key)0xf6; case 0x0412: return (SDL12Key)0xf7; case 0x042C: return (SDL12Key)0xf8; case 0x042B: return (SDL12Key)0xf9; case 0x0417: return (SDL12Key)0xfa; case 0x0428: return (SDL12Key)0xfb; case 0x042D: return (SDL12Key)0xfc; case 0x0429: return (SDL12Key)0xfd; case 0x0427: return (SDL12Key)0xfe; case 0x042A: return (SDL12Key)0xff; /* Greek */ case 0x0386: return (SDL12Key)0xa1; case 0x0388: return (SDL12Key)0xa2; case 0x0389: return (SDL12Key)0xa3; case 0x038A: return (SDL12Key)0xa4; case 0x03AA: return (SDL12Key)0xa5; case 0x038C: return (SDL12Key)0xa7; case 0x038E: return (SDL12Key)0xa8; case 0x03AB: return (SDL12Key)0xa9; case 0x038F: return (SDL12Key)0xab; case 0x0385: return (SDL12Key)0xae; case 0x2015: return (SDL12Key)0xaf; case 0x03AC: return (SDL12Key)0xb1; case 0x03AD: return (SDL12Key)0xb2; case 0x03AE: return (SDL12Key)0xb3; case 0x03AF: return (SDL12Key)0xb4; case 0x03CA: return (SDL12Key)0xb5; case 0x0390: return (SDL12Key)0xb6; case 0x03CC: return (SDL12Key)0xb7; case 0x03CD: return (SDL12Key)0xb8; case 0x03CB: return (SDL12Key)0xb9; case 0x03B0: return (SDL12Key)0xba; case 0x03CE: return (SDL12Key)0xbb; case 0x0391: return (SDL12Key)0xc1; case 0x0392: return (SDL12Key)0xc2; case 0x0393: return (SDL12Key)0xc3; case 0x0394: return (SDL12Key)0xc4; case 0x0395: return (SDL12Key)0xc5; case 0x0396: return (SDL12Key)0xc6; case 0x0397: return (SDL12Key)0xc7; case 0x0398: return (SDL12Key)0xc8; case 0x0399: return (SDL12Key)0xc9; case 0x039A: return (SDL12Key)0xca; case 0x039B: return (SDL12Key)0xcb; case 0x039C: return (SDL12Key)0xcc; case 0x039D: return (SDL12Key)0xcd; case 0x039E: return (SDL12Key)0xce; case 0x039F: return (SDL12Key)0xcf; case 0x03A0: return (SDL12Key)0xd0; case 0x03A1: return (SDL12Key)0xd1; case 0x03A3: return (SDL12Key)0xd2; case 0x03A4: return (SDL12Key)0xd4; case 0x03A5: return (SDL12Key)0xd5; case 0x03A6: return (SDL12Key)0xd6; case 0x03A7: return (SDL12Key)0xd7; case 0x03A8: return (SDL12Key)0xd8; case 0x03A9: return (SDL12Key)0xd9; case 0x03B1: return (SDL12Key)0xe1; case 0x03B2: return (SDL12Key)0xe2; case 0x03B3: return (SDL12Key)0xe3; case 0x03B4: return (SDL12Key)0xe4; case 0x03B5: return (SDL12Key)0xe5; case 0x03B6: return (SDL12Key)0xe6; case 0x03B7: return (SDL12Key)0xe7; case 0x03B8: return (SDL12Key)0xe8; case 0x03B9: return (SDL12Key)0xe9; case 0x03BA: return (SDL12Key)0xea; case 0x03BB: return (SDL12Key)0xeb; case 0x03BC: return (SDL12Key)0xec; case 0x03BD: return (SDL12Key)0xed; case 0x03BE: return (SDL12Key)0xee; case 0x03BF: return (SDL12Key)0xef; case 0x03C0: return (SDL12Key)0xf0; case 0x03C1: return (SDL12Key)0xf1; case 0x03C3: return (SDL12Key)0xf2; case 0x03C2: return (SDL12Key)0xf3; case 0x03C4: return (SDL12Key)0xf4; case 0x03C5: return (SDL12Key)0xf5; case 0x03C6: return (SDL12Key)0xf6; case 0x03C7: return (SDL12Key)0xf7; case 0x03C8: return (SDL12Key)0xf8; case 0x03C9: return (SDL12Key)0xf9; /* Technical */ case 0x23B7: return (SDL12Key)0xa1; case 0x250C: return (SDL12Key)0xa2; case 0x2500: return (SDL12Key)0xa3; case 0x2320: return (SDL12Key)0xa4; case 0x2321: return (SDL12Key)0xa5; case 0x2502: return (SDL12Key)0xa6; case 0x23A1: return (SDL12Key)0xa7; case 0x23A3: return (SDL12Key)0xa8; case 0x23A4: return (SDL12Key)0xa9; case 0x23A6: return (SDL12Key)0xaa; case 0x239B: return (SDL12Key)0xab; case 0x239D: return (SDL12Key)0xac; case 0x239E: return (SDL12Key)0xad; case 0x23A0: return (SDL12Key)0xae; case 0x23A8: return (SDL12Key)0xaf; case 0x23AC: return (SDL12Key)0xb0; case 0x2264: return (SDL12Key)0xbc; case 0x2260: return (SDL12Key)0xbd; case 0x2265: return (SDL12Key)0xbe; case 0x222B: return (SDL12Key)0xbf; case 0x2234: return (SDL12Key)0xc0; case 0x221D: return (SDL12Key)0xc1; case 0x221E: return (SDL12Key)0xc2; case 0x2207: return (SDL12Key)0xc5; case 0x223C: return (SDL12Key)0xc8; case 0x2243: return (SDL12Key)0xc9; case 0x21D4: return (SDL12Key)0xcd; case 0x21D2: return (SDL12Key)0xce; case 0x2261: return (SDL12Key)0xcf; case 0x221A: return (SDL12Key)0xd6; case 0x2282: return (SDL12Key)0xda; case 0x2283: return (SDL12Key)0xdb; case 0x2229: return (SDL12Key)0xdc; case 0x222A: return (SDL12Key)0xdd; case 0x2227: return (SDL12Key)0xde; case 0x2228: return (SDL12Key)0xdf; case 0x2202: return (SDL12Key)0xef; case 0x0192: return (SDL12Key)0xf6; case 0x2190: return (SDL12Key)0xfb; case 0x2191: return (SDL12Key)0xfc; case 0x2192: return (SDL12Key)0xfd; case 0x2193: return (SDL12Key)0xfe; /* Publishing */ case 0x2003: return (SDL12Key)0xa1; case 0x2002: return (SDL12Key)0xa2; case 0x2004: return (SDL12Key)0xa3; case 0x2005: return (SDL12Key)0xa4; case 0x2007: return (SDL12Key)0xa5; case 0x2008: return (SDL12Key)0xa6; case 0x2009: return (SDL12Key)0xa7; case 0x200A: return (SDL12Key)0xa8; case 0x2014: return (SDL12Key)0xa9; case 0x2013: return (SDL12Key)0xaa; case 0x2423: return (SDL12Key)0xac; case 0x2026: return (SDL12Key)0xae; case 0x2025: return (SDL12Key)0xaf; case 0x2153: return (SDL12Key)0xb0; case 0x2154: return (SDL12Key)0xb1; case 0x2155: return (SDL12Key)0xb2; case 0x2156: return (SDL12Key)0xb3; case 0x2157: return (SDL12Key)0xb4; case 0x2158: return (SDL12Key)0xb5; case 0x2159: return (SDL12Key)0xb6; case 0x215A: return (SDL12Key)0xb7; case 0x2105: return (SDL12Key)0xb8; case 0x2012: return (SDL12Key)0xbb; case 0x27E8: return (SDL12Key)0xbc; case 0x002E: return (SDL12Key)0xbd; case 0x27E9: return (SDL12Key)0xbe; case 0x215B: return (SDL12Key)0xc3; case 0x215C: return (SDL12Key)0xc4; case 0x215D: return (SDL12Key)0xc5; case 0x215E: return (SDL12Key)0xc6; case 0x2122: return (SDL12Key)0xc9; case 0x2613: return (SDL12Key)0xca; case 0x25C1: return (SDL12Key)0xcc; case 0x25B7: return (SDL12Key)0xcd; case 0x25CB: return (SDL12Key)0xce; case 0x25AF: return (SDL12Key)0xcf; case 0x2018: return (SDL12Key)0xd0; case 0x2019: return (SDL12Key)0xd1; case 0x201C: return (SDL12Key)0xd2; case 0x201D: return (SDL12Key)0xd3; case 0x211E: return (SDL12Key)0xd4; case 0x2030: return (SDL12Key)0xd5; case 0x2032: return (SDL12Key)0xd6; case 0x2033: return (SDL12Key)0xd7; case 0x271D: return (SDL12Key)0xd9; case 0x25AC: return (SDL12Key)0xdb; case 0x25C0: return (SDL12Key)0xdc; case 0x25B6: return (SDL12Key)0xdd; case 0x25CF: return (SDL12Key)0xde; case 0x25AE: return (SDL12Key)0xdf; case 0x25E6: return (SDL12Key)0xe0; case 0x25AB: return (SDL12Key)0xe1; case 0x25AD: return (SDL12Key)0xe2; case 0x25B3: return (SDL12Key)0xe3; case 0x25BD: return (SDL12Key)0xe4; case 0x2606: return (SDL12Key)0xe5; case 0x2022: return (SDL12Key)0xe6; case 0x25AA: return (SDL12Key)0xe7; case 0x25B2: return (SDL12Key)0xe8; case 0x25BC: return (SDL12Key)0xe9; case 0x261C: return (SDL12Key)0xea; case 0x261E: return (SDL12Key)0xeb; case 0x2663: return (SDL12Key)0xec; case 0x2666: return (SDL12Key)0xed; case 0x2665: return (SDL12Key)0xee; case 0x2720: return (SDL12Key)0xf0; case 0x2020: return (SDL12Key)0xf1; case 0x2021: return (SDL12Key)0xf2; case 0x2713: return (SDL12Key)0xf3; case 0x2717: return (SDL12Key)0xf4; case 0x266F: return (SDL12Key)0xf5; case 0x266D: return (SDL12Key)0xf6; case 0x2642: return (SDL12Key)0xf7; case 0x2640: return (SDL12Key)0xf8; case 0x260E: return (SDL12Key)0xf9; case 0x2315: return (SDL12Key)0xfa; case 0x2117: return (SDL12Key)0xfb; case 0x2038: return (SDL12Key)0xfc; case 0x201A: return (SDL12Key)0xfd; case 0x201E: return (SDL12Key)0xfe; /* Hebrew */ case 0x2017: return (SDL12Key)0xdf; case 0x05D0: return (SDL12Key)0xe0; case 0x05D1: return (SDL12Key)0xe1; case 0x05D2: return (SDL12Key)0xe2; case 0x05D3: return (SDL12Key)0xe3; case 0x05D4: return (SDL12Key)0xe4; case 0x05D5: return (SDL12Key)0xe5; case 0x05D6: return (SDL12Key)0xe6; case 0x05D7: return (SDL12Key)0xe7; case 0x05D8: return (SDL12Key)0xe8; case 0x05D9: return (SDL12Key)0xe9; case 0x05DA: return (SDL12Key)0xea; case 0x05DB: return (SDL12Key)0xeb; case 0x05DC: return (SDL12Key)0xec; case 0x05DD: return (SDL12Key)0xed; case 0x05DE: return (SDL12Key)0xee; case 0x05DF: return (SDL12Key)0xef; case 0x05E0: return (SDL12Key)0xf0; case 0x05E1: return (SDL12Key)0xf1; case 0x05E2: return (SDL12Key)0xf2; case 0x05E3: return (SDL12Key)0xf3; case 0x05E4: return (SDL12Key)0xf4; case 0x05E5: return (SDL12Key)0xf5; case 0x05E6: return (SDL12Key)0xf6; case 0x05E7: return (SDL12Key)0xf7; case 0x05E8: return (SDL12Key)0xf8; case 0x05E9: return (SDL12Key)0xf9; case 0x05EA: return (SDL12Key)0xfa; /* Thai */ case 0x0E01: return (SDL12Key)0xa1; case 0x0E02: return (SDL12Key)0xa2; case 0x0E03: return (SDL12Key)0xa3; case 0x0E04: return (SDL12Key)0xa4; case 0x0E05: return (SDL12Key)0xa5; case 0x0E06: return (SDL12Key)0xa6; case 0x0E07: return (SDL12Key)0xa7; case 0x0E08: return (SDL12Key)0xa8; case 0x0E09: return (SDL12Key)0xa9; case 0x0E0A: return (SDL12Key)0xaa; case 0x0E0B: return (SDL12Key)0xab; case 0x0E0C: return (SDL12Key)0xac; case 0x0E0D: return (SDL12Key)0xad; case 0x0E0E: return (SDL12Key)0xae; case 0x0E0F: return (SDL12Key)0xaf; case 0x0E10: return (SDL12Key)0xb0; case 0x0E11: return (SDL12Key)0xb1; case 0x0E12: return (SDL12Key)0xb2; case 0x0E13: return (SDL12Key)0xb3; case 0x0E14: return (SDL12Key)0xb4; case 0x0E15: return (SDL12Key)0xb5; case 0x0E16: return (SDL12Key)0xb6; case 0x0E17: return (SDL12Key)0xb7; case 0x0E18: return (SDL12Key)0xb8; case 0x0E19: return (SDL12Key)0xb9; case 0x0E1A: return (SDL12Key)0xba; case 0x0E1B: return (SDL12Key)0xbb; case 0x0E1C: return (SDL12Key)0xbc; case 0x0E1D: return (SDL12Key)0xbd; case 0x0E1E: return (SDL12Key)0xbe; case 0x0E1F: return (SDL12Key)0xbf; case 0x0E20: return (SDL12Key)0xc0; case 0x0E21: return (SDL12Key)0xc1; case 0x0E22: return (SDL12Key)0xc2; case 0x0E23: return (SDL12Key)0xc3; case 0x0E24: return (SDL12Key)0xc4; case 0x0E25: return (SDL12Key)0xc5; case 0x0E26: return (SDL12Key)0xc6; case 0x0E27: return (SDL12Key)0xc7; case 0x0E28: return (SDL12Key)0xc8; case 0x0E29: return (SDL12Key)0xc9; case 0x0E2A: return (SDL12Key)0xca; case 0x0E2B: return (SDL12Key)0xcb; case 0x0E2C: return (SDL12Key)0xcc; case 0x0E2D: return (SDL12Key)0xcd; case 0x0E2E: return (SDL12Key)0xce; case 0x0E2F: return (SDL12Key)0xcf; case 0x0E30: return (SDL12Key)0xd0; case 0x0E31: return (SDL12Key)0xd1; case 0x0E32: return (SDL12Key)0xd2; case 0x0E33: return (SDL12Key)0xd3; case 0x0E34: return (SDL12Key)0xd4; case 0x0E35: return (SDL12Key)0xd5; case 0x0E36: return (SDL12Key)0xd6; case 0x0E37: return (SDL12Key)0xd7; case 0x0E38: return (SDL12Key)0xd8; case 0x0E39: return (SDL12Key)0xd9; case 0x0E3A: return (SDL12Key)0xda; case 0x0E3F: return (SDL12Key)0xdf; case 0x0E40: return (SDL12Key)0xe0; case 0x0E41: return (SDL12Key)0xe1; case 0x0E42: return (SDL12Key)0xe2; case 0x0E43: return (SDL12Key)0xe3; case 0x0E44: return (SDL12Key)0xe4; case 0x0E45: return (SDL12Key)0xe5; case 0x0E46: return (SDL12Key)0xe6; case 0x0E47: return (SDL12Key)0xe7; case 0x0E48: return (SDL12Key)0xe8; case 0x0E49: return (SDL12Key)0xe9; case 0x0E4A: return (SDL12Key)0xea; case 0x0E4B: return (SDL12Key)0xeb; case 0x0E4C: return (SDL12Key)0xec; case 0x0E4D: return (SDL12Key)0xed; case 0x0E50: return (SDL12Key)0xf0; case 0x0E51: return (SDL12Key)0xf1; case 0x0E52: return (SDL12Key)0xf2; case 0x0E53: return (SDL12Key)0xf3; case 0x0E54: return (SDL12Key)0xf4; case 0x0E55: return (SDL12Key)0xf5; case 0x0E56: return (SDL12Key)0xf6; case 0x0E57: return (SDL12Key)0xf7; case 0x0E58: return (SDL12Key)0xf8; case 0x0E59: return (SDL12Key)0xf9; /* end of SDLK_WORLD_ keys based on Latin-* or similar High-ASCII charsets * and the low byte of their corresponding X11 XK_* KeySyms */ default: break; } return SDLK12_UNKNOWN; } static SDL12Key Scancode20toKeysym12(const SDL_Scancode scancode20) { switch (scancode20) { #define CASESCANCODE20TOKEY12(s20, k12) case SDL_SCANCODE_##s20: return SDLK12_##k12 CASESCANCODE20TOKEY12(A,a); CASESCANCODE20TOKEY12(B,b); CASESCANCODE20TOKEY12(C,c); CASESCANCODE20TOKEY12(D,d); CASESCANCODE20TOKEY12(E,e); CASESCANCODE20TOKEY12(F,f); CASESCANCODE20TOKEY12(G,g); CASESCANCODE20TOKEY12(H,h); CASESCANCODE20TOKEY12(I,i); CASESCANCODE20TOKEY12(J,j); CASESCANCODE20TOKEY12(K,k); CASESCANCODE20TOKEY12(L,l); CASESCANCODE20TOKEY12(M,m); CASESCANCODE20TOKEY12(N,n); CASESCANCODE20TOKEY12(O,o); CASESCANCODE20TOKEY12(P,p); CASESCANCODE20TOKEY12(Q,q); CASESCANCODE20TOKEY12(R,r); CASESCANCODE20TOKEY12(S,s); CASESCANCODE20TOKEY12(T,t); CASESCANCODE20TOKEY12(U,u); CASESCANCODE20TOKEY12(V,v); CASESCANCODE20TOKEY12(W,w); CASESCANCODE20TOKEY12(X,x); CASESCANCODE20TOKEY12(Y,y); CASESCANCODE20TOKEY12(Z,z); CASESCANCODE20TOKEY12(1,1); CASESCANCODE20TOKEY12(2,2); CASESCANCODE20TOKEY12(3,3); CASESCANCODE20TOKEY12(4,4); CASESCANCODE20TOKEY12(5,5); CASESCANCODE20TOKEY12(6,6); CASESCANCODE20TOKEY12(7,7); CASESCANCODE20TOKEY12(8,8); CASESCANCODE20TOKEY12(9,9); CASESCANCODE20TOKEY12(0,0); CASESCANCODE20TOKEY12(RETURN,RETURN); CASESCANCODE20TOKEY12(ESCAPE,ESCAPE); CASESCANCODE20TOKEY12(BACKSPACE,BACKSPACE); CASESCANCODE20TOKEY12(TAB,TAB); CASESCANCODE20TOKEY12(SPACE,SPACE); CASESCANCODE20TOKEY12(MINUS,MINUS); CASESCANCODE20TOKEY12(EQUALS,EQUALS); CASESCANCODE20TOKEY12(LEFTBRACKET,LEFTBRACKET); CASESCANCODE20TOKEY12(RIGHTBRACKET,RIGHTBRACKET); CASESCANCODE20TOKEY12(BACKSLASH,BACKSLASH); CASESCANCODE20TOKEY12(NONUSHASH,HASH); CASESCANCODE20TOKEY12(SEMICOLON,SEMICOLON); CASESCANCODE20TOKEY12(APOSTROPHE,QUOTE); CASESCANCODE20TOKEY12(GRAVE,BACKQUOTE); CASESCANCODE20TOKEY12(COMMA,COMMA); CASESCANCODE20TOKEY12(PERIOD,PERIOD); CASESCANCODE20TOKEY12(SLASH,SLASH); CASESCANCODE20TOKEY12(CAPSLOCK,CAPSLOCK); CASESCANCODE20TOKEY12(F1,F1); CASESCANCODE20TOKEY12(F2,F2); CASESCANCODE20TOKEY12(F3,F3); CASESCANCODE20TOKEY12(F4,F4); CASESCANCODE20TOKEY12(F5,F5); CASESCANCODE20TOKEY12(F6,F6); CASESCANCODE20TOKEY12(F7,F7); CASESCANCODE20TOKEY12(F8,F8); CASESCANCODE20TOKEY12(F9,F9); CASESCANCODE20TOKEY12(F10,F10); CASESCANCODE20TOKEY12(F11,F11); CASESCANCODE20TOKEY12(F12,F12); CASESCANCODE20TOKEY12(PRINTSCREEN,PRINT); CASESCANCODE20TOKEY12(SCROLLLOCK,SCROLLOCK); CASESCANCODE20TOKEY12(PAUSE,PAUSE); CASESCANCODE20TOKEY12(INSERT,INSERT); CASESCANCODE20TOKEY12(HOME,HOME); CASESCANCODE20TOKEY12(PAGEUP,PAGEUP); CASESCANCODE20TOKEY12(DELETE,DELETE); CASESCANCODE20TOKEY12(END,END); CASESCANCODE20TOKEY12(PAGEDOWN,PAGEDOWN); CASESCANCODE20TOKEY12(RIGHT,RIGHT); CASESCANCODE20TOKEY12(LEFT,LEFT); CASESCANCODE20TOKEY12(DOWN,DOWN); CASESCANCODE20TOKEY12(UP,UP); CASESCANCODE20TOKEY12(NUMLOCKCLEAR,NUMLOCK); CASESCANCODE20TOKEY12(KP_DIVIDE,KP_DIVIDE); CASESCANCODE20TOKEY12(KP_MULTIPLY,KP_MULTIPLY); CASESCANCODE20TOKEY12(KP_MINUS,KP_MINUS); CASESCANCODE20TOKEY12(KP_PLUS,KP_PLUS); CASESCANCODE20TOKEY12(KP_ENTER,KP_ENTER); CASESCANCODE20TOKEY12(KP_1,KP1); CASESCANCODE20TOKEY12(KP_2,KP2); CASESCANCODE20TOKEY12(KP_3,KP3); CASESCANCODE20TOKEY12(KP_4,KP4); CASESCANCODE20TOKEY12(KP_5,KP5); CASESCANCODE20TOKEY12(KP_6,KP6); CASESCANCODE20TOKEY12(KP_7,KP7); CASESCANCODE20TOKEY12(KP_8,KP8); CASESCANCODE20TOKEY12(KP_9,KP9); CASESCANCODE20TOKEY12(KP_0,KP0); CASESCANCODE20TOKEY12(NONUSBACKSLASH,BACKSLASH); /* In theory, this could be MENU, or COMPOSE, or neither, but on my machine, it's MENU. */ CASESCANCODE20TOKEY12(APPLICATION,MENU); CASESCANCODE20TOKEY12(POWER,POWER); CASESCANCODE20TOKEY12(F13,F13); CASESCANCODE20TOKEY12(F14,F14); CASESCANCODE20TOKEY12(F15,F15); CASESCANCODE20TOKEY12(KP_EQUALS,KP_EQUALS); /* SDL 1.2 doesn't support F16..F21 */ /* Nor SDL_SCANCODE_EXECUTE */ CASESCANCODE20TOKEY12(HELP,HELP); CASESCANCODE20TOKEY12(MENU,MENU); /* The next several scancodes don't have equivalents, until... */ CASESCANCODE20TOKEY12(SYSREQ,SYSREQ); CASESCANCODE20TOKEY12(CLEAR,CLEAR); /* Skip some more... */ CASESCANCODE20TOKEY12(LCTRL,LCTRL); CASESCANCODE20TOKEY12(LSHIFT,LSHIFT); CASESCANCODE20TOKEY12(LALT,LALT); #ifdef __MACOSX__ CASESCANCODE20TOKEY12(LGUI,LMETA); #else CASESCANCODE20TOKEY12(LGUI,LSUPER); #endif CASESCANCODE20TOKEY12(RCTRL,RCTRL); CASESCANCODE20TOKEY12(RSHIFT,RSHIFT); CASESCANCODE20TOKEY12(RALT,RALT); #ifdef __MACOSX__ CASESCANCODE20TOKEY12(RGUI,RMETA); #else CASESCANCODE20TOKEY12(RGUI,RSUPER); #endif CASESCANCODE20TOKEY12(MODE,MODE); #undef CASESCANCODE20TOKEY12 default: break; } return SDLK12_UNKNOWN; } static Uint8 Scancode20to12(SDL_Scancode sc) { /* SDL 1.2 scancodes are the actual raw scancodes (for the most part), and so differ wildly between different systems. Fortunately, this means they're rarely used, and often have fallbacks. Here, we support them for three systems: Win32, Mac OS X, and a synthesized pseudo-Linux that should work. Windows scancodes are bascially just Linux ones - 8. OS X has a totally different set of scancodes from everyone else. Linux's scancodes change depending on what driver you're using, but only really for a few keys. Since there are applications (DOSBox) which look this up and behave accordingly, but have fallbacks, those keys have scancodes of 0 here, to trigger the fallbacks. */ switch(sc) { #if defined(_WIN32) #define CASESCANCODE20TO12(sc20, sc12, sc12mac) case SDL_SCANCODE_##sc20: return (sc12 ? (sc12 - 8) : 0) #elif defined(__MACOSX__) #define CASESCANCODE20TO12(sc20, sc12, sc12mac) case SDL_SCANCODE_##sc20: return sc12mac #else #define CASESCANCODE20TO12(sc20, sc12, sc12mac) case SDL_SCANCODE_##sc20: return sc12 #endif CASESCANCODE20TO12(0, 0x13, 0x1D); CASESCANCODE20TO12(1, 0x0A, 0x12); CASESCANCODE20TO12(2, 0x0B, 0x13); CASESCANCODE20TO12(3, 0x0C, 0x14); CASESCANCODE20TO12(4, 0x0D, 0x15); CASESCANCODE20TO12(5, 0x0E, 0x17); CASESCANCODE20TO12(6, 0x0F, 0x16); CASESCANCODE20TO12(7, 0x10, 0x1A); CASESCANCODE20TO12(8, 0x11, 0x1C); CASESCANCODE20TO12(9, 0x12, 0x19); CASESCANCODE20TO12(A, 0x26, 0x00); CASESCANCODE20TO12(APOSTROPHE, 0x30, 0x27); CASESCANCODE20TO12(APPLICATION, 0x65, 0x00); CASESCANCODE20TO12(B, 0x38, 0x0B); CASESCANCODE20TO12(BACKSLASH, 0x33, 0x2A); CASESCANCODE20TO12(BACKSPACE, 0x16, 0x33); CASESCANCODE20TO12(C, 0x36, 0x08); CASESCANCODE20TO12(CAPSLOCK, 0x42, 0x00); CASESCANCODE20TO12(COMMA, 0x3B, 0x2B); CASESCANCODE20TO12(D, 0x28, 0x02); CASESCANCODE20TO12(DELETE, 0x00, 0x75); CASESCANCODE20TO12(DOWN, 0x00, 0x7D); CASESCANCODE20TO12(E, 0x1A, 0x0E); CASESCANCODE20TO12(END, 0x00, 0x77); CASESCANCODE20TO12(EQUALS, 0x15, 0x18); CASESCANCODE20TO12(ESCAPE, 0x09, 0x35); CASESCANCODE20TO12(F, 0x29, 0x03); CASESCANCODE20TO12(F1, 0x43, 0x7A); CASESCANCODE20TO12(F10, 0x4C, 0x6E); CASESCANCODE20TO12(F11, 0x5F, 0x67); CASESCANCODE20TO12(F12, 0x60, 0x6F); CASESCANCODE20TO12(F2, 0x44, 0x78); CASESCANCODE20TO12(F3, 0x45, 0x63); CASESCANCODE20TO12(F4, 0x46, 0x76); CASESCANCODE20TO12(F5, 0x47, 0x60); CASESCANCODE20TO12(F6, 0x48, 0x61); CASESCANCODE20TO12(F7, 0x49, 0x62); CASESCANCODE20TO12(F8, 0x4A, 0x64); CASESCANCODE20TO12(F9, 0x4B, 0x65); CASESCANCODE20TO12(G, 0x2A, 0x05); CASESCANCODE20TO12(GRAVE, 0x31, 0x32); /* Note: the mac scancode might not be 100% correct, see below */ CASESCANCODE20TO12(H, 0x2B, 0x04); CASESCANCODE20TO12(HOME, 0x00, 0x73); CASESCANCODE20TO12(I, 0x1F, 0x22); CASESCANCODE20TO12(INSERT, 0x00, 0x72); CASESCANCODE20TO12(J, 0x2C, 0x26); CASESCANCODE20TO12(K, 0x2D, 0x28); CASESCANCODE20TO12(KP_0, 0x5A, 0x52); CASESCANCODE20TO12(KP_1, 0x57, 0x53); CASESCANCODE20TO12(KP_2, 0x58, 0x54); CASESCANCODE20TO12(KP_3, 0x59, 0x55); CASESCANCODE20TO12(KP_4, 0x53, 0x56); CASESCANCODE20TO12(KP_5, 0x54, 0x57); CASESCANCODE20TO12(KP_6, 0x55, 0x58); CASESCANCODE20TO12(KP_7, 0x4F, 0x59); CASESCANCODE20TO12(KP_8, 0x50, 0x5B); CASESCANCODE20TO12(KP_9, 0x51, 0x5C); CASESCANCODE20TO12(KP_DIVIDE, 0x00, 0x4B); CASESCANCODE20TO12(KP_ENTER, 0x00, 0x4C); CASESCANCODE20TO12(KP_EQUALS, 0x00, 0x51); CASESCANCODE20TO12(KP_MINUS, 0x52, 0x4E); CASESCANCODE20TO12(KP_MULTIPLY, 0x3F, 0x43); CASESCANCODE20TO12(KP_PERIOD, 0x5B, 0x41); CASESCANCODE20TO12(KP_PLUS, 0x56, 0x45); CASESCANCODE20TO12(L, 0x2E, 0x25); CASESCANCODE20TO12(LALT, 0x40, 0x00); CASESCANCODE20TO12(LCTRL, 0x25, 0x00); CASESCANCODE20TO12(LEFT, 0x00, 0x7B); CASESCANCODE20TO12(LEFTBRACKET, 0x22, 0x21); CASESCANCODE20TO12(LGUI, 0x85, 0x00); CASESCANCODE20TO12(LSHIFT, 0x32, 0x00); CASESCANCODE20TO12(M, 0x3A, 0x2E); CASESCANCODE20TO12(MENU, 0x65, 0x00); CASESCANCODE20TO12(MINUS, 0x14, 0x1B); CASESCANCODE20TO12(N, 0x39, 0x2D); /* On Macs with ANSI layout, 0x32 is SDL_SCANCODE_GRAVE and _NONUSBACKSLASH doesn't exist. * On Macs with ISO layout, 0x32 is _NONUSBACKSLASH and 0x0A is the key at the position of _GRAVE.. * Probably it's best to keep _GRAVE at 0x32 and use 0x0A for _NONUSBACKSLASH instead, * so at least it has a unique scancode at all. */ CASESCANCODE20TO12(NONUSBACKSLASH, 0x5E, 0x0A); CASESCANCODE20TO12(NUMLOCKCLEAR, 0x4D, 0x47); CASESCANCODE20TO12(O, 0x20, 0x1F); CASESCANCODE20TO12(P, 0x21, 0x23); CASESCANCODE20TO12(PAGEDOWN, 0x00, 0x79); CASESCANCODE20TO12(PAGEUP, 0x00, 0x74); CASESCANCODE20TO12(PERIOD, 0x3C, 0x2F); CASESCANCODE20TO12(PRINTSCREEN, 0x6B, 0x6B); CASESCANCODE20TO12(Q, 0x18, 0x0C); CASESCANCODE20TO12(R, 0x1B, 0x0F); CASESCANCODE20TO12(RETURN, 0x24, 0x24); CASESCANCODE20TO12(RALT, 0x40, 0x00); CASESCANCODE20TO12(RCTRL, 0x25, 0x00); CASESCANCODE20TO12(RGUI, 0x86, 0x00); CASESCANCODE20TO12(RIGHT, 0x00, 0x7C); CASESCANCODE20TO12(RIGHTBRACKET, 0x23, 0x1E); CASESCANCODE20TO12(RSHIFT, 0x3E, 0x00); CASESCANCODE20TO12(S, 0x27, 0x01); CASESCANCODE20TO12(SCROLLLOCK, 0x4E, 0x71); CASESCANCODE20TO12(SEMICOLON, 0x2F, 0x29); CASESCANCODE20TO12(SLASH, 0x3D, 0x2C); CASESCANCODE20TO12(SPACE, 0x41, 0x31); CASESCANCODE20TO12(T, 0x1C, 0x11); CASESCANCODE20TO12(TAB, 0x17, 0x30); CASESCANCODE20TO12(U, 0x1E, 0x20); CASESCANCODE20TO12(UP, 0x00, 0x7E); CASESCANCODE20TO12(V, 0x37, 0x09); CASESCANCODE20TO12(W, 0x19, 0x0D); CASESCANCODE20TO12(X, 0x35, 0x07); CASESCANCODE20TO12(Y, 0x1D, 0x10); CASESCANCODE20TO12(Z, 0x34, 0x06); #undef CASESCANCODE20TO12 default: /* If we don't know it, return 0, which is "unknown". It's also "a" on Mac OS X, but SDL 1.2 uses it as "unknown", too. */ return 0; } } DECLSPEC12 Uint8 * SDLCALL SDL_GetKeyState(int *numkeys) { if (numkeys) { *numkeys = (int) SDL_arraysize(KeyState); } return KeyState; } static int DecodeUTF8Char(char **ptr) { Uint32 first_c = **(unsigned char **)ptr; int num_bytes = (first_c) ? (31 - SDL20_MostSignificantBitIndex32(~(first_c << 24))) : 0; Uint32 value = first_c & ((1 << (8 - num_bytes)) - 1); int i; (*ptr)++; for (i = 1; i < num_bytes; ++i) { value = (value << 6) | (**(unsigned char **)ptr & 0x3f); (*ptr)++; } return value; } static int IsRepeatable(SDL12Key key) { switch (key) { case SDLK12_UNKNOWN: case SDLK12_NUMLOCK: case SDLK12_CAPSLOCK: case SDLK12_LCTRL: case SDLK12_RCTRL: case SDLK12_LSHIFT: case SDLK12_RSHIFT: case SDLK12_LALT: case SDLK12_RALT: case SDLK12_LMETA: case SDLK12_RMETA: case SDLK12_MODE: return 0; default: return 1; } } /* Add the pending KEYDOWN event to the EventQueue, possibly with 'unicode' set * Returns 1 if there was a pending event. */ static int FlushPendingKeydownEvent(Uint32 unicode) { if (PendingKeydownEvent.type != SDL12_KEYDOWN) { return 0; } PendingKeydownEvent.key.keysym.unicode = unicode; PushEventIfNotFiltered(&PendingKeydownEvent); if (KeyRepeatDelay && IsRepeatable(PendingKeydownEvent.key.keysym.sym)) { SDL20_memcpy(&KeyRepeatEvent, &PendingKeydownEvent, sizeof (SDL12_Event)); /* SDL 1.2 waits for the delay, and then a full interval past that before the first repeat is reported. */ KeyRepeatNextTicks = SDL20_GetTicks() + KeyRepeatDelay + KeyRepeatInterval; } /* Reset the event. */ SDL20_memset(&PendingKeydownEvent, 0, sizeof (SDL12_Event)); return 1; } static int SDLCALL EventFilter20to12(void *data, SDL_Event *event20) { SDL12_Event event12; SDL12_SysWMmsg msg; SDL_assert(data == NULL); /* currently unused. */ SDL20_zero(event12); switch (event20->type) { case SDL_QUIT: event12.type = SDL12_QUIT; break; case SDL_WINDOWEVENT: if (!VideoWindow20) { break; /* no window? No event. */ } switch (event20->window.event) { /* don't send an SDL12_QUIT event for SDL_WINDOWEVENT_CLOSE; we only ever have a single window, so an SDL_QUIT will be coming from SDL2 next anyhow, so just send that on. */ case SDL_WINDOWEVENT_SHOWN: case SDL_WINDOWEVENT_EXPOSED: /* drop these during window creation (see issue #229) */ if (!SetVideoModeInProgress) { event12.type = SDL12_VIDEOEXPOSE; } break; case SDL_WINDOWEVENT_RESIZED: { /* don't generate a VIDEORESIZE event based on SIZE_CHANGED events: the recommended way to handle VIDEORESIZE is with a new SDL_SetVideoMode() call, and creating a new window generates a SIZE_CHANGED event, which leads to an infinite loop. */ /* don't report VIDEORESIZE if we're fullscreen-desktop; we're doing logical scaling and as far as the app is concerned the window doesn't change. */ const Uint32 flags = SDL20_GetWindowFlags(VideoWindow20); if ((flags & SDL_WINDOW_FULLSCREEN_DESKTOP) == SDL_WINDOW_FULLSCREEN_DESKTOP) { break; } if (ProcessingModalLoop) { PendingResizeEvent.type = SDL12_VIDEORESIZE; PendingResizeEvent.resize.w = event20->window.data1; PendingResizeEvent.resize.h = event20->window.data2; HasPendingResizeEvent = SDL_TRUE; } else { event12.type = SDL12_VIDEORESIZE; event12.resize.w = event20->window.data1; event12.resize.h = event20->window.data2; } break; } case SDL_WINDOWEVENT_MINIMIZED: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 0; event12.active.state = SDL12_APPACTIVE; break; case SDL_WINDOWEVENT_RESTORED: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 1; event12.active.state = SDL12_APPACTIVE; break; case SDL_WINDOWEVENT_ENTER: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 1; event12.active.state = SDL12_APPMOUSEFOCUS; break; case SDL_WINDOWEVENT_LEAVE: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 0; event12.active.state = SDL12_APPMOUSEFOCUS; break; case SDL_WINDOWEVENT_FOCUS_GAINED: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 1; event12.active.state = SDL12_APPINPUTFOCUS; break; case SDL_WINDOWEVENT_FOCUS_LOST: event12.type = SDL12_ACTIVEEVENT; event12.active.gain = 0; event12.active.state = SDL12_APPINPUTFOCUS; break; } break; case SDL_SYSWMEVENT: #if defined(SDL_VIDEO_DRIVER_WINDOWS) switch (event20->syswm.msg->msg.win.msg) { case WM_ENTERSIZEMOVE: case WM_ENTERMENULOOP: ++ProcessingModalLoop; break; case WM_EXITSIZEMOVE: case WM_EXITMENULOOP: --ProcessingModalLoop; if (ProcessingModalLoop == 0 && HasPendingResizeEvent) { PushEventIfNotFiltered(&PendingResizeEvent); HasPendingResizeEvent = SDL_FALSE; } break; default: break; } #endif if (!SupportSysWM) { return 1; } #if defined(SDL_VIDEO_DRIVER_WINDOWS) SDL_assert(event20->syswm.msg->subsystem == SDL_SYSWM_WINDOWS); msg.hwnd = event20->syswm.msg->msg.win.hwnd; msg.msg = event20->syswm.msg->msg.win.msg; msg.wParam = event20->syswm.msg->msg.win.wParam; msg.lParam = event20->syswm.msg->msg.win.lParam; #elif defined(SDL_VIDEO_DRIVER_X11) SDL_assert(event20->syswm.msg->subsystem == SDL_SYSWM_X11); msg.subsystem = SDL12_SYSWM_X11; SDL20_memcpy(&msg.event.xevent, &event20->syswm.msg->msg.x11.event, sizeof (XEvent)); #else SDL_assert(!"should have been caught by !SupportsSysWM test"); #endif SDL20_memcpy(&msg.version, SDL_Linked_Version(), sizeof (msg.version)); event12.type = SDL12_SYSWMEVENT; event12.syswm.msg = &msg; /* this is stack-allocated, but we copy and update the pointer later. */ break; case SDL_KEYUP: if (event20->key.repeat) { return 1; /* ignore 2.0-style key repeat events */ } if (TranslateKeyboardLayout) { event12.key.keysym.sym = Keysym20to12(event20->key.keysym.sym); } else { event12.key.keysym.sym = Scancode20toKeysym12(event20->key.keysym.scancode); } if (event12.key.keysym.sym == SDLK12_CAPSLOCK || event12.key.keysym.sym == SDLK12_NUMLOCK) { /* SDL 1.2 only sends capslock and numlock key events on keydown */ return 1; } if (KeyRepeatNextTicks) { SDL_assert(KeyRepeatEvent.type == SDL12_KEYDOWN); if (KeyRepeatEvent.key.keysym.sym == event12.key.keysym.sym) { KeyRepeatNextTicks = 0; } } KeyState[event12.key.keysym.sym] = event20->key.state; event12.type = SDL12_KEYUP; event12.key.which = 0; event12.key.state = event20->key.state; /* turns out that some apps actually made use of the hardware scancodes (checking for platform beforehand) */ event12.key.keysym.scancode = Scancode20to12(event20->key.keysym.scancode); event12.key.keysym.mod = event20->key.keysym.mod; /* these match up between 1.2 and 2.0! */ event12.key.keysym.unicode = 0; /* If there's a pending KEYDOWN event, flush it on KEYUP. */ FlushPendingKeydownEvent(0); break; case SDL_KEYDOWN: FlushPendingKeydownEvent(0); if (event20->key.repeat) { return 1; /* ignore 2.0-style key repeat events */ } if (TranslateKeyboardLayout) { event12.key.keysym.sym = Keysym20to12(event20->key.keysym.sym); } else { event12.key.keysym.sym = Scancode20toKeysym12(event20->key.keysym.scancode); } if (event12.key.keysym.sym == SDLK12_CAPSLOCK || event12.key.keysym.sym == SDLK12_NUMLOCK) { /* SDL 1.2 toggles capslock and numlock on keypress */ if (KeyState[event12.key.keysym.sym]) { KeyState[event12.key.keysym.sym] = SDL_RELEASED; event12.type = SDL12_KEYUP; event12.key.which = 0; event12.key.state = SDL_RELEASED; event12.key.keysym.scancode = Scancode20to12(event20->key.keysym.scancode); event12.key.keysym.mod = event20->key.keysym.mod; event12.key.keysym.unicode = 0; if (event12.key.keysym.sym == SDLK12_CAPSLOCK) { event12.key.keysym.mod &= ~KMOD12_CAPS; } else if (event12.key.keysym.sym == SDLK12_NUMLOCK) { event12.key.keysym.mod &= ~KMOD12_NUM; } break; } } KeyState[event12.key.keysym.sym] = event20->key.state; PendingKeydownEvent.type = SDL12_KEYDOWN; PendingKeydownEvent.key.which = 0; PendingKeydownEvent.key.state = event20->key.state; /* turns out that some apps actually made use of the hardware scancodes (checking for platform beforehand) */ PendingKeydownEvent.key.keysym.scancode = Scancode20to12(event20->key.keysym.scancode); PendingKeydownEvent.key.keysym.sym = event12.key.keysym.sym; PendingKeydownEvent.key.keysym.mod = event20->key.keysym.mod; /* these match up between 1.2 and 2.0! */ PendingKeydownEvent.key.keysym.unicode = 0; /* SDL 1.2 did not include modifiers in the keys that changed them */ if (PendingKeydownEvent.key.keysym.mod) { switch (PendingKeydownEvent.key.keysym.sym) { case SDLK12_LCTRL: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_LCTRL; break; case SDLK12_RCTRL: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_RCTRL; break; case SDLK12_LSHIFT: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_LSHIFT; break; case SDLK12_RSHIFT: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_RSHIFT; break; case SDLK12_LALT: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_LALT; break; case SDLK12_RALT: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_RALT; break; case SDLK12_LMETA: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_LMETA; break; case SDLK12_RMETA: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_RMETA; break; case SDLK12_MODE: PendingKeydownEvent.key.keysym.mod &= ~KMOD12_MODE; break; default: break; } } /* If Unicode is not enabled, flush all KEYDOWN events immediately. */ if (!EnabledUnicode) { FlushPendingKeydownEvent(0); return 1; } /* some programs rely on unicode values for these control characters */ switch (PendingKeydownEvent.key.keysym.sym) { case SDLK12_BACKSPACE: FlushPendingKeydownEvent('\b'); break; case SDLK12_TAB: FlushPendingKeydownEvent('\t'); break; case SDLK12_RETURN: case SDLK12_KP_ENTER: /* Enter: \r, Shift+Enter: \n */ if (PendingKeydownEvent.key.keysym.mod & KMOD_SHIFT) FlushPendingKeydownEvent('\n'); else FlushPendingKeydownEvent('\r'); break; case SDLK12_ESCAPE: FlushPendingKeydownEvent(0x1B); /* '\e' */ break; default: /* not a supported control character when CTRL is pressed, text events aren't sent so use fallback for unicode */ if (event20->key.keysym.mod & KMOD_CTRL) { switch (PendingKeydownEvent.key.keysym.sym) { case SDLK12_UNKNOWN: FlushPendingKeydownEvent(0); break; case SDLK12_SPACE: FlushPendingKeydownEvent(' '); break; case SDLK12_DELETE: FlushPendingKeydownEvent('\x7F'); break; default: if (event20->key.keysym.sym & SDLK_SCANCODE_MASK) { /* This key has no associated unicode text */ FlushPendingKeydownEvent(0); } else { FlushPendingKeydownEvent(event20->key.keysym.sym); } break; } } break; } return 1; case SDL_TEXTEDITING: return 1; case SDL_TEXTINPUT: { char *text = event20->text.text; const int codePoint = DecodeUTF8Char(&text); FlushPendingKeydownEvent(codePoint); return 1; } case SDL_MOUSEMOTION: if (!VideoSurface12 || !VideoSurface12->surface20) { return 1; /* we don't have a screen surface yet? Don't send this on to the app. */ } event12.type = SDL12_MOUSEMOTION; event12.motion.which = (Uint8) event20->motion.which; event12.motion.state = event20->motion.state; AdjustOpenGLLogicalScalingPoint(&event20->motion.x, &event20->motion.y); /* Clamp the absolute position to the window dimensions. */ event20->motion.x = SDL_max(SDL_min(event20->motion.x, VideoSurface12->w), 0); event20->motion.y = SDL_max(SDL_min(event20->motion.y, VideoSurface12->h), 0); event12.motion.x = (Uint16) event20->motion.x; event12.motion.y = (Uint16) event20->motion.y; if (UseMouseRelativeScaling) { AdjustOpenGLLogicalScalingVector(&event20->motion.xrel, &event20->motion.yrel, &MouseRelativeRemainder.x, &MouseRelativeRemainder.y); } event12.motion.xrel = (Sint16) event20->motion.xrel; event12.motion.yrel = (Sint16) event20->motion.yrel; if (MouseInputIsRelative) { /* in relative mode, clamp fake absolute position to the window dimensions. */ #define ADJUST_RELATIVE(axis, rel, dim) { \ MousePosition.axis += event20->motion.rel; \ if (MousePosition.axis <= 0) { \ MousePosition.axis = 0; \ } else if (MousePosition.axis >= VideoSurface12->dim) { \ MousePosition.axis = (VideoSurface12->dim - 1); \ } \ event12.motion.axis = MousePosition.axis; \ } ADJUST_RELATIVE(x, xrel, w); ADJUST_RELATIVE(y, yrel, h); #undef ADJUST_RELATIVE } else { MousePosition.x = event12.motion.x; MousePosition.y = event12.motion.y; } break; case SDL_MOUSEBUTTONDOWN: event12.type = SDL12_MOUSEBUTTONDOWN; event12.button.which = (Uint8) event20->button.which; event12.button.button = event20->button.button; if (event12.button.button > 3) { event12.button.button += 2; /* SDL_BUTTON_X1/2 */ } event12.button.state = event20->button.state; if (MouseInputIsRelative) { /* If we're using relative mouse input, we need to use our "fake" position. */ event12.button.x = MousePosition.x; event12.button.y = MousePosition.y; } else { AdjustOpenGLLogicalScalingPoint(&event20->button.x, &event20->button.y); event12.button.x = (Uint16) event20->button.x; event12.button.y = (Uint16) event20->button.y; } break; case SDL_MOUSEBUTTONUP: event12.type = SDL12_MOUSEBUTTONUP; event12.button.which = (Uint8) event20->button.which; event12.button.button = event20->button.button; if (event12.button.button > 3) { event12.button.button += 2; /* SDL_BUTTON_X1/2 */ } event12.button.state = event20->button.state; if (MouseInputIsRelative) { /* If we're using relative mouse input, we need to use our "fake" position. */ event12.button.x = MousePosition.x; event12.button.y = MousePosition.y; } else { AdjustOpenGLLogicalScalingPoint(&event20->button.x, &event20->button.y); event12.button.x = (Uint16) event20->button.x; event12.button.y = (Uint16) event20->button.y; } break; case SDL_MOUSEWHEEL: if (event20->wheel.y == 0) { break; /* don't support horizontal wheels in 1.2. */ } event12.type = SDL12_MOUSEBUTTONDOWN; event12.button.which = (Uint8) event20->wheel.which; event12.button.button = (event20->wheel.y > 0) ? 4 : 5; /* wheelup is 4, down is 5. */ event12.button.state = SDL_PRESSED; event12.button.x = MousePosition.x; event12.button.y = MousePosition.y; PushEventIfNotFiltered(&event12); event12.type = SDL12_MOUSEBUTTONUP; /* immediately release mouse "button" at the end of this switch. */ event12.button.state = SDL_RELEASED; break; case SDL_JOYAXISMOTION: if (!JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->jaxis.which); if (which != -1) { event12.type = SDL12_JOYAXISMOTION; event12.jaxis.which = (Uint8) which; event12.jaxis.axis = event20->jaxis.axis; event12.jaxis.value = event20->jaxis.value; } } break; case SDL_JOYBALLMOTION: if (!JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->jball.which); if (which != -1) { event12.type = SDL12_JOYBALLMOTION; event12.jball.which = (Uint8) which; event12.jball.ball = event20->jball.ball; event12.jball.xrel = event20->jball.xrel; event12.jball.yrel = event20->jball.yrel; } } break; case SDL_JOYHATMOTION: if (!JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->jhat.which); if (which != -1) { event12.type = SDL12_JOYHATMOTION; event12.jhat.which = (Uint8) which; event12.jhat.hat = event20->jhat.hat; event12.jhat.value = event20->jhat.value; } } break; case SDL_JOYBUTTONDOWN: case SDL_JOYBUTTONUP: if (!JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->jbutton.which); if (which != -1) { event12.type = (event20->jbutton.state) ? SDL12_JOYBUTTONDOWN : SDL12_JOYBUTTONUP; event12.jbutton.which = (Uint8) which; event12.jbutton.button = event20->jbutton.button; event12.jbutton.state = event20->jbutton.state; } } break; case SDL_CONTROLLERAXISMOTION: if (JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->caxis.which); if (which != -1) { event12.type = SDL12_JOYAXISMOTION; event12.jaxis.which = (Uint8) which; event12.jaxis.axis = event20->caxis.axis; event12.jaxis.value = event20->caxis.value; } } break; case SDL_CONTROLLERBUTTONDOWN: case SDL_CONTROLLERBUTTONUP: if (JoysticksAreGameControllers) { const int which = FindJoystick12IndexByInstanceId(event20->cbutton.which); if (which != -1) { event12.type = (event20->cbutton.state) ? SDL12_JOYBUTTONDOWN : SDL12_JOYBUTTONUP; event12.jbutton.which = (Uint8) which; event12.jbutton.button = event20->cbutton.button; event12.jbutton.state = event20->cbutton.state; } } break; /* case SDL_JOYDEVICEADDED: case SDL_JOYDEVICEREMOVED: case SDL_CONTROLLERDEVICEADDED: case SDL_CONTROLLERDEVICEREMOVED: case SDL_CONTROLLERDEVICEREMAPPED: case SDL_FINGERDOWN: case SDL_FINGERUP: case SDL_FINGERMOTION: case SDL_DOLLARGESTURE: case SDL_DOLLARRECORD: case SDL_MULTIGESTURE: case SDL_CLIPBOARDUPDATE: case SDL_DROPFILE: */ default: return 1; /* drop everything else. */ } PushEventIfNotFiltered(&event12); /* always pass it to the 2.0 event queue, as internal watchers (like the render API) might need to see these events to deal with logical scaling, etc. We've already copied it to the separate 1.2 event queue, and run the app's 1.2 event filter. Next time we call 1.2's SDL_PollEvent or SDL_PumpEvents(), we'll throw away the entire SDL2 event queue, as everything that cares about those will have then had a chance to examine it. */ return 1; } DECLSPEC12 void SDLCALL SDL_SetEventFilter(SDL12_EventFilter filter12) { /* We always have a filter installed, but will call the app's too. */ EventFilter12 = filter12; } DECLSPEC12 SDL12_EventFilter SDLCALL SDL_GetEventFilter(void) { return EventFilter12; } static SDL12_Rect * Rect20to12(const SDL_Rect *rect20, SDL12_Rect *rect12) { rect12->x = (Sint16) rect20->x; rect12->y = (Sint16) rect20->y; rect12->w = (Uint16) ((rect20->w <= 0) ? 0 : rect20->w); rect12->h = (Uint16) ((rect20->h <= 0) ? 0 : rect20->h); return rect12; } static SDL_Rect * Rect12to20(const SDL12_Rect *rect12, SDL_Rect *rect20) { rect20->x = (int) rect12->x; rect20->y = (int) rect12->y; rect20->w = (int) rect12->w; rect20->h = (int) rect12->h; return rect20; } static SDL_bool Surface20to12InPlace(SDL_Surface *surface20, SDL12_Surface *surface12) { SDL_BlendMode blendmode = SDL_BLENDMODE_NONE; SDL12_Palette *palette12 = NULL; SDL12_PixelFormat *format12 = NULL; Uint32 flags = 0; if (!surface20) { return SDL_FALSE; } if (surface20->pitch > 65535) { SDL20_SetError("Pitch is too large"); /* can't fit to 16-bits */ return SDL_FALSE; } if (surface20->format->palette) { palette12 = (SDL12_Palette *) SDL20_malloc(sizeof (SDL12_Palette)); if (!palette12) { goto failed; } } format12 = (SDL12_PixelFormat *) SDL20_malloc(sizeof (SDL12_PixelFormat)); if (!format12) { goto failed; } if (palette12) { SDL20_zerop(palette12); SDL_assert(surface20->format->palette); palette12->ncolors = surface20->format->palette->ncolors; palette12->colors = surface20->format->palette->colors; } SDL20_zerop(format12); format12->palette = palette12; format12->BitsPerPixel = surface20->format->BitsPerPixel; format12->BytesPerPixel = surface20->format->BytesPerPixel; format12->Rloss = surface20->format->Rloss; format12->Gloss = surface20->format->Gloss; format12->Bloss = surface20->format->Bloss; format12->Aloss = surface20->format->Aloss; format12->Rshift = surface20->format->Rshift; format12->Gshift = surface20->format->Gshift; format12->Bshift = surface20->format->Bshift; format12->Ashift = surface20->format->Ashift; format12->Rmask = surface20->format->Rmask; format12->Gmask = surface20->format->Gmask; format12->Bmask = surface20->format->Bmask; format12->Amask = surface20->format->Amask; if (SDL20_GetColorKey(surface20, &format12->colorkey) < 0) { format12->colorkey = 0; } else { surface12->flags |= SDL12_SRCCOLORKEY; } if (SDL20_GetSurfaceAlphaMod(surface20, &format12->alpha) < 0) { format12->alpha = 255; } SDL20_zerop(surface12); flags = surface20->flags; flags &= ~SDL_SIMD_ALIGNED; /* we don't need to map this to 1.2 */ #define MAPSURFACEFLAGS(fl) { if (surface20->flags & SDL_##fl) { surface12->flags |= SDL12_##fl; flags &= ~SDL_##fl; } } MAPSURFACEFLAGS(PREALLOC); MAPSURFACEFLAGS(RLEACCEL); /*MAPSURFACEFLAGS(DONTFREE);*/ #undef MAPSURFACEFLAGS SDL_assert(flags == 0); /* non-zero if there's a flag we didn't map. */ if ((SDL20_GetSurfaceBlendMode(surface20, &blendmode) == 0) && (blendmode == SDL_BLENDMODE_BLEND)) { surface12->flags |= SDL12_SRCALPHA; } surface12->format = format12; surface12->w = surface20->w; surface12->h = surface20->h; surface12->pitch = (Uint16) surface20->pitch; surface12->pixels = surface20->pixels; surface12->offset = 0; surface12->surface20 = surface20; Rect20to12(&surface20->clip_rect, &surface12->clip_rect); surface12->refcount = surface20->refcount; return SDL_TRUE; failed: SDL20_free(palette12); SDL20_free(format12); return SDL_FALSE; } static SDL12_Surface * Surface20to12(SDL_Surface *surface20) { SDL12_Surface *surface12 = NULL; surface12 = (SDL12_Surface *) SDL20_malloc(sizeof (SDL12_Surface)); if (!surface12) { goto failed; } SDL20_zerop(surface12); if (!Surface20to12InPlace(surface20, surface12)) { goto failed; } return surface12; failed: SDL20_free(surface12); return NULL; } static void SetPalette12ForMasks(SDL12_Surface *surface12, const Uint32 Rmask, const Uint32 Gmask, const Uint32 Bmask) { SDL12_PixelFormat *format12; SDL_Color *color; int i, ncolors; format12 = surface12->format; if (format12->palette && (Rmask || Bmask || Gmask)) { int Rw, Rm, Gw, Gm, Bw, Bm; #define LOSSMASKSHIFTSETUP(t) { \ format12->t##shift = 0; \ format12->t##loss = 8; \ if (t##mask) { \ Uint32 mask; \ for (mask = t##mask; !(mask & 1); mask >>= 1) { \ format12->t##shift++; \ } \ while (mask & 1) { \ format12->t##loss--; \ mask >>= 1; \ } \ } \ format12->t##mask = t##mask; \ } LOSSMASKSHIFTSETUP(R); LOSSMASKSHIFTSETUP(G); LOSSMASKSHIFTSETUP(B); #undef LOSSMASKSHIFTSETUP format12->Amask = 0; format12->Ashift = 0; format12->Aloss = 8; #define MASKSETUP(t) { \ t##w = 0, t##m = 0; \ if (t##mask) { \ t##w = 8 - format12->t##loss; \ for (i = format12->t##loss; i > 0; i -= t##w) { \ t##m |= 1 << i; \ } \ } \ } MASKSETUP(R); MASKSETUP(G); MASKSETUP(B); #undef MASKSETUP ncolors = format12->palette->ncolors; color = format12->palette->colors; for (i = 0; i < ncolors; i++, color++) { #define SETCOLOR(T, t) { \ const int x = (i & T##mask) >> format12->T##shift; \ color->t = (x << format12->T##loss) | ((x * T##m) >> T##w); \ } SETCOLOR(R, r); SETCOLOR(G, g); SETCOLOR(B, b); #undef SETCOLOR color->a = 255; } } } static SDL_Surface * CreateRGBSurface(Uint32 flags12, int width, int height, int depth, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask) { SDL_Surface *surface20; (void)flags12; /* SDL 1.2 checks this. */ if ((width >= 16384) || (height >= 65536)) { SDL20_SetError("Width or height is too large"); return NULL; } /* !!! FIXME: this isn't strictly correct, but SDL2 doesn't support !!! FIXME: arbitrary depths smaller than 8 bits, and this lets at !!! FIXME: least one game (rockdodger) function correctly. */ if (depth < 8 && depth != 1 && depth != 4) { if (WantDebugLogging) { SDL20_Log("This app is creating an %d-bit SDL_Surface, but we are bumping it to 8-bits. If you see rendering issues, please report them!", depth); } depth = 8; } if (depth <= 8) { /* don't pass masks to SDL2 for <= 8-bit surfaces, it'll cause problems. */ surface20 = SDL20_CreateRGBSurface(0, width, height, depth, 0, 0, 0, 0); } else { surface20 = SDL20_CreateRGBSurface(0, width, height, depth, Rmask, Gmask, Bmask, Amask); } /* SDL 1.2 would make a surface from almost any masks, even if it doesn't make sense; specifically, it will make a surface if a color mask is bogus. Sometimes this even worked because it would eventually land in a generic blitter that just copied data blindly. SDL2 wants more strict pixel formats, so try to detect this case and try again with a standard format. */ if ((surface20 == NULL) && (depth >= 16) && (SDL20_MasksToPixelFormatEnum(depth, Rmask, Gmask, Bmask, Amask) == SDL_PIXELFORMAT_UNKNOWN)) { /* I have no illusions this is correct, it just works for the known problem cases so far. */ if (depth == 16) { Rmask = SDL_SwapLE32(0x0000F800); Gmask = SDL_SwapLE32(0x000007E0); Bmask = SDL_SwapLE32(0x0000001F); Amask = 0; } else { Rmask = SDL_SwapLE32(0x000000FF); Gmask = SDL_SwapLE32(0x0000FF00); Bmask = SDL_SwapLE32(0x00FF0000); Amask = SDL_SwapLE32(Amask ? 0xFF000000 : 0x00000000); } surface20 = SDL20_CreateRGBSurface(0, width, height, depth, Rmask, Gmask, Bmask, Amask); } return surface20; } static void Surface12SetMasks(SDL12_Surface *surface12, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask) { SetPalette12ForMasks(surface12, Rmask, Gmask, Bmask); if (Amask != 0) { surface12->flags |= SDL12_SRCALPHA; SDL20_SetSurfaceBlendMode(surface12->surface20, SDL_BLENDMODE_BLEND); } } DECLSPEC12 SDL12_Surface * SDLCALL SDL_CreateRGBSurface(Uint32 flags12, int width, int height, int depth, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask) { SDL12_Surface *surface12; SDL_Surface *surface20; surface20 = CreateRGBSurface(flags12, width, height, depth, Rmask, Gmask, Bmask, Amask); if (!surface20) { return NULL; } surface12 = Surface20to12(surface20); if (!surface12) { SDL20_FreeSurface(surface20); return NULL; } SDL_assert(!(width && height) || ((surface12->flags & ~(SDL12_SRCCOLORKEY|SDL12_SRCALPHA))) == 0); /* shouldn't have prealloc, rleaccel, or dontfree. */ Surface12SetMasks(surface12, Rmask, Gmask, Bmask, Amask); return surface12; } DECLSPEC12 SDL12_Surface * SDLCALL SDL_CreateRGBSurfaceFrom(void *pixels, int width, int height, int depth, int pitch, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask) { SDL_Surface *surface20; SDL12_Surface *surface12; if ((width >= 16384) || (height >= 65536)) { SDL20_SetError("Width or height is too large"); return NULL; } if (depth == 8) { /* don't pass masks to SDL2 for 8-bit surfaces, it'll cause problems. */ surface20 = SDL20_CreateRGBSurfaceFrom(pixels, width, height, depth, pitch, 0, 0, 0, 0); } else { surface20 = SDL20_CreateRGBSurfaceFrom(pixels, width, height, depth, pitch, Rmask, Gmask, Bmask, Amask); } surface12 = Surface20to12(surface20); if (!surface12) { SDL20_FreeSurface(surface20); return NULL; } SDL_assert((surface12->flags & ~(SDL12_SRCCOLORKEY|SDL12_SRCALPHA)) == SDL12_PREALLOC); /* should _only_ have prealloc. */ /* TODO: Is it correct that this always ignored Amask, or should it be * using Surface12SetMasks which takes Amask into account? */ SetPalette12ForMasks(surface12, Rmask, Gmask, Bmask); return surface12; } DECLSPEC12 void SDLCALL SDL_FreeSurface(SDL12_Surface *surface12) { if (surface12 && (surface12 != VideoSurface12)) { surface12->refcount--; if (surface12->refcount) return; FreeSurfaceContents(surface12); SDL20_free(surface12); } } DECLSPEC12 void SDLCALL SDL_GetClipRect(SDL12_Surface *surface12, SDL12_Rect *rect) { if (surface12 && rect) { SDL20_memcpy(rect, &surface12->clip_rect, sizeof (SDL12_Rect)); } } DECLSPEC12 SDL_bool SDLCALL SDL_SetClipRect(SDL12_Surface *surface12, const SDL12_Rect *rect12) { SDL_bool retval = SDL_FALSE; if (surface12) { SDL_Rect rect20; retval = SDL20_SetClipRect(surface12->surface20, rect12 ? Rect12to20(rect12, &rect20) : NULL); SDL20_GetClipRect(surface12->surface20, &rect20); Rect20to12(&rect20, &surface12->clip_rect); } return retval; } DECLSPEC12 int SDLCALL SDL_FillRect(SDL12_Surface *dst, SDL12_Rect *dstrect12, Uint32 color) { SDL_Rect dstrect20; const int retval = SDL20_FillRect(dst->surface20, dstrect12 ? Rect12to20(dstrect12, &dstrect20) : NULL, color); if (retval == 0) { if (dstrect12) { /* 1.2 stores the clip intersection in dstrect */ SDL_Rect intersected20; SDL20_IntersectRect(&dstrect20, &dst->surface20->clip_rect, &intersected20); Rect20to12(&intersected20, dstrect12); } } return retval; } DECLSPEC12 Uint32 SDLCALL SDL_MapRGB(const SDL12_PixelFormat *format12, Uint8 r, Uint8 g, Uint8 b) { /* This is probably way slower than apps expect. */ SDL_PixelFormat format20; SDL_Palette palette20; return SDL20_MapRGB(PixelFormat12to20(&format20, &palette20, format12), r, g, b); } DECLSPEC12 Uint32 SDLCALL SDL_MapRGBA(const SDL12_PixelFormat *format12, Uint8 r, Uint8 g, Uint8 b, Uint8 a) { /* This is probably way slower than apps expect. */ SDL_PixelFormat format20; SDL_Palette palette20; return SDL20_MapRGBA(PixelFormat12to20(&format20, &palette20, format12), r, g, b, a); } DECLSPEC12 void SDLCALL SDL_GetRGB(Uint32 pixel, const SDL12_PixelFormat *format12, Uint8 *r, Uint8 *g, Uint8 *b) { /* This is probably way slower than apps expect. */ SDL_PixelFormat format20; SDL_Palette palette20; SDL20_GetRGB(pixel, PixelFormat12to20(&format20, &palette20, format12), r, g, b); } DECLSPEC12 void SDLCALL SDL_GetRGBA(Uint32 pixel, const SDL12_PixelFormat *format12, Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a) { /* This is probably way slower than apps expect. */ SDL_PixelFormat format20; SDL_Palette palette20; SDL20_GetRGBA(pixel, PixelFormat12to20(&format20, &palette20, format12), r, g, b, a); } DECLSPEC12 const SDL12_VideoInfo * SDLCALL SDL_GetVideoInfo(void) { return VideoInfo12.vfmt ? &VideoInfo12 : NULL; } DECLSPEC12 int SDLCALL SDL_VideoModeOK(int width, int height, int bpp, Uint32 sdl12flags) { int i, j, actual_bpp = 0; if (!SDL20_WasInit(SDL_INIT_VIDEO)) { return 0; } /* if the 1.2 video backend could center a surface in a larger mode, it would accept the size. Since we scale things, we will, too, even without an exact width/height match. */ if (!(sdl12flags & SDL12_FULLSCREEN)) { SDL_DisplayMode mode; SDL20_GetDesktopDisplayMode(VideoDisplayIndex, &mode); if ((mode.w >= width) && (mode.h >= height)) { actual_bpp = SDL_BITSPERPIXEL(mode.format); } } else { for (i = 0; i < VideoModesCount; ++i) { VideoModeList *vmode = &VideoModes[i]; for (j = 0; j < vmode->nummodes; ++j) { if (vmode->modeslist12[j].w >= width && vmode->modeslist12[j].h >= height) { if (!vmode->format) { return bpp; } if (SDL_BITSPERPIXEL(vmode->format) == 24 && bpp == 32) { actual_bpp = 32; } else if (SDL_BITSPERPIXEL(vmode->format) >= (Uint32) bpp) { actual_bpp = SDL_BITSPERPIXEL(vmode->format); } } } } } return (actual_bpp == 24) ? 32 : actual_bpp; } DECLSPEC12 SDL12_Rect ** SDLCALL SDL_ListModes(const SDL12_PixelFormat *format12, Uint32 flags) { VideoModeList *best_modes = NULL; Uint32 bpp; int i; SDL_bool windowed_mode_list = SDL12Compat_GetHintBoolean("SDL12COMPAT_WINDOWED_MODE_LIST", SDL_FALSE); if (!SDL20_WasInit(SDL_INIT_VIDEO)) { SDL20_SetError("Video subsystem not initialized"); return NULL; } if ((!format12) && (!VideoInfo12.vfmt)) { SDL20_SetError("No pixel format specified"); return NULL; } if (IsDummyVideo) { return (SDL12_Rect **) -1; /* 1.2's dummy driver always returns -1, and it's useful to special-case that. */ } if (!(flags & SDL12_FULLSCREEN) && !windowed_mode_list) { return (SDL12_Rect **) -1; /* any resolution is fine. */ } if (format12 && (format12 != VideoInfo12.vfmt)) { bpp = (Uint32) format12->BitsPerPixel; } else { bpp = SDL_BITSPERPIXEL(VideoInfoVfmt20->format); } for (i = 0; i < VideoModesCount; i++) { VideoModeList *modes = &VideoModes[i]; if (SDL_BITSPERPIXEL(modes->format) == bpp) { return modes->modes12; } if (SDL_BITSPERPIXEL(modes->format) == 24 && bpp == 32) { best_modes = modes; } else if (SDL_BITSPERPIXEL(modes->format) > bpp) { if (!best_modes || SDL_BITSPERPIXEL(modes->format) > SDL_BITSPERPIXEL(best_modes->format)) { best_modes = modes; } } } if (!best_modes) { SDL20_SetError("No modes support requested pixel format"); return NULL; } return best_modes->modes12; } DECLSPEC12 void SDLCALL SDL_FreeCursor(SDL12_Cursor *cursor12) { if (cursor12 == CurrentCursor12) { CurrentCursor12 = NULL; } if (cursor12) { if (cursor12->wm_cursor) { SDL20_FreeCursor(cursor12->wm_cursor); } SDL20_free(cursor12->data); SDL20_free(cursor12->mask); SDL20_free(cursor12); } } DECLSPEC12 SDL12_Cursor * SDLCALL SDL_CreateCursor(Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y) { const size_t datasize = h * (w / 8); SDL_Cursor *cursor20 = NULL; SDL12_Cursor *retval = NULL; retval = (SDL12_Cursor *) SDL20_malloc(sizeof (SDL12_Cursor)); if (!retval) { goto outofmem; } SDL20_zerop(retval); retval->data = (Uint8 *) SDL20_malloc(datasize); if (!retval->data) { goto outofmem; } retval->mask = (Uint8 *) SDL20_malloc(datasize); if (!retval->mask) { goto outofmem; } cursor20 = SDL20_CreateCursor(data, mask, w, h, hot_x, hot_y); if (!cursor20) { goto failed; } retval->area.w = w; retval->area.h = h; retval->hot_x = hot_x; retval->hot_y = hot_y; retval->wm_cursor = cursor20; /* we always leave retval->save as null pointers. */ SDL20_memcpy(retval->data, data, datasize); SDL20_memcpy(retval->mask, mask, datasize); return retval; outofmem: SDL20_OutOfMemory(); failed: SDL_FreeCursor(retval); return NULL; } DECLSPEC12 void SDLCALL SDL_SetCursor(SDL12_Cursor *cursor) { CurrentCursor12 = cursor; SDL20_SetCursor(cursor ? cursor->wm_cursor : NULL); } DECLSPEC12 SDL12_Cursor * SDLCALL SDL_GetCursor(void) { if (!CurrentCursor12) { CurrentCursor12 = SDL_CreateCursor(default_cdata, default_cmask, DEFAULT_CWIDTH, DEFAULT_CHEIGHT, DEFAULT_CHOTX, DEFAULT_CHOTY); } return CurrentCursor12; } static void GetEnvironmentWindowPosition(int *x, int *y) { int display = VideoDisplayIndex; const char *window = SDL12COMPAT_getenv_unsafe("SDL_VIDEO_WINDOW_POS"); const char *center = SDL12COMPAT_getenv_unsafe("SDL_VIDEO_CENTERED"); if (window) { if (SDL20_strcmp(window, "center") == 0) { center = window; } else if (SDL20_sscanf(window, "%d,%d", x, y) == 2) { return; } } if (center) { *x = SDL_WINDOWPOS_CENTERED_DISPLAY(display); *y = SDL_WINDOWPOS_CENTERED_DISPLAY(display); } else { *x = SDL_WINDOWPOS_UNDEFINED_DISPLAY(display); *y = SDL_WINDOWPOS_UNDEFINED_DISPLAY(display); } } static SDL12_Surface * EndVidModeCreate(void) { QueuedOverlayItem *overlay; if (OpenGLBlitTexture) { OpenGLFuncs.glDeleteTextures(1, &OpenGLBlitTexture); OpenGLBlitTexture = 0; } if (VideoTexture20) { SDL20_DestroyTexture(VideoTexture20); VideoTexture20 = NULL; } if (VideoRenderer20) { SDL20_DestroyRenderer(VideoRenderer20); VideoRenderer20 = NULL; } if (VideoRendererLock) { SDL20_DestroyMutex(VideoRendererLock); VideoRendererLock = NULL; } if (VideoGLContext20) { SDL20_GL_MakeCurrent(NULL, NULL); SDL20_GL_DeleteContext(VideoGLContext20); VideoGLContext20 = NULL; } if (VideoWindow20) { SDL20_DestroyWindow(VideoWindow20); VideoWindow20 = NULL; } if (VideoPhysicalPalette20) { SDL20_FreePalette(VideoPhysicalPalette20); VideoPhysicalPalette20 = NULL; } if (VideoSurface12) { SDL20_free(VideoSurface12->pixels); VideoSurface12->pixels = NULL; FreeSurfaceContents(VideoSurface12); } if (VideoConvertSurface20) { SDL20_FreeSurface(VideoConvertSurface20); VideoConvertSurface20 = NULL; } SDL20_zero(OpenGLFuncs); OpenGLBlitLockCount = 0; OpenGLLogicalScalingWidth = 0; OpenGLLogicalScalingHeight = 0; OpenGLLogicalScalingFBO = 0; OpenGLLogicalScalingColor = 0; OpenGLLogicalScalingDepth = 0; OpenGLLogicalScalingMultisampleFBO = 0; OpenGLLogicalScalingMultisampleColor = 0; OpenGLLogicalScalingMultisampleDepth = 0; MouseInputIsRelative = SDL_FALSE; MousePosition.x = 0; MousePosition.y = 0; overlay = QueuedDisplayOverlays.next; while (overlay != NULL) { QueuedOverlayItem *next = overlay->next; SDL_free(overlay); overlay = next; } QueuedDisplayOverlays.next = NULL; QueuedDisplayOverlaysTail = &QueuedDisplayOverlays; VideoSurfaceUpdatedInBackgroundThread = SDL_FALSE; SetVideoModeThread = 0; CurrentRefreshRate = SDL12_REFRESH_DEFAULT; return NULL; } /* Essentially the same as SDL_CreateRGBSurface, but in-place */ static void CreateVideoSurface(const Uint32 fmt) { Uint32 rmask, gmask, bmask, amask; int bpp; SDL_Surface *surface20; if (!SDL20_PixelFormatEnumToMasks(fmt, &bpp, &rmask, &gmask, &bmask, &amask)) { return; } SDL20_zerop(VideoSurface12); surface20 = CreateRGBSurface(0, 0, 0, bpp, rmask, gmask, bmask, amask); if (!Surface20to12InPlace(surface20, VideoSurface12)) { FreeSurfaceContents(VideoSurface12); return; } Surface12SetMasks(VideoSurface12, rmask, gmask, bmask, amask); } static SDL_Surface * CreateNullPixelSurface20(const int width, const int height, const Uint32 fmt) { SDL_Surface *surface20 = SDL20_CreateRGBSurfaceWithFormat(0, 0, 0, SDL_BITSPERPIXEL(fmt), fmt); if (surface20) { surface20->flags |= SDL_PREALLOC; surface20->pixels = NULL; surface20->w = width; surface20->h = height; surface20->pitch = 0; SDL20_SetClipRect(surface20, NULL); } return surface20; } static void LoadOpenGLFunctions(void) { const char *version; int major = 0, minor = 0; /* load core functions so we can guess about a few other things. */ SDL20_zero(OpenGLFuncs); OpenGLFuncs.SUPPORTS_Core = SDL_TRUE; #define OPENGL_SYM(ext,rc,fn,params,args,ret) OpenGLFuncs.fn = \ (OpenGLFuncs.SUPPORTS_##ext)? (openglfn_##fn##_t)SDL20_GL_GetProcAddress(#fn) : NULL; #include "SDL20_syms.h" version = (const char *) OpenGLFuncs.glGetString(GL_VERSION); if (!version || (SDL20_sscanf(version, "%d.%d", &major, &minor) != 2)) { major = minor = 0; } /* Lookup reported extensions. */ #define OPENGL_EXT(name) OpenGLFuncs.SUPPORTS_##name = SDL20_GL_ExtensionSupported(#name); #include "SDL20_syms.h" /* GL_ARB_framebuffer_object is in core OpenGL 3.0+ with the same entry point names as the extension version. */ if (major >= 3) { OpenGLFuncs.SUPPORTS_GL_ARB_framebuffer_object = SDL_TRUE; } if (major >= 2) { OpenGLFuncs.SUPPORTS_GL_ARB_texture_non_power_of_two = SDL_TRUE; /* core since 2.0 */ } /* load everything we can. */ #define OPENGL_SYM(ext,rc,fn,params,args,ret) OpenGLFuncs.fn = \ (OpenGLFuncs.SUPPORTS_##ext)? (openglfn_##fn##_t)SDL20_GL_GetProcAddress(#fn) : NULL; #include "SDL20_syms.h" } static void ResolveFauxBackbufferMSAA(void) { const GLboolean has_scissor = OpenGLFuncs.glIsEnabled(GL_SCISSOR_TEST); if (has_scissor) { OpenGLFuncs.glDisable(GL_SCISSOR_TEST); /* scissor test affects framebuffer_blit */ } OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLLogicalScalingFBO); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLLogicalScalingMultisampleFBO); OpenGLFuncs.glBlitFramebuffer(0, 0, OpenGLLogicalScalingWidth, OpenGLLogicalScalingHeight, 0, 0, OpenGLLogicalScalingWidth, OpenGLLogicalScalingHeight, GL_COLOR_BUFFER_BIT, GL_NEAREST); if (has_scissor) { OpenGLFuncs.glEnable(GL_SCISSOR_TEST); } OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLCurrentReadFBO); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLCurrentDrawFBO); } /* if the app binds its own framebuffer objects, it'll try to bind the window framebuffer (always zero) to draw to the screen, but if we're using a framebuffer object to handle scaling, we need to catch those binds and make sure rendering intended for the window framebuffer is redirected to our scaling FBO, so we have SDL_GL_GetProcAddress() hand out a shim for glBindFramebuffer to catch this. */ static void GLAPIENTRY glBindFramebuffer_shim_for_scaling(GLenum target, GLuint name) { /* OpenGLLogicalScaling{Multisample,}FBO will be zero if we aren't scaling, making this use the default. */ /* We always cache the current framebuffer when it's changed here, so we don't have to repeatedly ask OpenGL what the current framebuffer is, and so we can only force resolves if the currently bound read FBO is the default. */ if ((target == GL_READ_FRAMEBUFFER) || (target == GL_FRAMEBUFFER)) { if (OpenGLLogicalScalingMultisampleFBO) { /* We need to read from a resolves FBO if multisampling is enabled. */ OpenGLCurrentReadFBO = (name == 0) ? OpenGLLogicalScalingMultisampleFBO : name; } else { OpenGLCurrentReadFBO = (name == 0) ? OpenGLLogicalScalingFBO : name; } } if ((target == GL_DRAW_FRAMEBUFFER) || (target == GL_FRAMEBUFFER)) { OpenGLCurrentDrawFBO = (name == 0) ? OpenGLLogicalScalingFBO : name; } /* If multisampling is enabled, and we're trying using the default framebuffer, do a multisample resolve. */ if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) { ResolveFauxBackbufferMSAA(); } else { /* ResolveFauxBackbufferMSAA() will bind the framebuffers, otherwise we have to do it manually */ OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLCurrentReadFBO); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLCurrentDrawFBO); } } static void GLAPIENTRY glReadPixels_shim_for_scaling(GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *data) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glReadPixels(x, y, width, height, format, type, data); } static void GLAPIENTRY glCopyPixels_shim_for_scaling(GLint x, GLint y, GLsizei width, GLsizei height, GLenum type) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyPixels(x, y, width, height, type); } static void GLAPIENTRY glCopyTexImage1D_shim_for_scaling(GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyTexImage1D(target, level, internalformat, x, y, width, border); } static void GLAPIENTRY glCopyTexSubImage1D_shim_for_scaling(GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyTexSubImage1D(target, level, xoffset, x, y, width); } static void GLAPIENTRY glCopyTexImage2D_shim_for_scaling(GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyTexImage2D(target, level, internalformat, x, y, width, height, border); } static void GLAPIENTRY glCopyTexSubImage2D_shim_for_scaling(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyTexSubImage2D(target, level, xoffset, yoffset, x, y, width, height); } static void GLAPIENTRY glCopyTexSubImage3D_shim_for_scaling(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height) { if (OpenGLLogicalScalingMultisampleFBO && (OpenGLCurrentReadFBO == OpenGLLogicalScalingMultisampleFBO)) ResolveFauxBackbufferMSAA(); OpenGLFuncs.glCopyTexSubImage3D(target, level, xoffset, yoffset, zoffset, x, y, width, height); } static SDL_bool InitializeOpenGLScaling(const int w, const int h) { int alpha_size = 0; int depth_size = 0; int stencil_size = 0; SDL_assert(VideoWindow20 != NULL); /* Support the MOUSE_RELATIVE_SCALING hint from SDL 2.0 for OpenGL scaling. */ UseMouseRelativeScaling = SDL12Compat_GetHintBoolean("SDL_MOUSE_RELATIVE_SCALING", SDL_TRUE); if (!OpenGLFuncs.SUPPORTS_GL_ARB_framebuffer_object) { return SDL_FALSE; /* no FBOs, no scaling. */ } OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, 0); OpenGLFuncs.glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); SDL20_GL_SwapWindow(VideoWindow20); SDL20_GL_GetAttribute(SDL_GL_ALPHA_SIZE, &alpha_size); SDL20_GL_GetAttribute(SDL_GL_DEPTH_SIZE, &depth_size); SDL20_GL_GetAttribute(SDL_GL_STENCIL_SIZE, &stencil_size); if (!OpenGLLogicalScalingFBO) { OpenGLFuncs.glGenFramebuffers(1, &OpenGLLogicalScalingFBO); } if (!OpenGLLogicalScalingColor) { OpenGLFuncs.glGenRenderbuffers(1, &OpenGLLogicalScalingColor); } if (!OpenGLLogicalScalingDepth) { OpenGLFuncs.glGenRenderbuffers(1, &OpenGLLogicalScalingDepth); } OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, OpenGLLogicalScalingFBO); OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, OpenGLLogicalScalingColor); OpenGLFuncs.glRenderbufferStorageMultisample(GL_RENDERBUFFER, OpenGLLogicalScalingSamples, (alpha_size > 0) ? GL_RGBA8 : GL_RGB8, w, h); OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_COLOR_ATTACHMENT0, GL_RENDERBUFFER, OpenGLLogicalScalingColor); if (depth_size || stencil_size) { OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, OpenGLLogicalScalingDepth); OpenGLFuncs.glRenderbufferStorageMultisample(GL_RENDERBUFFER, OpenGLLogicalScalingSamples, GL_DEPTH24_STENCIL8, w, h); if (depth_size) { OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_DEPTH_ATTACHMENT, GL_RENDERBUFFER, OpenGLLogicalScalingDepth); } if (stencil_size) { OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_STENCIL_ATTACHMENT, GL_RENDERBUFFER, OpenGLLogicalScalingDepth); } } OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, 0); if ((OpenGLFuncs.glCheckFramebufferStatus(GL_FRAMEBUFFER) != GL_FRAMEBUFFER_COMPLETE) || OpenGLFuncs.glGetError()) { OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, 0); OpenGLFuncs.glDeleteRenderbuffers(1, &OpenGLLogicalScalingColor); OpenGLFuncs.glDeleteRenderbuffers(1, &OpenGLLogicalScalingDepth); OpenGLFuncs.glDeleteFramebuffers(1, &OpenGLLogicalScalingFBO); OpenGLLogicalScalingFBO = OpenGLLogicalScalingColor = OpenGLLogicalScalingDepth = 0; return SDL_FALSE; } if (OpenGLLogicalScalingSamples) { if (!OpenGLLogicalScalingMultisampleFBO) { OpenGLFuncs.glGenFramebuffers(1, &OpenGLLogicalScalingMultisampleFBO); } if (!OpenGLLogicalScalingMultisampleColor) { OpenGLFuncs.glGenRenderbuffers(1, &OpenGLLogicalScalingMultisampleColor); } if (!OpenGLLogicalScalingMultisampleDepth) { OpenGLFuncs.glGenRenderbuffers(1, &OpenGLLogicalScalingMultisampleDepth); } OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, OpenGLLogicalScalingMultisampleFBO); OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, OpenGLLogicalScalingMultisampleColor); OpenGLFuncs.glRenderbufferStorage(GL_RENDERBUFFER, (alpha_size > 0) ? GL_RGBA8 : GL_RGB8, w, h); OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_COLOR_ATTACHMENT0, GL_RENDERBUFFER, OpenGLLogicalScalingMultisampleColor); if (depth_size || stencil_size) { OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, OpenGLLogicalScalingMultisampleDepth); OpenGLFuncs.glRenderbufferStorage(GL_RENDERBUFFER, GL_DEPTH24_STENCIL8, w, h); if (depth_size) { OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_DEPTH_ATTACHMENT, GL_RENDERBUFFER, OpenGLLogicalScalingMultisampleDepth); } if (stencil_size) { OpenGLFuncs.glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_STENCIL_ATTACHMENT, GL_RENDERBUFFER, OpenGLLogicalScalingMultisampleDepth); } } OpenGLFuncs.glBindRenderbuffer(GL_RENDERBUFFER, 0); if ((OpenGLFuncs.glCheckFramebufferStatus(GL_FRAMEBUFFER) != GL_FRAMEBUFFER_COMPLETE) || OpenGLFuncs.glGetError()) { OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, 0); OpenGLFuncs.glDeleteRenderbuffers(1, &OpenGLLogicalScalingMultisampleColor); OpenGLFuncs.glDeleteRenderbuffers(1, &OpenGLLogicalScalingMultisampleDepth); OpenGLFuncs.glDeleteFramebuffers(1, &OpenGLLogicalScalingMultisampleFBO); OpenGLLogicalScalingMultisampleFBO = OpenGLLogicalScalingMultisampleColor = OpenGLLogicalScalingMultisampleDepth = 0; } OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLLogicalScalingFBO); OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLLogicalScalingMultisampleFBO); } /* initialise the cached current FBO bindings properly */ OpenGLCurrentReadFBO = OpenGLLogicalScalingMultisampleFBO ? OpenGLLogicalScalingMultisampleFBO : OpenGLLogicalScalingFBO; OpenGLCurrentDrawFBO = OpenGLLogicalScalingFBO; OpenGLFuncs.glViewport(0, 0, w, h); OpenGLFuncs.glScissor(0, 0, w, h); OpenGLLogicalScalingWidth = w; OpenGLLogicalScalingHeight = h; OpenGLFuncs.glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); return SDL_TRUE; } /* The idea here is that SDL's OpenGL-based renderers always notice if they aren't using the correct context and attempt to set the correct context before doing any work, but (at least for X11, and probably other platforms), the current context is thread-local, and _it's an error to set a context current if it's already current on another thread_. So we try to catch every place we call into the renderer and end that work with a call to this function, which will reset the GL context to NULL, so if an app tries to render from a background thread, the GL renderer will be able to set the context, do it's work, and then we reset it right after. Without this, we either need all apps to render exclusively on the main thread or fail to draw at all. This feels risky, but it's better than the alternative! Also, the renderer API isn't thread safe in general, so wrapping it in a mutex is necessary anyhow. */ static SDL_Renderer * LockVideoRenderer(void) { SDL20_LockMutex(VideoRendererLock); return VideoRenderer20; } static void UnlockVideoRenderer(void) { if ((VideoRenderer20 != NULL) && (SDL20_GL_GetCurrentContext() != NULL)) { SDL20_GL_MakeCurrent(NULL, NULL); } SDL20_UnlockMutex(VideoRendererLock); } static void UpdateInputGrab(void); static SDL_bool ShouldUseOpenGL(void) { /* Create an OpenGL window if the default renderer is OpenGL */ SDL_RendererInfo info; if (SDL20_GetRenderDriverInfo(0, &info) == 0) { if (SDL20_strncmp(info.name, "opengl", 6) == 0) { return SDL_TRUE; } } return SDL_FALSE; } static SDL12_Surface * SetVideoModeImpl(int width, int height, int bpp, Uint32 flags12) { SDL_DisplayMode dmode; Uint32 fullscreen_flags20 = 0; Uint32 appfmt; const char *vsync_env = SDL12Compat_GetHint("SDL12COMPAT_SYNC_TO_VBLANK"); float window_size_scaling = SDL12Compat_GetHintFloat("SDL12COMPAT_WINDOW_SCALING", 1.0f); int max_bpp = SDL12Compat_GetHintInt("SDL12COMPAT_MAX_BPP", 32); SDL_bool use_gl_scaling = SDL_FALSE; SDL_bool use_highdpi = SDL_TRUE; SDL_bool fix_bordless_fs_win = SDL_TRUE; int scaled_width = width; int scaled_height = height; const char *fromwin_env = NULL; int gl_max_fps; SDL_bool force_display_mode = SDL_FALSE; VideoSurface12 = &VideoSurface12Location; if (flags12 & SDL12_OPENGL) { /* For now we default GL scaling to ENABLED. If an app breaks or is linked directly to glBindFramebuffer, they'll need to turn it off with this environment variable. The reason we have a toggle to prevent this is because an app might use FBOs directly, and will cause this to break if they bind Framebuffer 0 instead of our render target. If we can fool them into calling a fake glBindFramebuffer that binds our logical FBO instead of the window framebuffer, we can probably work with these apps, too. That's easy from SDL_GL_GetProcAddress, but we would need to export the symbol from here too, for those that link against OpenGL directly, and we don't want to risk that. UT2004 is known to use FBOs with SDL 1.2, and I assume idTech 4 games (Doom 3, Quake 4, Prey) do as well. */ use_gl_scaling = WantOpenGLScaling; /* default use_highdpi to false for OpenGL windows when not using OpenGL scaling as legacy OpenGL applications are unlikely to support high-DPI setups properly. (They often use the window size to determine the resolution in some or all parts of their code.) Because OpenGL scaling is never used for windows, it is always false there. */ use_highdpi = (flags12 & SDL12_FULLSCREEN) ? use_gl_scaling : SDL_FALSE; gl_max_fps = SDL12Compat_GetHintInt("SDL12COMPAT_MAX_FPS", 0); if (gl_max_fps != 0) { OpenGLBuffersSwapTickInterval = 1000.f / gl_max_fps; OpenGLBuffersLastSwapTicks = SDL20_GetTicks(); } } use_highdpi = SDL12Compat_GetHintBoolean("SDL12COMPAT_HIGHDPI", use_highdpi); fix_bordless_fs_win = SDL12Compat_GetHintBoolean("SDL12COMPAT_FIX_BORDERLESS_FS_WIN", fix_bordless_fs_win); ForceGLSwapBufferContext = SDL12Compat_GetHintBoolean("SDL12COMPAT_FORCE_GL_SWAPBUFFER_CONTEXT", SDL_FALSE); flags12 &= ~SDL12_HWACCEL; /* just in case - https://github.com/libsdl-org/SDL-1.2/issues/817 */ /* SDL_SetVideoMode() implicitly inits if necessary. */ if (SDL20_WasInit(SDL_INIT_VIDEO) == 0) { if (SDL20_Init(SDL_INIT_VIDEO) < 0) { return NULL; } if (Init12Video() < 0) { return NULL; } } if ((width < 0) || (height < 0)) { SDL20_SetError("Invalid width or height"); return NULL; } if (SDL20_GetCurrentDisplayMode(VideoDisplayIndex, &dmode) < 0) { return NULL; } if (width == 0) { width = dmode.w; } if (height == 0) { height = dmode.h; } if (bpp == 0) { flags12 |= SDL12_ANYFORMAT; bpp = SDL_BITSPERPIXEL(dmode.format); /* keep this simple: we aren't handling palettes here, so for < 16-bit formats, give them 16-bit and we'll convert later. Nothing in SDL 1.2 will handle > 32 bits, so clamp there, too. AND ALSO, most apps will handle 32-bits but not 24, so force around that...so basically, you can have 16 or 32 bit. */ bpp = (bpp <= 16) ? 16 : max_bpp; } if ((bpp != 8) && (bpp != 16) && (bpp != 24) && (bpp != 32)) { if (flags12 & SDL12_ANYFORMAT) { bpp = max_bpp; } else { SDL20_SetError("Unsupported bits-per-pixel"); return NULL; } } appfmt = BPPToPixelFormat(bpp); SDL_assert((VideoSurface12->surface20 != NULL) == (VideoWindow20 != NULL)); if (VideoSurface12->surface20 && ((VideoSurface12->flags & SDL12_OPENGL) != (flags12 & SDL12_OPENGL))) { EndVidModeCreate(); /* rebuild the window if moving to/from a GL context */ } else if ((flags12 & SDL12_OPENGL) && VideoSurface12->surface20 && (VideoSurface12->surface20->format->format != appfmt)) { EndVidModeCreate(); /* rebuild the window if changing pixel format on an OpenGL surface */ } else if (DesiredRefreshRate != CurrentRefreshRate) { EndVidModeCreate(); /* rebuild the window if changing refresh rate */ } else { /* SDL 1.2 (infuriatingly!) destroys the window (and GL context!) on each resize in some cases, on various platforms. Try to match that. */ #ifdef __WINDOWS__ /* The windx5 driver _always_ destroyed the window, unconditionally, but the default (windib) did not, so match windib. * windib: keep if: * - window already exists * - BitsPerPixel hasn't changed (in OpenGL mode; for software we don't care about the format change). * - none of the window flags (except SDL_ANYFORMAT) have changed * - window is already SDL_OPENGL. * - window is not a fullscreen window. */ const Uint32 important_flags = ~(SDL12_PREALLOC | SDL12_ANYFORMAT); const SDL_bool recreate_window = ( ((VideoSurface12->flags & important_flags) != (flags12 & important_flags)) || ((flags12 & SDL12_OPENGL) && (!VideoSurface12->format || (VideoSurface12->format->BitsPerPixel != bpp))) || ((flags12 & SDL12_FULLSCREEN) == SDL12_FULLSCREEN) ) ? SDL_TRUE : SDL_FALSE; #elif defined(__APPLE__) const SDL_bool recreate_window = SDL_TRUE; /* macOS ("quartz" backend) unconditionally destroys the GL context */ #elif defined(__HAIKU__) const SDL_bool recreate_window = SDL_FALSE; /* BeOS and Haiku ("bwindow" backend) unconditionally keeps the GL context */ #elif defined(__LINUX__) || defined(unix) || defined(__unix__) || defined(__FreeBSD__) || defined(__NetBSD__) || defined(__OpenBSD__) || defined(sun) /* The x11 backend does in _some_ cases, and since Linux software depends on that, even though Wayland and * such wasn't a thing at the time, we treat everything that looks a little like Unix this way. * x11: keep if: * - window already exists * - window is already SDL_OPENGL. * - new flags also want SDL_OPENGL. * - BitsPerPixel hasn't changed (in OpenGL mode; for software we don't care about the format change). * - SDL_NOFRAME hasn't changed */ const SDL_bool recreate_window = ( ((VideoSurface12->flags & SDL12_OPENGL) != (flags12 & SDL12_OPENGL)) || ((flags12 & SDL12_OPENGL) && (!VideoSurface12->format || (VideoSurface12->format->BitsPerPixel != bpp))) || ((VideoSurface12->flags & SDL12_NOFRAME) != (flags12 & SDL12_NOFRAME)) ) ? SDL_TRUE : SDL_FALSE; #else const SDL_bool recreate_window = SDL_TRUE; /* everywhere else: nuke it from orbit. Oh well. */ #endif if (recreate_window) { EndVidModeCreate(); /* rebuild the window if we can't resize it. */ } } if (flags12 & SDL12_FULLSCREEN) { /* For software rendering, we're just going to push it off onto the GPU, so use FULLSCREEN_DESKTOP and logical scaling there. If possible, we'll do this with OpenGL, too, but we might not be able to. */ if ((use_gl_scaling || ((flags12 & SDL12_OPENGL) == 0) || ((dmode.w == width) && (dmode.h == height))) && (DesiredRefreshRate == SDL12_REFRESH_DEFAULT)) { fullscreen_flags20 |= SDL_WINDOW_FULLSCREEN_DESKTOP; } else { fullscreen_flags20 |= SDL_WINDOW_FULLSCREEN; if (DesiredRefreshRate != SDL12_REFRESH_DEFAULT) { force_display_mode = SDL_TRUE; } } } else if (fix_bordless_fs_win && (flags12 & SDL12_NOFRAME) && (width == dmode.w) && (height == dmode.h)) { /* app appears to be trying to do a "borderless fullscreen windowed" mode, so just bump it to FULLSCREEN_DESKTOP so it cooperates with various display managers (into a fullscreen space on macOS, hide the Dock on Gnome, etc). */ fullscreen_flags20 |= SDL_WINDOW_FULLSCREEN_DESKTOP; } fromwin_env = SDL12COMPAT_getenv_unsafe("SDL_WINDOWID"); if (fromwin_env) { window_size_scaling = 1.0f; /* don't scale for external windows */ } else if (window_size_scaling <= 0.0f) { window_size_scaling = 1.0f; /* bogus value, reset to default */ } else if (flags12 & SDL12_RESIZABLE) { window_size_scaling = 1.0f; /* assume that resizable windows are already prepared to handle whatever without scaling. */ } else if ((fullscreen_flags20 & SDL_WINDOW_FULLSCREEN_DESKTOP) != 0) { window_size_scaling = 1.0f; /* setting the window to fullscreen or fullscreen_desktop? Don't scale it. */ } else if ((flags12 & SDL12_OPENGL) && !use_gl_scaling) { window_size_scaling = 1.0f; /* OpenGL but not doing GL scaling? Don't allow window size scaling. */ } else { scaled_width = (int) (window_size_scaling * width); scaled_height = (int) (window_size_scaling * height); } if (fromwin_env) { char *endp = NULL; const Uint64 windowid = SDL_strtoull(fromwin_env, &endp, 0); if ((*fromwin_env == '\0') || (*endp != '\0')) { SDL20_SetError("Invalid SDL_WINDOWID"); return EndVidModeCreate(); } else { EndVidModeCreate(); VideoWindow20 = SDL20_CreateWindowFrom((void *) (size_t) (windowid)); if (!VideoWindow20) { return EndVidModeCreate(); } } } else if (!VideoWindow20) { /* create it */ int x = SDL_WINDOWPOS_UNDEFINED, y = SDL_WINDOWPOS_UNDEFINED; Uint32 flags20 = fullscreen_flags20; if (flags12 & SDL12_OPENGL) { flags20 |= SDL_WINDOW_OPENGL; } if (flags12 & SDL12_RESIZABLE) { flags20 |= SDL_WINDOW_RESIZABLE; } if (flags12 & SDL12_NOFRAME) { flags20 |= SDL_WINDOW_BORDERLESS; } if (use_highdpi) { flags20 |= SDL_WINDOW_ALLOW_HIGHDPI; } if (!(flags20 & SDL_WINDOW_OPENGL) && ShouldUseOpenGL()) { flags20 |= SDL_WINDOW_OPENGL; } /* most platforms didn't check these environment variables, but the major ones did (x11, windib, quartz), so we'll just offer it everywhere. */ GetEnvironmentWindowPosition(&x, &y); /* If GL scaling is disabled, and a multisampled buffer is requested, do it. */ if (!use_gl_scaling && (flags12 & SDL12_OPENGL) && OpenGLLogicalScalingSamples) { SDL20_GL_SetAttribute(SDL_GL_MULTISAMPLEBUFFERS, 1); SDL20_GL_SetAttribute(SDL_GL_MULTISAMPLESAMPLES, OpenGLLogicalScalingSamples); } VideoWindow20 = SDL20_CreateWindow(WindowTitle, x, y, scaled_width, scaled_height, flags20); if (!VideoWindow20 && (flags20 & SDL_WINDOW_OPENGL) && !(flags12 & SDL12_OPENGL)) { /* OpenGL might not be installed, try again without that flag */ flags20 &= ~SDL_WINDOW_OPENGL; VideoWindow20 = SDL20_CreateWindow(WindowTitle, x, y, scaled_width, scaled_height, flags20); } if (!VideoWindow20) { return EndVidModeCreate(); } if (VideoIcon20) { SDL20_SetWindowIcon(VideoWindow20, VideoIcon20); } if (force_display_mode) { SDL_DisplayMode desired_mode, closest_mode; SDL20_zero(desired_mode); SDL20_zero(closest_mode); desired_mode.w = scaled_width; desired_mode.h = scaled_height; desired_mode.refresh_rate = DesiredRefreshRate; if (!SDL20_GetClosestDisplayMode(SDL20_GetWindowDisplayIndex(VideoWindow20), &desired_mode, &closest_mode)) { return EndVidModeCreate(); } else if (SDL20_SetWindowDisplayMode(VideoWindow20, &closest_mode) < 0) { return EndVidModeCreate(); } CurrentRefreshRate = DesiredRefreshRate; } } else { /* resize it */ SDL20_SetWindowSize(VideoWindow20, scaled_width, scaled_height); SDL20_SetWindowFullscreen(VideoWindow20, fullscreen_flags20); /* This second SetWindowSize is a workaround for an SDL2 bug, see https://github.com/libsdl-org/sdl12-compat/issues/148 */ SDL20_SetWindowSize(VideoWindow20, scaled_width, scaled_height); SDL20_SetWindowBordered(VideoWindow20, (flags12 & SDL12_NOFRAME) ? SDL_FALSE : SDL_TRUE); SDL20_SetWindowResizable(VideoWindow20, (flags12 & SDL12_RESIZABLE) ? SDL_TRUE : SDL_FALSE); } if (VideoSurface12->surface20) { SDL20_free(VideoSurface12->pixels); } else { CreateVideoSurface(appfmt); if (!VideoSurface12->surface20) { return EndVidModeCreate(); } } VideoSurface12->surface20->flags |= SDL_PREALLOC; VideoSurface12->flags |= SDL12_PREALLOC; VideoSurface12->pixels = VideoSurface12->surface20->pixels = NULL; VideoSurface12->w = VideoSurface12->surface20->w = width; VideoSurface12->h = VideoSurface12->surface20->h = height; VideoSurface12->pitch = VideoSurface12->surface20->pitch = width * SDL_BYTESPERPIXEL(appfmt); SDL_SetClipRect(VideoSurface12, NULL); if (flags12 & SDL12_FULLSCREEN) { VideoSurface12->flags |= SDL12_FULLSCREEN; } else { VideoSurface12->flags &= ~SDL12_FULLSCREEN; } if (flags12 & SDL12_RESIZABLE) { VideoSurface12->flags |= SDL12_RESIZABLE; } else { VideoSurface12->flags &= ~SDL12_RESIZABLE; } if (flags12 & SDL12_OPENGL) { SDL_assert(!VideoTexture20); /* either a new window or we destroyed all this */ SDL_assert(!VideoRenderer20); if (!VideoGLContext20) { VideoGLContext20 = SDL20_GL_CreateContext(VideoWindow20); if (!VideoGLContext20) { return EndVidModeCreate(); } LoadOpenGLFunctions(); } VideoSurface12->flags |= SDL12_OPENGL; /* Try to set up a logical scaling */ if (use_gl_scaling) { if (!InitializeOpenGLScaling(width, height)) { const SDL_bool was_fullscreen = ((fullscreen_flags20 & SDL_WINDOW_FULLSCREEN_DESKTOP) != 0) ? SDL_TRUE : SDL_FALSE; window_size_scaling = 1.0f; use_gl_scaling = SDL_FALSE; fullscreen_flags20 &= ~SDL_WINDOW_FULLSCREEN_DESKTOP; SDL20_SetWindowFullscreen(VideoWindow20, fullscreen_flags20); SDL20_SetWindowSize(VideoWindow20, width, height); /* not scaled_width, scaled_height */ if (was_fullscreen) { fullscreen_flags20 |= SDL_WINDOW_FULLSCREEN; SDL20_SetWindowFullscreen(VideoWindow20, fullscreen_flags20); } } } if ((flags12 & SDL12_OPENGLBLIT) == SDL12_OPENGLBLIT) { const int pixsize = VideoSurface12->format->BytesPerPixel; const GLenum glfmt = (pixsize == 4) ? GL_RGBA : GL_RGB; const GLenum gltype = (pixsize == 4) ? GL_UNSIGNED_BYTE : GL_UNSIGNED_SHORT_5_6_5; if (!OpenGLFuncs.SUPPORTS_GL_ARB_texture_non_power_of_two) { SDL20_SetError("Your OpenGL drivers don't support NPOT textures for SDL_OPENGLBLIT; please upgrade."); return EndVidModeCreate(); } if (!OpenGLBlitTexture) { OpenGLFuncs.glGenTextures(1, &OpenGLBlitTexture); } OpenGLFuncs.glBindTexture(GL_TEXTURE_2D, OpenGLBlitTexture); OpenGLFuncs.glTexImage2D(GL_TEXTURE_2D, 0, (pixsize == 4) ? GL_RGBA : GL_RGB, VideoSurface12->w, VideoSurface12->h, 0, glfmt, gltype, NULL); VideoSurface12->surface20->pixels = SDL20_malloc(height * VideoSurface12->pitch); VideoSurface12->pixels = VideoSurface12->surface20->pixels; if (!VideoSurface12->pixels) { SDL20_OutOfMemory(); return EndVidModeCreate(); } SDL20_memset(VideoSurface12->pixels, 0xFF, height * VideoSurface12->pitch); /* SDL 1.2 default OPENGLBLIT surface to full intensity */ VideoSurface12->flags |= SDL12_OPENGLBLIT; } if (vsync_env) { SDL20_GL_SetSwapInterval(SDL20_atoi(vsync_env)); } else { SDL20_GL_SetSwapInterval(SwapInterval); } } else { /* always use a renderer for non-OpenGL windows. */ const char *old_scale_quality = SDL20_GetHint(SDL_HINT_RENDER_SCALE_QUALITY); const SDL_bool want_vsync = (vsync_env && SDL20_atoi(vsync_env)) ? SDL_TRUE : SDL_FALSE; SDL_RendererInfo rinfo; SDL_assert(!VideoGLContext20); /* either a new window or we destroyed all this */ if (!VideoRendererLock) { VideoRendererLock = SDL20_CreateMutex(); if (!VideoRendererLock) { return EndVidModeCreate(); } } if (!VideoRenderer20 && want_vsync) { VideoRenderer20 = SDL20_CreateRenderer(VideoWindow20, -1, SDL_RENDERER_ACCELERATED|SDL_RENDERER_PRESENTVSYNC); } if (!VideoRenderer20) { VideoRenderer20 = SDL20_CreateRenderer(VideoWindow20, -1, SDL_RENDERER_ACCELERATED); } if (!VideoRenderer20) { VideoRenderer20 = SDL20_CreateRenderer(VideoWindow20, -1, 0); } if (!VideoRenderer20) { return EndVidModeCreate(); } SDL20_RenderSetLogicalSize(VideoRenderer20, width, height); /* we need to make sure we're at the back of the Event Watch queue */ SDL20_DelEventWatch(EventFilter20to12, NULL); SDL20_AddEventWatch(EventFilter20to12, NULL); SDL20_SetRenderDrawColor(VideoRenderer20, 0, 0, 0, 255); /* leave this black always, we only use it to clear the framebuffer. */ SDL20_RenderClear(VideoRenderer20); SDL20_RenderPresent(VideoRenderer20); if (SDL20_GetRendererInfo(VideoRenderer20, &rinfo) < 0) { return EndVidModeCreate(); } if (!VideoTexture20) { SDL20_SetHint(SDL_HINT_RENDER_SCALE_QUALITY, WantScaleMethodNearest ? "0" : "1"); VideoTexture20 = SDL20_CreateTexture(VideoRenderer20, rinfo.texture_formats[0], SDL_TEXTUREACCESS_STREAMING, width, height); SDL20_SetHint(SDL_HINT_RENDER_SCALE_QUALITY, old_scale_quality); if (!VideoTexture20) { return EndVidModeCreate(); } } /* clear the texture for (re)use */ { SDL_Surface *surface = NULL; if (SDL20_LockTextureToSurface(VideoTexture20, NULL, &surface) == 0) { SDL20_FillRect(surface, NULL, SDL20_MapRGB(surface->format, 0, 0, 0)); SDL20_UnlockTexture(VideoTexture20); } } /* don't need conversion, or need to change the conversion surface's format? Nuke the existing surface (and maybe rebuild it later). */ if (VideoConvertSurface20 && ((rinfo.texture_formats[0] == appfmt) || (rinfo.texture_formats[0] != VideoConvertSurface20->format->format))) { SDL20_FreeSurface(VideoConvertSurface20); VideoConvertSurface20 = NULL; } if (rinfo.texture_formats[0] != appfmt) { /* need to convert between app's format and texture format */ VideoConvertSurface20 = CreateNullPixelSurface20(width, height, rinfo.texture_formats[0]); if (!VideoConvertSurface20) { return EndVidModeCreate(); } } VideoSurface12->flags &= ~SDL12_OPENGL; VideoSurface12->surface20->pixels = SDL20_calloc(height, VideoSurface12->pitch); VideoSurface12->pixels = VideoSurface12->surface20->pixels; if (!VideoSurface12->pixels) { SDL20_OutOfMemory(); return EndVidModeCreate(); } /* fill in the same default palette that SDL 1.2 does... */ if (VideoSurface12->format->BitsPerPixel == 8) { int i; SDL_Color *color = VideoSurface12->format->palette->colors; for (i = 0; i < 256; i++, color++) { { const int x = i & 0xe0; color->r = x | x >> 3 | x >> 6; } { const int x = (i << 3) & 0xe0; color->g = x | x >> 3 | x >> 6; } { const int x = (i & 0x3) | ((i & 0x3) << 2); color->b = x | x << 4; } color->a = 255; } if (!VideoPhysicalPalette20) { VideoPhysicalPalette20 = SDL20_AllocPalette(256); if (!VideoPhysicalPalette20) { return EndVidModeCreate(); } } SDL20_SetPaletteColors(VideoPhysicalPalette20, VideoSurface12->format->palette->colors, 0, 256); } } SetVideoModeThread = SDL20_ThreadID(); VideoSurfacePresentTicks = 0; VideoSurfaceLastPresentTicks = 0; VideoSurfaceUpdatedInBackgroundThread = SDL_FALSE; SDL20_RaiseWindow(VideoWindow20); UpdateInputGrab(); if ((flags12 & SDL12_OPENGL) == 0) { /* see notes above these functions about GL context resetting. Force a lock/unlock here to set that up. */ LockVideoRenderer(); UnlockVideoRenderer(); } SDL_PumpEvents(); /* run this once at startup. */ return VideoSurface12; } DECLSPEC12 SDL12_Surface * SDLCALL SDL_SetVideoMode(int width, int height, int bpp, Uint32 flags12) { SDL12_Surface *retval; SetVideoModeInProgress = SDL_TRUE; retval = SetVideoModeImpl(width, height, bpp, flags12); SetVideoModeInProgress = SDL_FALSE; return retval; } /* SDL_SetRefreshRate was never in an real SDL-1.2 release, but apparently StepMania was maintaining a fork with this API for literally years. */ DECLSPEC12 void SDLCALL SDL_SetRefreshRate(int rate) { DesiredRefreshRate = (rate >= 0) ? rate : 0; /* takes effect on next SDL_SetVideoMode call. */ } DECLSPEC12 SDL12_Surface * SDLCALL SDL_GetVideoSurface(void) { return VideoSurface12; } static int SaveDestAlpha(SDL12_Surface *src12, SDL12_Surface *dst12, SDL_Rect *dstrect20, Uint8 **retval) { /* The 1.2 docs say this: * RGBA->RGBA: * SDL_SRCALPHA set: * alpha-blend (using the source alpha channel) the RGB values; * leave destination alpha untouched. [Note: is this correct?] * * In SDL2, we change the destination alpha. We have to save it off in this case, which sucks. */ Uint8 *dstalpha = NULL; const SDL_bool save_dstalpha = (PreserveDestinationAlpha && (src12->flags & SDL12_SRCALPHA) && dst12->format->Amask && ((src12->format->alpha != 255) || src12->format->Amask)) ? SDL_TRUE : SDL_FALSE; if (save_dstalpha && (dstrect20->w > 0) && (dstrect20->h > 0)) { const Uint32 amask = dst12->format->Amask; const Uint32 ashift = dst12->format->Ashift; const Uint16 pitch = dst12->pitch; Uint8 *dptr; int x, y, w, h; w = dstrect20->w; h = dstrect20->h; dstalpha = (Uint8 *) SDL20_malloc(w * h); if (!dstalpha) { *retval = NULL; return SDL20_OutOfMemory(); } dptr = dstalpha; if (dst12->format->BytesPerPixel == 2) { const Uint16 *sptr = (const Uint16 *) dst12->pixels; sptr += ((dst12->pitch / 2) * dstrect20->y) + dstrect20->x; for (y = 0; y < h; y++) { for (x = 0; x < w; x++) { *(dptr++) = (Uint8) ((sptr[x] & amask) >> ashift); } sptr = (Uint16 *) (((Uint8 *) sptr) + pitch); } } else if (dst12->format->BytesPerPixel == 4) { const Uint32 *sptr = (const Uint32 *) dst12->pixels; sptr += ((dst12->pitch / 4) * dstrect20->y) + dstrect20->x; for (y = 0; y < h; y++) { for (x = 0; x < w; x++) { *(dptr++) = (Uint8) ((sptr[x] & amask) >> ashift); } sptr = (Uint32 *) (((Uint8 *) sptr) + pitch); } } else { SDL_assert(!"Unhandled dest alpha"); } } *retval = dstalpha; return 0; } static void RestoreDestAlpha(SDL12_Surface *dst12, Uint8 *dstalpha, const SDL_Rect *dstrect20) { if (dstalpha) { const Uint8 *sptr = dstalpha; const Uint32 amask = dst12->format->Amask; const Uint32 ashift = dst12->format->Ashift; const Uint16 pitch = dst12->pitch; int x, y, w, h; w = dstrect20->w; h = dstrect20->h; if (dst12->format->BytesPerPixel == 2) { Uint16 *dptr = (Uint16 *) dst12->pixels; dptr += ((dst12->pitch / 2) * dstrect20->y) + dstrect20->x; for (y = 0; y < h; y++) { for (x = 0; x < w; x++) { dptr[x] = (Uint16) ((dptr[x] & ~amask) | ((((Uint16) *(sptr++)) << ashift) & amask)); } dptr = (Uint16 *) (((Uint8 *) dptr) + pitch); } } else if (dst12->format->BytesPerPixel == 4) { Uint32 *dptr = (Uint32 *) dst12->pixels; dptr += ((dst12->pitch / 4) * dstrect20->y) + dstrect20->x; for (y = 0; y < h; y++) { for (x = 0; x < w; x++) { dptr[x] = (dptr[x] & ~amask) | ((((Uint32) *(sptr++)) << ashift) & amask); } dptr = (Uint32 *) (((Uint8 *) dptr) + pitch); } } else { SDL_assert(!"Unhandled dest alpha"); } SDL20_free(dstalpha); } } static void PrepBlitDestRect(SDL_Rect *dstrect20, SDL12_Surface *dst12, const SDL12_Rect *dstrect12) { /* dstrect12 w and h is ignored, SDL 1.2 only cares about position. */ dstrect20->w = dst12->w; dstrect20->h = dst12->h; if (dstrect12) { SDL_Rect fulldstrect20; fulldstrect20.x = fulldstrect20.y = 0; fulldstrect20.w = dst12->w; fulldstrect20.h = dst12->h; dstrect20->x = dstrect12->x; dstrect20->y = dstrect12->y; SDL20_IntersectRect(&fulldstrect20, dstrect20, dstrect20); } else { dstrect20->x = 0; dstrect20->y = 0; } } DECLSPEC12 int SDLCALL SDL_UpperBlit(SDL12_Surface *src12, SDL12_Rect *srcrect12, SDL12_Surface *dst12, SDL12_Rect *dstrect12) { Uint8 *dstalpha; SDL_Rect srcrect20, dstrect20; int retval; PrepBlitDestRect(&dstrect20, dst12, dstrect12); if ((src12 == NULL) || (dst12 == NULL)) { return SDL20_SetError("SDL_UpperBlit: passed a NULL surface"); } if ((src12->pixels == NULL) || (dst12->pixels == NULL)) { return SDL20_SetError("SDL_UpperBlit: passed a surface with NULL pixels"); } if (SaveDestAlpha(src12, dst12, &dstrect20, &dstalpha) < 0) { return -1; } retval = SDL20_UpperBlit(src12->surface20, srcrect12 ? Rect12to20(srcrect12, &srcrect20) : NULL, dst12->surface20, dstrect12 ? Rect12to20(dstrect12, &dstrect20) : NULL); RestoreDestAlpha(dst12, dstalpha, &dstrect20); if (dstrect12) { Rect20to12(&dstrect20, dstrect12); } return retval; } DECLSPEC12 int SDLCALL SDL_LowerBlit(SDL12_Surface *src12, SDL12_Rect *srcrect12, SDL12_Surface *dst12, SDL12_Rect *dstrect12) { Uint8 *dstalpha; SDL_Rect srcrect20, dstrect20; int retval; PrepBlitDestRect(&dstrect20, dst12, dstrect12); if (SaveDestAlpha(src12, dst12, &dstrect20, &dstalpha) < 0) { return -1; } retval = SDL20_LowerBlit(src12->surface20, srcrect12 ? Rect12to20(srcrect12, &srcrect20) : NULL, dst12->surface20, dstrect12 ? Rect12to20(dstrect12, &dstrect20) : NULL); RestoreDestAlpha(dst12, dstalpha, &dstrect20); if (srcrect12) { Rect20to12(&srcrect20, srcrect12); } if (dstrect12) { Rect20to12(&dstrect20, dstrect12); } return retval; } DECLSPEC12 int SDLCALL SDL_SoftStretch(SDL12_Surface *src12, SDL12_Rect *srcrect12, SDL12_Surface *dst12, SDL12_Rect *dstrect12) { SDL_Rect srcrect20, dstrect20; return SDL20_SoftStretch(src12->surface20, srcrect12 ? Rect12to20(srcrect12, &srcrect20) : NULL, dst12->surface20, dstrect12 ? Rect12to20(dstrect12, &dstrect20) : NULL); } DECLSPEC12 int SDLCALL SDL_SetAlpha(SDL12_Surface *surface12, Uint32 flags12, Uint8 value) { /* note that SDL 1.2 does not check if surface12 is NULL before dereferencing it either */ const SDL_bool addkey = (flags12 & SDL12_SRCALPHA) ? SDL_TRUE : SDL_FALSE; int retval = 0; if (addkey) { if (!surface12->format->Amask) { /* whole-surface alpha is ignored if surface has an alpha channel. */ retval = SDL20_SetSurfaceAlphaMod(surface12->surface20, value); if (SDL20_GetSurfaceAlphaMod(surface12->surface20, &surface12->format->alpha) < 0) { surface12->format->alpha = 255; } } surface12->flags |= SDL12_SRCALPHA; SDL20_SetSurfaceBlendMode(surface12->surface20, SDL_BLENDMODE_BLEND); } else { if (!surface12->format->Amask) { /* whole-surface alpha is ignored if surface has an alpha channel. */ retval = SDL20_SetSurfaceAlphaMod(surface12->surface20, 255); if (SDL20_GetSurfaceAlphaMod(surface12->surface20, &surface12->format->alpha) < 0) { surface12->format->alpha = 255; } } surface12->flags &= ~SDL12_SRCALPHA; SDL20_SetSurfaceBlendMode(surface12->surface20, SDL_BLENDMODE_NONE); } return retval; } DECLSPEC12 int SDLCALL SDL_LockSurface(SDL12_Surface *surface12) { int retval = 0; /* just pretend to lock for the screen surface, but ignore it. */ if (surface12 != VideoSurface12) { retval = SDL20_LockSurface(surface12->surface20); surface12->pixels = surface12->surface20->pixels; surface12->pitch = surface12->surface20->pitch; } return retval; } DECLSPEC12 void SDLCALL SDL_UnlockSurface(SDL12_Surface *surface12) { /* just pretend to lock for the screen surface, but ignore it. */ if (surface12 != VideoSurface12) { SDL20_UnlockSurface(surface12->surface20); surface12->pixels = surface12->surface20->pixels; surface12->pitch = surface12->surface20->pitch; } } DECLSPEC12 int SDLCALL SDL_SetColorKey(SDL12_Surface *surface12, Uint32 flag12, Uint32 key) { const SDL_bool addkey = (flag12 & SDL12_SRCCOLORKEY) ? SDL_TRUE : SDL_FALSE; const int retval = SDL20_SetColorKey(surface12->surface20, addkey, key); if (SDL20_GetColorKey(surface12->surface20, &surface12->format->colorkey) < 0) { surface12->format->colorkey = 0; } if (addkey) { surface12->flags |= SDL12_SRCCOLORKEY; /* you could set a color key on a 1.2 surface that had an alpha channel, but it would be ignored during blits. */ if (surface12->format->Amask) { SDL20_SetColorKey(surface12->surface20, SDL_FALSE, key); } } else { surface12->flags &= ~SDL12_SRCCOLORKEY; } return retval; } DECLSPEC12 SDL12_Surface * SDLCALL SDL_ConvertSurface(SDL12_Surface *src12, const SDL12_PixelFormat *format12, Uint32 flags12) { Uint32 flags20 = 0; SDL_PixelFormat format20; SDL_Palette palette20; SDL_Surface *surface20; SDL12_Surface *retval = NULL; if (flags12 & SDL12_PREALLOC) flags20 |= SDL_PREALLOC; if (flags12 & SDL12_RLEACCEL) flags20 |= SDL_RLEACCEL; surface20 = SDL20_ConvertSurface(src12->surface20, PixelFormat12to20(&format20, &palette20, format12), flags20); if (surface20) { retval = Surface20to12(surface20); if (!retval) { SDL20_FreeSurface(surface20); } else { if (retval->format->Amask != 0) { SDL20_SetSurfaceBlendMode(surface20, SDL_BLENDMODE_BLEND); retval->flags |= SDL12_SRCALPHA; } if (flags12 & SDL12_SRCCOLORKEY) { Uint8 r, g, b, a; SDL20_GetRGBA(src12->format->colorkey, src12->surface20->format, &r, &g, &b, &a); SDL_SetColorKey(retval, SDL12_SRCCOLORKEY, SDL20_MapRGBA(retval->surface20->format, r, g, b, a)); } } } return retval; } DECLSPEC12 SDL12_Surface * SDLCALL SDL_DisplayFormat(SDL12_Surface *surface12) { const Uint32 flags = surface12->flags & (SDL12_SRCCOLORKEY|SDL12_SRCALPHA|SDL12_RLEACCELOK); if (!VideoSurface12 || !VideoSurface12->surface20) { SDL20_SetError("No video mode has been set"); return NULL; } return SDL_ConvertSurface(surface12, VideoSurface12->format, flags); } DECLSPEC12 SDL12_Surface * SDLCALL SDL_DisplayFormatAlpha(SDL12_Surface *surface12) { const Uint32 flags = surface12->flags & (SDL12_SRCALPHA|SDL12_RLEACCELOK); SDL12_Surface *retval = NULL; SDL_PixelFormat *fmt20 = NULL; SDL12_PixelFormat fmt12; if (!VideoSurface12 || !VideoSurface12->surface20) { SDL20_SetError("No video mode has been set"); return NULL; } /* we only allow a few formats for the screen surface, and this is the appropriate alpha format for all of them. */ fmt20 = SDL20_AllocFormat(SDL_PIXELFORMAT_ARGB8888); if (!fmt20) { return NULL; } retval = SDL_ConvertSurface(surface12, PixelFormat20to12(&fmt12, NULL, fmt20), flags); SDL20_FreeFormat(fmt20); return retval; } static void PresentScreen(void) { QueuedOverlayItem *overlay; SDL_Renderer *renderer = LockVideoRenderer(); if (!renderer) { return; } /* We don't actually implement an event thread in sdl12-compat, but some * games will only call SDL_PeepEvents(), which doesn't otherwise pump * events, and get stuck when they've consumed all the events. * * Just pumping the event loop here simulates an event thread well enough * for most things. */ if (EventThreadEnabled) { SDL_PumpEvents(); } SDL20_RenderClear(renderer); SDL20_RenderCopy(renderer, VideoTexture20, NULL, NULL); /* Render any pending YUV overlay over the surface texture. */ overlay = QueuedDisplayOverlays.next; if (overlay) { while (overlay != NULL) { QueuedOverlayItem *next = overlay->next; if (overlay->overlay12) { SDL12_YUVData *hwdata = (SDL12_YUVData *) overlay->overlay12->hwdata; SDL_Rect dstrect20; SDL20_RenderCopy(renderer, hwdata->texture20, NULL, Rect12to20(&overlay->dstrect12, &dstrect20)); } SDL_free(overlay); overlay = next; } QueuedDisplayOverlays.next = NULL; QueuedDisplayOverlaysTail = &QueuedDisplayOverlays; } SDL20_RenderPresent(renderer); VideoSurfaceUpdatedInBackgroundThread = SDL_FALSE; VideoSurfaceLastPresentTicks = SDL20_GetTicks(); VideoSurfacePresentTicks = 0; UnlockVideoRenderer(); } static void UpdateRect12to20(SDL12_Surface *surface12, const SDL12_Rect *rect12, SDL_Rect *rect20, SDL_bool *whole_screen) { Rect12to20(rect12, rect20); if (!rect20->x && !rect20->y && !rect20->w && !rect20->h) { *whole_screen = SDL_TRUE; rect20->w = surface12->w; rect20->h = surface12->h; } else { SDL_Rect surfacerect20; surfacerect20.x = surfacerect20.y = 0; surfacerect20.w = surface12->w; surfacerect20.h = surface12->h; Rect12to20(rect12, rect20); SDL20_IntersectRect(&surfacerect20, rect20, rect20); if ((rect20->x == 0) && (rect20->y == 0) && (rect20->w == surface12->w) && (rect20->h == surface12->h)) { *whole_screen = SDL_TRUE; } } } /* For manual throttling of screen updates. */ static int GetDesiredMillisecondsPerFrame(void) { SDL_DisplayMode mode; if (VideoSurface12->flags & SDL12_FULLSCREEN) { SDL_assert(VideoWindow20 != NULL); if (SDL20_GetWindowDisplayMode(VideoWindow20, &mode) == 0) { if (mode.refresh_rate) { return 1000 / mode.refresh_rate; } } } else if (SDL20_GetCurrentDisplayMode(VideoDisplayIndex, &mode) == 0) { /* If we're windowed, assume we're on the default screen. */ if (mode.refresh_rate) { return 1000 / mode.refresh_rate; } } return 15; } /* SDL_OPENGLBLIT support APIs. https://discourse.libsdl.org/t/ogl-and-sdl/2775/3 */ DECLSPEC12 void SDLCALL SDL_GL_Lock(void) { if (!OpenGLBlitTexture) { return; } if (++OpenGLBlitLockCount == 1) { OpenGLFuncs.glPushAttrib(GL_ALL_ATTRIB_BITS); OpenGLFuncs.glPushClientAttrib(GL_CLIENT_PIXEL_STORE_BIT); OpenGLFuncs.glEnable(GL_TEXTURE_2D); OpenGLFuncs.glEnable(GL_BLEND); OpenGLFuncs.glDisable(GL_FOG); OpenGLFuncs.glDisable(GL_ALPHA_TEST); OpenGLFuncs.glDisable(GL_DEPTH_TEST); OpenGLFuncs.glDisable(GL_SCISSOR_TEST); OpenGLFuncs.glDisable(GL_STENCIL_TEST); OpenGLFuncs.glDisable(GL_CULL_FACE); OpenGLFuncs.glBindTexture(GL_TEXTURE_2D, OpenGLBlitTexture); OpenGLFuncs.glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); OpenGLFuncs.glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); OpenGLFuncs.glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); OpenGLFuncs.glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_WRAP_S, GL_REPEAT); OpenGLFuncs.glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_WRAP_T, GL_REPEAT); OpenGLFuncs.glPixelStorei(GL_UNPACK_ROW_LENGTH, VideoSurface12->pitch / VideoSurface12->format->BytesPerPixel); OpenGLFuncs.glBlendFunc(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA); OpenGLFuncs.glColor4f(1.0f, 1.0f, 1.0f, 1.0f); OpenGLFuncs.glViewport(0, 0, VideoSurface12->w, VideoSurface12->h); OpenGLFuncs.glMatrixMode(GL_PROJECTION); OpenGLFuncs.glPushMatrix(); OpenGLFuncs.glLoadIdentity(); OpenGLFuncs.glOrtho(0.0, (GLdouble) VideoSurface12->w, (GLdouble) VideoSurface12->h, 0.0, 0.0, 1.0); OpenGLFuncs.glMatrixMode(GL_MODELVIEW); OpenGLFuncs.glPushMatrix(); OpenGLFuncs.glLoadIdentity(); } } DECLSPEC12 void SDLCALL SDL_GL_UpdateRects(int numrects, SDL12_Rect *rects12) { if (OpenGLBlitTexture) { const int srcpitch = VideoSurface12->pitch; const int pixsize = VideoSurface12->format->BytesPerPixel; const GLenum glfmt = (pixsize == 4) ? GL_RGBA : GL_RGB; const GLenum gltype = (pixsize == 4) ? GL_UNSIGNED_BYTE : GL_UNSIGNED_SHORT_5_6_5; SDL_Rect surfacerect20; int i; surfacerect20.x = surfacerect20.y = 0; surfacerect20.w = VideoSurface12->w; surfacerect20.h = VideoSurface12->h; for (i = 0; i < numrects; i++) { SDL_Rect rect20; SDL_Rect intersected20; Uint8 *src; SDL20_IntersectRect(Rect12to20(&rects12[i], &rect20), &surfacerect20, &intersected20); src = (((Uint8 *) VideoSurface12->pixels) + (intersected20.y * srcpitch)) + (intersected20.x * pixsize); OpenGLFuncs.glTexSubImage2D(GL_TEXTURE_2D, 0, intersected20.x, intersected20.y, intersected20.w, intersected20.h, glfmt, gltype, src); OpenGLFuncs.glBegin(GL_TRIANGLE_STRIP); { const GLfloat tex_x1 = ((GLfloat) intersected20.x) / ((GLfloat) VideoSurface12->w); const GLfloat tex_y1 = ((GLfloat) intersected20.y) / ((GLfloat) VideoSurface12->h); const GLfloat tex_x2 = tex_x1 + ((GLfloat) intersected20.w) / ((GLfloat) VideoSurface12->w); const GLfloat tex_y2 = tex_y1 + ((GLfloat) intersected20.h) / ((GLfloat) VideoSurface12->h); const GLint vert_x1 = (GLint) intersected20.x; const GLint vert_y1 = (GLint) intersected20.y; const GLint vert_x2 = vert_x1 + (GLint) intersected20.w; const GLint vert_y2 = vert_y1 + (GLint) intersected20.h; OpenGLFuncs.glTexCoord2f(tex_x1, tex_y1); OpenGLFuncs.glVertex2i(vert_x1, vert_y1); OpenGLFuncs.glTexCoord2f(tex_x2, tex_y1); OpenGLFuncs.glVertex2i(vert_x2, vert_y1); OpenGLFuncs.glTexCoord2f(tex_x1, tex_y2); OpenGLFuncs.glVertex2i(vert_x1, vert_y2); OpenGLFuncs.glTexCoord2f(tex_x2, tex_y2); OpenGLFuncs.glVertex2i(vert_x2, vert_y2); } OpenGLFuncs.glEnd(); } } } DECLSPEC12 void SDLCALL SDL_GL_Unlock(void) { if (OpenGLBlitTexture) { if (OpenGLBlitLockCount > 0) { if (--OpenGLBlitLockCount == 0) { OpenGLFuncs.glPopMatrix(); OpenGLFuncs.glMatrixMode(GL_PROJECTION); OpenGLFuncs.glPopMatrix(); OpenGLFuncs.glPopClientAttrib(); OpenGLFuncs.glPopAttrib(); } } } } DECLSPEC12 void SDLCALL SDL_UpdateRects(SDL12_Surface *surface12, int numrects, SDL12_Rect *rects12) { const SDL_bool ThisIsSetVideoModeThread = (SDL20_ThreadID() == SetVideoModeThread) ? SDL_TRUE : SDL_FALSE; /* strangely, SDL 1.2 doesn't check if surface12 is NULL before touching it */ /* (UpdateRect, singular, does...) */ if ((surface12 == VideoSurface12) && ((surface12->flags & SDL12_OPENGLBLIT) == SDL12_OPENGLBLIT)) { SDL_GL_Lock(); SDL_GL_UpdateRects(numrects, rects12); SDL_GL_Unlock(); return; } if (surface12->flags & SDL12_OPENGL) { SDL20_SetError("Use SDL_GL_SwapBuffers() on OpenGL surfaces"); return; } /* everything else is marked SDL12_DOUBLEBUF and SHOULD BE a no-op here, * but in practice most apps never got a double-buffered surface and * don't handle it correctly, so we have to work around it. */ if (surface12 == VideoSurface12) { const SDL_bool upload_later = (!ThisIsSetVideoModeThread && !AllowThreadedDraws) ? SDL_TRUE : SDL_FALSE; SDL_Palette *logicalPal = surface12->surface20->format->palette; const int pixsize = surface12->format->BytesPerPixel; const int srcpitch = surface12->pitch; SDL_bool whole_screen = SDL_FALSE; SDL_Renderer *renderer = NULL; void *pixels = NULL; SDL_Rect rect20; int pitch = 0; int i, j; if (!upload_later) { renderer = LockVideoRenderer(); /* must own the renderer before locking the texture! */ } for (i = 0; i < numrects; i++) { UpdateRect12to20(surface12, &rects12[i], &rect20, &whole_screen); if (!renderer) { continue; } if (!rect20.w || !rect20.h) { continue; } if (SDL20_LockTexture(VideoTexture20, &rect20, &pixels, &pitch) < 0) { continue; /* oh well */ } if (VideoConvertSurface20) { SDL_Rect dstrect20; /* pretend that the subregion is just the top left of the convert surface. */ dstrect20.x = dstrect20.y = 0; dstrect20.w = rect20.w; dstrect20.h = rect20.h; surface12->surface20->format->palette = VideoPhysicalPalette20; VideoConvertSurface20->pixels = pixels; VideoConvertSurface20->pitch = pitch; VideoConvertSurface20->w = rect20.w; VideoConvertSurface20->h = rect20.h; SDL20_UpperBlit(VideoSurface12->surface20, &rect20, VideoConvertSurface20, &dstrect20); } else { const int cpy = rect20.w * pixsize; char *dst = (char *) pixels; const Uint8 *src = (((Uint8 *) surface12->pixels) + (rect20.y * srcpitch)) + (rect20.x * pixsize); for (j = 0; j < rect20.h; j++) { SDL20_memcpy(dst, src, cpy); src += srcpitch; dst += pitch; } } SDL20_UnlockTexture(VideoTexture20); } if (VideoConvertSurface20) { /* reset some state we messed with */ surface12->surface20->format->palette = logicalPal; VideoConvertSurface20->pixels = NULL; VideoConvertSurface20->pitch = 0; VideoConvertSurface20->w = VideoSurface12->w; VideoConvertSurface20->h = VideoSurface12->h; } if (upload_later) { VideoSurfaceUpdatedInBackgroundThread = SDL_TRUE; VideoSurfacePresentTicks = whole_screen ? 1 : VideoSurfaceLastPresentTicks + GetDesiredMillisecondsPerFrame(); /* flip it later (or as soon as the main thread can). */ } else if (whole_screen) { PresentScreen(); /* flip it now. */ } else { if (!VideoSurfacePresentTicks) { VideoSurfacePresentTicks = VideoSurfaceLastPresentTicks + GetDesiredMillisecondsPerFrame(); /* flip it later. */ } else if (SDL_TICKS_PASSED(SDL20_GetTicks(), VideoSurfacePresentTicks)) { PresentScreen(); } } if (renderer) { UnlockVideoRenderer(); } } } DECLSPEC12 void SDLCALL SDL_UpdateRect(SDL12_Surface *screen12, Sint32 x, Sint32 y, Uint32 w, Uint32 h) { if (screen12) { SDL12_Rect rect12; rect12.x = (Sint16) x; rect12.y = (Sint16) y; rect12.w = (Uint16) (w ? w : (unsigned)screen12->w); rect12.h = (Uint16) (h ? h : (unsigned)screen12->h); SDL_UpdateRects(screen12, 1, &rect12); } } DECLSPEC12 int SDLCALL SDL_Flip(SDL12_Surface *surface12) { if (surface12 == VideoSurface12) { SDL_UpdateRect(surface12, 0, 0, 0, 0); /* update the whole screen and present now. */ } return 0; } static void HandleKeyRepeat(void) { /* SDL 1.2 is a little weird about key repeat; it manages it itself (so we can't use SDL2's key repeat), it only runs during PumpEvents (so no AddTimer or separate thread to manage it), and it cares about the last key pressed (so if a key is repeating and you press a new one down, it stops repeating the first key). */ if (KeyRepeatNextTicks) { const Uint32 now = SDL20_GetTicks(); SDL_assert(KeyRepeatEvent.type == SDL12_KEYDOWN); if (SDL_TICKS_PASSED(now, KeyRepeatNextTicks)) { /* these repeat from the current time in SDL 1.2, not consistently! */ KeyRepeatNextTicks = now + KeyRepeatInterval; PushEventIfNotFiltered(&KeyRepeatEvent); } } } DECLSPEC12 void SDLCALL SDL_PumpEvents(void) { const SDL_bool ThisIsSetVideoModeThread = (SDL20_ThreadID() == SetVideoModeThread) ? SDL_TRUE : SDL_FALSE; SDL_Event e; static SDL_bool InPumpEvents = SDL_FALSE; if (!ThisIsSetVideoModeThread && !AllowThreadedPumps) { return; } if (InPumpEvents) return; InPumpEvents = SDL_TRUE; /* If the app is doing dirty rectangles, we set a flag and present the * screen surface when they pump for new events if we're close to 60Hz, * which we consider a sign that they are done rendering for the current * frame and it would make sense to send it to the screen. */ if (VideoSurfacePresentTicks && SDL_TICKS_PASSED(SDL20_GetTicks(), VideoSurfacePresentTicks)) { if (VideoSurfaceUpdatedInBackgroundThread) { SDL_Flip(VideoSurface12); /* this will update the texture and present. */ } else { PresentScreen(); } } if (EventQueueMutex) { SDL20_LockMutex(EventQueueMutex); } while (SDL20_PollEvent(&e)) { /* spin to drain the SDL2 event queue. */ } /* If there's a pending KEYDOWN event, and we haven't got a TEXTINPUT * event which matches it, then let it through now. */ if (PendingKeydownEvent.type == SDL12_KEYDOWN) { FlushPendingKeydownEvent(0); } HandleKeyRepeat(); /* deal with SDL 1.2-style key repeat... */ if (EventQueueMutex) { SDL20_UnlockMutex(EventQueueMutex); } InPumpEvents = SDL_FALSE; } DECLSPEC12 void SDLCALL SDL_WM_SetCaption(const char *title, const char *icon) { if (WindowTitle) { SDL20_free(WindowTitle); } if (WindowIconTitle) { SDL20_free(WindowIconTitle); } WindowTitle = title ? SDL20_strdup(title) : NULL; WindowIconTitle = icon ? SDL20_strdup(icon) : NULL; if (VideoWindow20) { SDL20_SetWindowTitle(VideoWindow20, WindowTitle); } } DECLSPEC12 void SDLCALL SDL_WM_GetCaption(const char **title, const char **icon) { if (title) { *title = WindowTitle; } if (icon) { *icon = WindowIconTitle; } } DECLSPEC12 void SDLCALL SDL_WM_SetIcon(SDL12_Surface *icon12, Uint8 *mask) { SDL_BlendMode oldmode; Uint32 rmask, gmask, bmask, amask; SDL_Surface *icon20; int bpp; int ret; /* Make sure we actually have an icon to set */ if (!icon12) { return; } /* take the mask and zero out those alpha values. */ oldmode = SDL_BLENDMODE_NONE; if (SDL20_GetSurfaceBlendMode(icon12->surface20, &oldmode) < 0) { return; /* oh well. */ } if (!SDL20_PixelFormatEnumToMasks(SDL_PIXELFORMAT_ARGB8888, &bpp, &rmask, &gmask, &bmask, &amask)) { return; /* oh well. */ } icon20 = SDL20_CreateRGBSurface(0, icon12->w, icon12->h, bpp, rmask, gmask, bmask, amask); if (!icon20) { return; /* oh well. */ } SDL20_SetSurfaceBlendMode(icon12->surface20, SDL_BLENDMODE_NONE); ret = SDL20_UpperBlit(icon12->surface20, NULL, icon20, NULL); SDL20_SetSurfaceBlendMode(icon12->surface20, oldmode); if (ret == 0) { if (mask) { const int w = icon12->w; const int h = icon12->h; const int mpitch = (w + 7) / 8; Uint32 *ptr = (Uint32 *) icon20->pixels; int x, y; SDL_assert(icon20->format->BytesPerPixel == 4); SDL_assert(icon20->pitch == icon20->w * 4); for (y = 0; y < h; y++) { for (x = 0; x < w; x++, ptr++) { if (!(mask[y*mpitch + x/8] & (128 >> (x % 8)))) { *ptr &= ~amask; } else { *ptr |= amask; } } } } if (VideoWindow20) { SDL20_SetWindowIcon(VideoWindow20, icon20); } SDL20_FreeSurface(VideoIcon20); VideoIcon20 = icon20; } if (VideoWindow20) { SDL20_SetWindowIcon(VideoWindow20, VideoIcon20); } } DECLSPEC12 int SDLCALL SDL_WM_IconifyWindow(void) { if (VideoWindow20) { SDL20_MinimizeWindow(VideoWindow20); } return 0; } DECLSPEC12 int SDLCALL SDL_WM_ToggleFullScreen(SDL12_Surface *surface) { int retval = 0; if (surface == VideoSurface12) { Uint32 flags20; SDL_assert(VideoWindow20); flags20 = SDL20_GetWindowFlags(VideoWindow20); if (flags20 & SDL_WINDOW_FULLSCREEN) { SDL_assert(VideoSurface12->flags & SDL12_FULLSCREEN); retval = (SDL20_SetWindowFullscreen(VideoWindow20, 0) == 0); if (retval) { VideoSurface12->flags &= ~SDL12_FULLSCREEN; } } else { Uint32 newflags20; SDL_assert((VideoSurface12->flags & SDL12_FULLSCREEN) == 0); newflags20 = (((VideoSurface12->flags & SDL12_OPENGL) == 0) || (OpenGLLogicalScalingFBO != 0)) ? SDL_WINDOW_FULLSCREEN_DESKTOP : SDL_WINDOW_FULLSCREEN; retval = (SDL20_SetWindowFullscreen(VideoWindow20, newflags20) == 0); if (retval) { VideoSurface12->flags |= SDL12_FULLSCREEN; } } if (retval) { SDL_Renderer *renderer = LockVideoRenderer(); if (renderer) { SDL20_RenderSetLogicalSize(renderer, VideoSurface12->w, VideoSurface12->h); UnlockVideoRenderer(); } } } return retval; } static void UpdateRelativeMouseMode(void) { /* in SDL 1.2, hiding+grabbing the cursor was like SDL2's relative mouse mode. */ if (VideoWindow20) { const SDL_bool enable = (VideoWindowGrabbed && VideoCursorHidden) ? SDL_TRUE : SDL_FALSE; MouseInputIsRelative = enable; SDL20_SetRelativeMouseMode(MouseInputIsRelative); } } DECLSPEC12 int SDLCALL SDL_ShowCursor(int toggle) { const int retval = VideoCursorHidden ? 0 : 1; if (toggle >= 0) { const SDL_bool wanthide = (toggle == 0) ? SDL_TRUE : SDL_FALSE; SDL20_ShowCursor(wanthide ? 0 : 1); VideoCursorHidden = wanthide; UpdateRelativeMouseMode(); } return retval; } static void UpdateInputGrab(void) { /* SDL 1.2 always grabbed input if the video mode was fullscreen. */ if (VideoWindow20) { const SDL_bool isfullscreen = (VideoSurface12 && VideoSurface12->surface20 && (VideoSurface12->flags & SDL12_FULLSCREEN)) ? SDL_TRUE : SDL_FALSE; const SDL_bool wantgrab = (VideoWindowGrabWanted || isfullscreen) ? SDL_TRUE : SDL_FALSE; SDL20_SetWindowGrab(VideoWindow20, wantgrab); VideoWindowGrabbed = wantgrab; UpdateRelativeMouseMode(); } } DECLSPEC12 SDL12_GrabMode SDLCALL SDL_WM_GrabInput(SDL12_GrabMode mode) { if (mode != SDL12_GRAB_QUERY) { VideoWindowGrabWanted = (mode == SDL12_GRAB_ON) ? SDL_TRUE : SDL_FALSE; UpdateInputGrab(); } return VideoWindowGrabWanted ? SDL12_GRAB_ON : SDL12_GRAB_OFF; } DECLSPEC12 void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y) { if (MouseInputIsRelative) { /* we have to track this ourselves, in case app calls SDL_GetMouseState(). */ MousePosition.x = (int) x; MousePosition.y = (int) y; } else if (x == MousePosition.x && y == MousePosition.y) { /* There's no movement needed, just generate an internal event */ SDL12_Event event; event.type = SDL12_MOUSEMOTION; event.motion.which = 0; event.motion.state = SDL_GetMouseState(NULL, NULL); event.motion.x = x; event.motion.y = y; event.motion.xrel = 0; event.motion.yrel = 0; PushEventIfNotFiltered(&event); } else { if (VideoWindow20) { SDL_Rect viewport; float scale_x, scale_y; if (OpenGLLogicalScalingFBO) { int physical_w, physical_h; /* we want to scale into the window size, which is dpi-scaled */ SDL20_GetWindowSize(VideoWindow20, &physical_w, &physical_h); viewport = GetOpenGLLogicalScalingViewport(physical_w, physical_h); scale_x = (float)viewport.w / OpenGLLogicalScalingWidth; scale_y = (float)viewport.h / OpenGLLogicalScalingHeight; } else { SDL20_RenderGetViewport(VideoRenderer20, &viewport); SDL20_RenderGetScale(VideoRenderer20, &scale_x, &scale_y); viewport.x = (int)SDL20_lroundf(viewport.x * scale_x); viewport.y = (int)SDL20_lroundf(viewport.y * scale_y); viewport.w = (int)SDL20_lroundf(viewport.w * scale_x); viewport.h = (int)SDL20_lroundf(viewport.h * scale_y); } x = (int)SDL20_lroundf(viewport.x + (x * scale_x)); y = (int)SDL20_lroundf(viewport.y + (y * scale_y)); SDL20_WarpMouseInWindow(VideoWindow20, x, y); } } } DECLSPEC12 Uint8 SDLCALL SDL_GetAppState(void) { Uint8 state12 = 0; if (VideoWindow20) { const Uint32 flags20 = SDL20_GetWindowFlags(VideoWindow20); if ((flags20 & SDL_WINDOW_SHOWN) && !(flags20 & SDL_WINDOW_MINIMIZED)) { state12 |= SDL12_APPACTIVE; } if (flags20 & SDL_WINDOW_INPUT_FOCUS) { state12 |= SDL12_APPINPUTFOCUS; } if (flags20 & SDL_WINDOW_MOUSE_FOCUS) { state12 |= SDL12_APPMOUSEFOCUS; } } return state12; } DECLSPEC12 int SDLCALL SDL_SetPalette(SDL12_Surface *surface12, int flags, const SDL_Color *colors, int firstcolor, int ncolors) { SDL12_Palette *palette12; SDL_Palette *palette20; SDL_Color *opaquecolors; int i, retval; if (!surface12) { return 0; /* not an error, a no-op. */ } if ((flags & (SDL12_LOGPAL | SDL12_PHYSPAL)) == 0) { return 0; /* nothing to do. */ } palette12 = surface12->format->palette; if (!palette12) { return 0; /* not an error, a no-op. */ } palette20 = surface12->surface20->format->palette; SDL_assert(palette20 != NULL); /* we need to force the "unused" field to 255, since it's "alpha" in SDL2. */ opaquecolors = (SDL_Color *) SDL20_malloc(sizeof (SDL_Color) * ncolors); if (!opaquecolors) { SDL20_OutOfMemory(); return 0; } /* don't SDL_memcpy in case the 'a' field is uninitialized and upsets * memory tools like Valgrind. */ for (i = 0; i < ncolors; i++) { opaquecolors[i].r = colors[i].r; opaquecolors[i].g = colors[i].g; opaquecolors[i].b = colors[i].b; opaquecolors[i].a = 255; } retval = 1; /* "The return value is 1 if all colours could be set as requested, and 0 otherwise." */ if (flags & SDL12_LOGPAL) { if (SDL20_SetPaletteColors(palette20, opaquecolors, firstcolor, ncolors) < 0) { retval = 0; } } if ((flags & SDL12_PHYSPAL) && (surface12 == VideoSurface12) && VideoPhysicalPalette20) { if (SDL20_SetPaletteColors(VideoPhysicalPalette20, opaquecolors, firstcolor, ncolors) < 0) { retval = 0; } } SDL20_free(opaquecolors); /* in case this pointer changed... */ palette12->colors = palette20->colors; if ((surface12 == VideoSurface12) && (flags & SDL12_PHYSPAL)) { SDL_UpdateRect(surface12, 0, 0, 0, 0); /* force screen to reblit with new palette. */ } return retval; } DECLSPEC12 int SDLCALL SDL_SetColors(SDL12_Surface *surface12, const SDL_Color * colors, int firstcolor, int ncolors) { return SDL_SetPalette(surface12, SDL12_LOGPAL | SDL12_PHYSPAL, colors, firstcolor, ncolors); } #if defined(SDL_VIDEO_DRIVER_X11) /* In 1.2, these would lock the event thread (if you _used_ the event thread), and call XSync(SDL_Display, False) before unlocking */ static void x11_lock_display(void) {} static void x11_unlock_display(void) {} #endif DECLSPEC12 int SDLCALL SDL_GetWMInfo(SDL12_SysWMinfo *info12) { SDL_SysWMinfo info20; SDL_bool temp_window = SDL_FALSE; SDL_Window *win20 = VideoWindow20; int rc; if (info12->version.major > 1) { SDL20_SetError("Requested version is unsupported"); return 0; /* some programs only test against 0, not -1 */ } if (!SupportSysWM) { SDL20_SetError("No SysWM support available"); return 0; /* some programs only test against 0, not -1 */ } if (win20 == NULL) { /* It was legal to call SDL_GetWMInfo without SDL_SetVideoMode() on X11 and Windows (and others...?) in 1.2. */ win20 = SDL20_CreateWindow("SDL_GetWMInfo support window", SDL_WINDOWPOS_UNDEFINED, SDL_WINDOWPOS_UNDEFINED, 128, 128, SDL_WINDOW_HIDDEN); if (!win20) { return 0; } temp_window = SDL_TRUE; } SDL20_zero(info20); /* SDL2, before the version scheme change, would fail if the requested version wasn't 2.0.x, so if the SDL2 is from before this was fixed, we need to lie about the version, and assume it will work out. */ if (LinkedSDL2VersionInt >= SDL_VERSIONNUM(2,24,0)) { SDL_VERSION(&info20.version); } else { info20.version.major = 2; info20.version.minor = 0; info20.version.patch = 22; } rc = SDL20_GetWindowWMInfo(win20, &info20); if (temp_window) { SDL20_DestroyWindow(win20); } if (!rc) { return 0; /* some programs only test against 0, not -1 */ } #if defined(_WIN32) if (info20.subsystem == SDL_SYSWM_WINDOWS) { info12->window = temp_window ? 0 : info20.info.win.window; if (SDL_VERSIONNUM(info12->version.major, info12->version.minor, info12->version.patch) >= SDL_VERSIONNUM(1, 2, 5)) { info12->hglrc = (HGLRC) VideoGLContext20; } } else { SDL20_SetError("No SysWM information available"); return 0; /* some programs only test against 0, not -1 */ } #elif defined(SDL_VIDEO_DRIVER_X11) if (info20.subsystem == SDL_SYSWM_X11) { info12->subsystem = SDL12_SYSWM_X11; info12->info.x11.display = info20.info.x11.display; info12->info.x11.window = temp_window ? 0 : info20.info.x11.window; if (SDL_VERSIONNUM(info12->version.major, info12->version.minor, info12->version.patch) >= SDL_VERSIONNUM(1, 0, 2)) { /* While these don't exist in SDL2, some programs expect to get a valid window anyway. */ info12->info.x11.fswindow = info12->info.x11.window; info12->info.x11.wmwindow = info12->info.x11.window; } if (SDL_VERSIONNUM(info12->version.major, info12->version.minor, info12->version.patch) >= SDL_VERSIONNUM(1, 2, 12)) { info12->info.x11.gfxdisplay = info20.info.x11.display; /* shrug */ } info12->info.x11.lock_func = x11_lock_display; /* just no-ops for now */ info12->info.x11.unlock_func = x11_unlock_display; } else { SDL20_SetError("No SysWM information available"); return 0; /* some programs only test against 0, not -1 */ } #else info12->data = 0; /* shrug */ #endif return 1; } DECLSPEC12 SDL_Window * SDLCALL SDL12COMPAT_GetWindow(void) { return VideoWindow20; } DECLSPEC12 SDL12_Overlay * SDLCALL SDL_CreateYUVOverlay(int w, int h, Uint32 format12, SDL12_Surface *display12) { /* SDL 1.2 has you pass the screen surface in here, but it doesn't check that it's _actually_ the screen surface, which implies you should be able to blit YUV overlays to other surfaces too...but then SDL_DisplayYUVOverlay always uses the screen surface unconditionally. As such, and because overlays were sort of hostile to software rendering anyhow, we always make an SDL_Texture in here and draw over the screen pixels, in hopes that the GPU gives us a boost here. */ const char *old_scale_quality = SDL20_GetHint(SDL_HINT_RENDER_SCALE_QUALITY); SDL12_Overlay *retval = NULL; SDL12_YUVData *hwdata = NULL; SDL_Renderer *renderer = NULL; Uint32 format20 = 0; if (display12 != VideoSurface12) { /* SDL 1.2 doesn't check this, but it seems irresponsible not to. */ SDL20_SetError("YUV overlays are only supported on the screen surface"); return NULL; } if (display12->flags & SDL12_OPENGL) { SDL20_SetError("YUV overlays are not supported in OpenGL mode"); return NULL; } switch (format12) { #define SUPPORTED_YUV_FORMAT(x) case SDL12_##x##_OVERLAY: format20 = SDL_PIXELFORMAT_##x; break SUPPORTED_YUV_FORMAT(YV12); SUPPORTED_YUV_FORMAT(IYUV); SUPPORTED_YUV_FORMAT(YUY2); SUPPORTED_YUV_FORMAT(UYVY); SUPPORTED_YUV_FORMAT(YVYU); #undef SUPPORTED_YUV_FORMAT default: SDL20_SetError("Unsupported YUV format"); return NULL; } retval = (SDL12_Overlay *) SDL20_calloc(1, sizeof (SDL12_Overlay) + sizeof (SDL12_YUVData)); if (!retval) { SDL20_OutOfMemory(); return NULL; } hwdata = (SDL12_YUVData *) (retval + 1); hwdata->pixelbuf = (Uint8 *) SDL20_calloc(1, (w * 2) * h); if (!hwdata->pixelbuf) { SDL20_free(retval); SDL20_OutOfMemory(); return NULL; } hwdata->pixels[0] = hwdata->pixelbuf; if ((format12 == SDL12_YV12_OVERLAY) || (format12 == SDL12_IYUV_OVERLAY)) { retval->planes = 3; hwdata->pitches[0] = w; hwdata->pitches[1] = hwdata->pitches[2] = w / 2; hwdata->pixels[1] = hwdata->pixels[0] + (w * h); hwdata->pixels[2] = hwdata->pixels[1] + ((w / 2) * h); } else { retval->planes = 1; hwdata->pitches[0] = w * 2; } renderer = LockVideoRenderer(); SDL20_SetHint(SDL_HINT_RENDER_SCALE_QUALITY, "0"); hwdata->texture20 = SDL20_CreateTexture(renderer, format20, SDL_TEXTUREACCESS_STREAMING, w, h); SDL20_SetHint(SDL_HINT_RENDER_SCALE_QUALITY, old_scale_quality); UnlockVideoRenderer(); if (!hwdata->texture20) { SDL20_free(hwdata->pixelbuf); SDL20_free(retval); return NULL; } retval->format = format12; retval->w = w; retval->h = h; retval->hwfuncs = (void *) 0x1; /* in case it's important for this to be non-NULL. */ retval->hwdata = hwdata; retval->hw_overlay = 1; retval->pitches = hwdata->pitches; /* Some programs (e.g. mplayer) access pixels without locking. */ retval->pixels = hwdata->pixels; hwdata->dirty = SDL_TRUE; return retval; } DECLSPEC12 int SDLCALL SDL_LockYUVOverlay(SDL12_Overlay *overlay12) { SDL12_YUVData *hwdata; if (!overlay12) { return SDL20_InvalidParamError("overlay"); } /* SMPEG locks the YUV overlay, calls SDL_DisplayYUVOverlay() on it, copies data to it then unlocks it, in that order, which _seems_ like an app bug, but it works in 1.2. Most of SDL 1.2's yuv lock/unlock implementations are just no-ops anyhow, so we upload during display, if the overlay has been locked since last time (and even if it is still locked), to accomodate this usage pattern. */ hwdata = (SDL12_YUVData *) overlay12->hwdata; hwdata->dirty = SDL_TRUE; /* assume the contents will change and we must upload */ overlay12->pixels = hwdata->pixels; return 0; /* success */ } DECLSPEC12 int SDLCALL SDL_DisplayYUVOverlay(SDL12_Overlay *overlay12, SDL12_Rect *dstrect12) { QueuedOverlayItem *overlay; SDL12_YUVData *hwdata; SDL_Renderer *renderer; const SDL_bool ThisIsSetVideoModeThread = (SDL20_ThreadID() == SetVideoModeThread) ? SDL_TRUE : SDL_FALSE; if (!overlay12) { return SDL20_InvalidParamError("overlay"); } if (!dstrect12) { return SDL20_InvalidParamError("dstrect"); } if ((renderer = LockVideoRenderer()) == NULL) { return SDL20_SetError("No software screen surface available"); } for (overlay = QueuedDisplayOverlays.next; overlay != NULL; overlay = overlay->next) { if (overlay->overlay12 == overlay12) { /* trying to draw the same overlay twice in one frame? Dump the current surface and overlays to the screen now. */ /* Force an update of the screen. */ if (ThisIsSetVideoModeThread) { if (VideoSurfaceUpdatedInBackgroundThread) { SDL_Flip(VideoSurface12); /* this will update the texture and present. */ } else if (VideoSurfacePresentTicks) { PresentScreen(); } } break; } } if ((overlay = (QueuedOverlayItem *) SDL_malloc(sizeof (QueuedOverlayItem))) == NULL) { UnlockVideoRenderer(); return SDL20_OutOfMemory(); } hwdata = (SDL12_YUVData *) overlay12->hwdata; /* Upload contents if we've been locked, even if we're _still_ locked, to work around an SMPEG quirk. */ if (hwdata->dirty) { SDL_Rect rect20; rect20.x = rect20.y = 0; rect20.w = overlay12->w; rect20.h = overlay12->h; if (overlay12->format == SDL12_IYUV_OVERLAY) { SDL20_UpdateYUVTexture(hwdata->texture20, &rect20, hwdata->pixels[0], hwdata->pitches[0], hwdata->pixels[1], hwdata->pitches[1], hwdata->pixels[2], hwdata->pitches[2]); } else if (overlay12->format == SDL12_YV12_OVERLAY) { SDL20_UpdateYUVTexture(hwdata->texture20, &rect20, hwdata->pixels[0], hwdata->pitches[0], hwdata->pixels[2], hwdata->pitches[2], hwdata->pixels[1], hwdata->pitches[1]); } else { SDL20_UpdateTexture(hwdata->texture20, &rect20, hwdata->pixels[0], hwdata->pitches[0]); } if (overlay12->pixels == NULL) { /* must leave it marked as dirty if still locked! */ hwdata->dirty = SDL_FALSE; } } /* The app may or may not SDL_Flip() after this...queue this to render on the next present, and start a timer going to force a present, in case they don't. */ overlay->overlay12 = overlay12; SDL20_memcpy(&overlay->dstrect12, dstrect12, sizeof (SDL12_Rect)); overlay->next = NULL; SDL_assert(QueuedDisplayOverlaysTail != NULL); SDL_assert(QueuedDisplayOverlaysTail->next == NULL); QueuedDisplayOverlaysTail->next = overlay; QueuedDisplayOverlaysTail = overlay; if (!VideoSurfacePresentTicks) { VideoSurfacePresentTicks = VideoSurfaceLastPresentTicks + GetDesiredMillisecondsPerFrame(); /* flip it later. */ } UnlockVideoRenderer(); return 0; } DECLSPEC12 void SDLCALL SDL_UnlockYUVOverlay(SDL12_Overlay *overlay12) { /* MLT SDL1 consumer uses locks, but accesses pixels pointer outside the lock, so don't null the pixels pointer. */ /*if (overlay12) { overlay12->pixels = NULL; }*/ (void)overlay12; } DECLSPEC12 void SDLCALL SDL_FreeYUVOverlay(SDL12_Overlay *overlay12) { if (overlay12) { SDL_Renderer *renderer = LockVideoRenderer(); SDL12_YUVData *hwdata = (SDL12_YUVData *) overlay12->hwdata; QueuedOverlayItem *overlay = QueuedDisplayOverlays.next; while (overlay != NULL) { if (overlay->overlay12 == overlay12) { overlay->overlay12 = NULL; /* don't try to draw this later. */ } overlay = overlay->next; } if (renderer) { SDL20_DestroyTexture(hwdata->texture20); UnlockVideoRenderer(); } SDL20_free(hwdata->pixelbuf); SDL20_free(overlay12); } } DECLSPEC12 void * SDLCALL SDL_GL_GetProcAddress(const char *sym) { /* see comments on glBindFramebuffer_shim_for_scaling for explanation */ if ((SDL20_strcmp(sym, "glBindFramebuffer") == 0) || (SDL20_strcmp(sym, "glBindFramebufferEXT") == 0)) { return (void *) glBindFramebuffer_shim_for_scaling; } /* these functions all need to have an MSAA resolve inserted before use */ if ((SDL20_strcmp(sym, "glReadPixels") == 0)) { return (void *) glReadPixels_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyPixels") == 0)) { return (void *) glCopyPixels_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyTexImage1D") == 0)) { return (void *) glCopyTexImage1D_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyTexSubImage1D") == 0)) { return (void *) glCopyTexSubImage1D_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyTexImage2D") == 0)) { return (void *) glCopyTexImage2D_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyTexSubImage2D") == 0)) { return (void *) glCopyTexSubImage2D_shim_for_scaling; } if ((SDL20_strcmp(sym, "glCopyTexSubImage3D") == 0)) { return (void *) glCopyTexSubImage3D_shim_for_scaling; } /* this function is specific to the shim library */ if ((SDL20_strcmp(sym, "SDL12COMPAT_GetWindow") == 0)) { return (void *) SDL12COMPAT_GetWindow; } return SDL20_GL_GetProcAddress(sym); } DECLSPEC12 int SDLCALL SDL_GL_LoadLibrary(const char *libname) { /* SDL 1.2 would unload the previous library if one was loaded. SDL2 reports an error if one is already loaded, and sometimes loads it internally for some video targets, so unloading it probably isn't safe. There really isn't a good reason to be using anything other than the system OpenGL in 2019, so we ignore the error in this case to match 1.2 behavior, even if you were going to load a different library this time. Oh well. */ const int rc = SDL20_GL_LoadLibrary(libname); if (rc < 0) { const char *err = SDL20_GetError(); char *dup; if (SDL20_strcmp(err, "OpenGL library already loaded") == 0) { return 0; } /* reset the actual error. */ dup = SDL20_strdup(err); if (!dup) { SDL20_OutOfMemory(); } else { SDL20_SetError(dup); SDL20_free(dup); } } return rc; } DECLSPEC12 int SDLCALL SDL_GL_SetAttribute(SDL12_GLattr attr, int value) { if (attr >= SDL12_GL_MAX_ATTRIBUTE) { return SDL20_SetError("Unknown GL attribute"); } /* swap control was moved out of this API, everything else lines up. */ if (attr == SDL12_GL_SWAP_CONTROL) { SwapInterval = value; return 0; } if (attr == SDL12_GL_MULTISAMPLESAMPLES) { OpenGLLogicalScalingSamples = value; return 0; } if (attr == SDL12_GL_MULTISAMPLEBUFFERS) { return 0; } return SDL20_GL_SetAttribute((SDL_GLattr) attr, value); } DECLSPEC12 int SDLCALL SDL_GL_GetAttribute(SDL12_GLattr attr, int* value) { int retval; if (attr >= SDL12_GL_MAX_ATTRIBUTE) { return SDL20_SetError("Unknown GL attribute"); } /* swap control was moved out of this API, everything else lines up. */ if (attr == SDL12_GL_SWAP_CONTROL) { *value = SDL20_GL_GetSwapInterval(); return 0; } if (attr == SDL12_GL_MULTISAMPLESAMPLES) { *value = OpenGLLogicalScalingSamples; return 0; } if (attr == SDL12_GL_MULTISAMPLEBUFFERS) { *value = (OpenGLLogicalScalingSamples) ? 1 : 0; return 0; } /* SDL2 has a bug where FBO 0 must be bound or SDL20_GL_GetAttribute gives incorrect information. See https://github.com/libsdl-org/sdl12-compat/issues/150 */ if (OpenGLCurrentDrawFBO == 0) { retval = SDL20_GL_GetAttribute((SDL_GLattr) attr, value); } else { SDL_assert(OpenGLFuncs.glBindFramebuffer != NULL); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, 0); retval = SDL20_GL_GetAttribute((SDL_GLattr) attr, value); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLCurrentDrawFBO); } return retval; } DECLSPEC12 void SDLCALL SDL_GL_SwapBuffers(void) { if (VideoWindow20) { if (OpenGLBuffersSwapTickInterval != 0.f) { const Uint32 tickDelta = SDL20_GetTicks() - OpenGLBuffersLastSwapTicks; if (tickDelta < OpenGLBuffersSwapTickInterval) { SDL20_Delay((int)(OpenGLBuffersSwapTickInterval + 0.5f) - tickDelta); } } /* Some applications, e.g. Awesomenauts, play with glXMakeCurrent() behind our backs and break SwapBuffers() */ if (ForceGLSwapBufferContext) { SDL20_GL_MakeCurrent(VideoWindow20, VideoGLContext20); } if (OpenGLLogicalScalingFBO != 0) { const GLboolean has_scissor = OpenGLFuncs.glIsEnabled(GL_SCISSOR_TEST); int physical_w, physical_h; GLfloat clearcolor[4]; SDL_Rect dstrect; /* use the drawable size, which is != window size for HIGHDPI systems */ SDL20_GL_GetDrawableSize(VideoWindow20, &physical_w, &physical_h); dstrect = GetOpenGLLogicalScalingViewport(physical_w, physical_h); OpenGLFuncs.glGetFloatv(GL_COLOR_CLEAR_VALUE, clearcolor); if (has_scissor) { OpenGLFuncs.glDisable(GL_SCISSOR_TEST); /* scissor test affects framebuffer_blit */ } OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLLogicalScalingFBO); /* Resolve the multisample framebuffer if required. */ if (OpenGLLogicalScalingMultisampleFBO) { OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLLogicalScalingMultisampleFBO); OpenGLFuncs.glBlitFramebuffer(0, 0, OpenGLLogicalScalingWidth, OpenGLLogicalScalingHeight, 0, 0, OpenGLLogicalScalingWidth, OpenGLLogicalScalingHeight, GL_COLOR_BUFFER_BIT, GL_NEAREST); OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLLogicalScalingMultisampleFBO); } OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, 0); OpenGLFuncs.glClearColor(0.0f, 0.0f, 0.0f, 1.0f); OpenGLFuncs.glClear(GL_COLOR_BUFFER_BIT); OpenGLFuncs.glBlitFramebuffer(0, 0, OpenGLLogicalScalingWidth, OpenGLLogicalScalingHeight, dstrect.x, dstrect.y, dstrect.x + dstrect.w, dstrect.y + dstrect.h, GL_COLOR_BUFFER_BIT, WantScaleMethodNearest ? GL_NEAREST : GL_LINEAR); OpenGLFuncs.glBindFramebuffer(GL_FRAMEBUFFER, 0); SDL20_GL_SwapWindow(VideoWindow20); OpenGLFuncs.glClearColor(clearcolor[0], clearcolor[1], clearcolor[2], clearcolor[3]); if (has_scissor) { OpenGLFuncs.glEnable(GL_SCISSOR_TEST); } OpenGLFuncs.glBindFramebuffer(GL_READ_FRAMEBUFFER, OpenGLCurrentReadFBO); OpenGLFuncs.glBindFramebuffer(GL_DRAW_FRAMEBUFFER, OpenGLCurrentDrawFBO); } else { SDL20_GL_SwapWindow(VideoWindow20); } if (OpenGLBuffersSwapTickInterval != 0.f) { OpenGLBuffersLastSwapTicks = SDL20_GetTicks(); } } } DECLSPEC12 int SDLCALL SDL_SetGamma(float red, float green, float blue) { Uint16 red_ramp[256]; Uint16 green_ramp[256]; Uint16 blue_ramp[256]; SDL20_CalculateGammaRamp(red, red_ramp); if (green == red) { SDL20_memcpy(green_ramp, red_ramp, sizeof(red_ramp)); } else { SDL20_CalculateGammaRamp(green, green_ramp); } if (blue == red) { SDL20_memcpy(blue_ramp, red_ramp, sizeof(red_ramp)); } else if (blue == green) { SDL20_memcpy(blue_ramp, green_ramp, sizeof(green_ramp)); } else { SDL20_CalculateGammaRamp(blue, blue_ramp); } return SDL20_SetWindowGammaRamp(VideoWindow20, red_ramp, green_ramp, blue_ramp); } DECLSPEC12 int SDLCALL SDL_SetGammaRamp(const Uint16 *red, const Uint16 *green, const Uint16 *blue) { return SDL20_SetWindowGammaRamp(VideoWindow20, red, green, blue); } DECLSPEC12 int SDLCALL SDL_GetGammaRamp(Uint16 *red, Uint16 *green, Uint16 *blue) { return SDL20_GetWindowGammaRamp(VideoWindow20, red, green, blue); } DECLSPEC12 int SDLCALL SDL_EnableKeyRepeat(int delay, int interval) { if ((delay < 0) || (interval < 0)) { return SDL20_SetError("Invalid key repeat values"); } KeyRepeatEvent.type = SDL12_NOEVENT; KeyRepeatNextTicks = 0; KeyRepeatDelay = (Uint32) delay; KeyRepeatInterval = (Uint32) interval; return 0; } DECLSPEC12 void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval) { if (delay) { *delay = (int) KeyRepeatDelay; } if (interval) { *interval = (int) KeyRepeatInterval; } } DECLSPEC12 int SDLCALL SDL_EnableUNICODE(int enable) { const int old = EnabledUnicode; if (enable >= 0) { EnabledUnicode = enable; if (enable) { SDL20_StartTextInput(); } else { SDL20_StopTextInput(); } } return old; } /* SDL 1.2 limited timers to a 10ms resolution. SDL 2.0 doesn't, so we might have to round. This is the equation 1.2 uses: */ static Uint32 RoundTimerTo12Resolution(const Uint32 ms) { return (((ms + 10) - 1) / 10) * 10; } static Uint32 SDLCALL SetTimerCallback12(Uint32 interval, void* param) { return RoundTimerTo12Resolution(((SDL12_TimerCallback)param)(interval)); } DECLSPEC12 int SDLCALL SDL_SetTimer(Uint32 interval, SDL12_TimerCallback callback) { static SDL_TimerID compat_timer; if (compat_timer) { SDL20_RemoveTimer(compat_timer); compat_timer = 0; } if (interval && callback) { interval = RoundTimerTo12Resolution(interval); compat_timer = SDL20_AddTimer(interval, SetTimerCallback12, (void*)callback); if (!compat_timer) { return -1; } } return 0; } DECLSPEC12 void SDLCALL SDL_Delay(Uint32 ticks) { /* In case there's a loading screen from a background thread and the main thread is waiting... */ const SDL_bool ThisIsSetVideoModeThread = (SDL20_ThreadID() == SetVideoModeThread) ? SDL_TRUE : SDL_FALSE; if (ThisIsSetVideoModeThread) { if (VideoSurfaceUpdatedInBackgroundThread) { SDL_Flip(VideoSurface12); /* this will update the texture and present. */ } else if (VideoSurfacePresentTicks) { PresentScreen(); } } SDL20_Delay(ticks); } DECLSPEC12 char * SDLCALL SDL_getenv(const char *name) { return SDL12COMPAT_getenv_unsafe(name); } DECLSPEC12 int SDLCALL SDL_putenv(const char *_var) { char *ptr = NULL; char *var = SDL20_strdup(_var); if (var == NULL) { return -1; /* we don't set errno. */ } ptr = SDL20_strchr(var, '='); if (ptr == NULL) { SDL20_free(var); return -1; } *ptr = '\0'; /* split the string into name and value. */ SDL12COMPAT_setenv_unsafe(var, ptr + 1); SDL20_free(var); return 0; } #if (defined(_WIN32) || defined(__OS2__)) && !defined(SDL_PASSED_BEGINTHREAD_ENDTHREAD) #error SDL_PASSED_BEGINTHREAD_ENDTHREAD not defined #endif #ifdef SDL_PASSED_BEGINTHREAD_ENDTHREAD #ifdef _WIN32 /* Official Windows versions of SDL-1.2 >= 1.2.10 were always built * with HAVE_LIBC, i.e.: *without* SDL_PASSED_BEGINTHREAD_ENDTHREAD * defined, in order to keep binary compatibility with SDL <= 1.2.9. * * On the other hand SDL2 >= 2.0.12, as we dictate for Windows does * always define SDL_PASSED_BEGINTHREAD_ENDTHREAD, in order to keep * SDL2 versions built with and without libc binary compatible with * each other. * * Therefore, we have to do the following trick below. */ DECLSPEC12 SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data) { return SDL20_CreateThread(fn, NULL, data, NULL, NULL); } #else DECLSPEC12 SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread) { return SDL20_CreateThread(fn, NULL, data, pfnBeginThread, pfnEndThread); } #endif #else DECLSPEC12 SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data) { return SDL20_CreateThread(fn, NULL, data); } #endif /* These two will truncate the returned value on LP64 systems, * a shortcoming of SDL-1.2. */ DECLSPEC12 Uint32 SDLCALL SDL_ThreadID(void) { return SDL20_ThreadID(); } DECLSPEC12 Uint32 SDLCALL SDL_GetThreadID(SDL_Thread *thread) { return SDL20_GetThreadID(thread); } DECLSPEC12 int SDLCALL SDL_mutexP(SDL_mutex *mutex) { return SDL20_LockMutex(mutex); } DECLSPEC12 int SDLCALL SDL_mutexV(SDL_mutex *mutex) { return SDL20_UnlockMutex(mutex); } DECLSPEC12 void SDLCALL SDL_KillThread(SDL_Thread *thread) { (void)thread; SDL20_Log("WARNING: this app used SDL_KillThread(), an unforgivable curse.\n" "This program should be fixed. No thread was actually harmed.\n"); } static Uint32 SDLCALL AddTimerCallback12(Uint32 interval, void *param) { SDL12_TimerID data = (SDL12_TimerID) param; return RoundTimerTo12Resolution(data->callback(interval, data->param)); } DECLSPEC12 SDL12_TimerID SDLCALL SDL_AddTimer(Uint32 interval, SDL12_NewTimerCallback callback, void *param) { SDL12_TimerID data = (SDL12_TimerID) SDL20_malloc(sizeof (SDL12_TimerID_Data)); if (!data) { SDL20_OutOfMemory(); return NULL; } interval = RoundTimerTo12Resolution(interval); data->callback = callback; data->param = param; data->timer_id = SDL20_AddTimer(interval, AddTimerCallback12, data); if (!data->timer_id) { SDL20_free(data); return NULL; } if (EventQueueMutex) { SDL20_LockMutex(EventQueueMutex); } data->prev = NULL; data->next = AddedTimers; if (AddedTimers) { AddedTimers->prev = data; } AddedTimers = data; if (EventQueueMutex) { SDL20_UnlockMutex(EventQueueMutex); } return data; } DECLSPEC12 SDL_bool SDLCALL SDL_RemoveTimer(SDL12_TimerID data) { SDL_bool retval = SDL_FALSE; if (data) { /* SDL 1.2 would make sure the pointer was valid and return false instead of crashing, so we check that too. */ SDL12_TimerID i; if (EventQueueMutex) { SDL20_LockMutex(EventQueueMutex); } for (i = AddedTimers; i != NULL; i = i->next) { if (i == data) { break; } } if (i != NULL) { /* this is valid. */ if (data->prev) { data->prev->next = data->next; } if (data->next) { data->next->prev = data->prev; } if (data == AddedTimers) { AddedTimers = data->next; } retval = SDL_TRUE; SDL20_RemoveTimer(data->timer_id); } if (EventQueueMutex) { SDL20_UnlockMutex(EventQueueMutex); } if (retval) { SDL20_free(data); } } return retval; } typedef struct SDL12_RWops { int (SDLCALL *seek)(struct SDL12_RWops *context, int offset, int whence); int (SDLCALL *read)(struct SDL12_RWops *context, void *ptr, int size, int maxnum); int (SDLCALL *write)(struct SDL12_RWops *context, const void *ptr, int size, int num); int (SDLCALL *close)(struct SDL12_RWops *context); Uint32 type; void *padding[8]; SDL_RWops *rwops20; } SDL12_RWops; DECLSPEC12 SDL12_RWops * SDLCALL SDL_AllocRW(void) { SDL12_RWops *rwops = (SDL12_RWops *) SDL20_malloc(sizeof (SDL12_RWops)); if (!rwops) { SDL20_OutOfMemory(); } return rwops; } DECLSPEC12 void SDLCALL SDL_FreeRW(SDL12_RWops *rwops12) { SDL20_free(rwops12); } static int SDLCALL RWops20to12_seek(struct SDL12_RWops *rwops12, int offset, int whence) { return (int)rwops12->rwops20->seek(rwops12->rwops20, offset, whence); } static int SDLCALL RWops20to12_read(struct SDL12_RWops *rwops12, void *ptr, int size, int maxnum) { return (int)rwops12->rwops20->read(rwops12->rwops20, ptr, size, maxnum); } static int SDLCALL RWops20to12_write(struct SDL12_RWops *rwops12, const void *ptr, int size, int num) { return (int)rwops12->rwops20->write(rwops12->rwops20, ptr, size, num); } static int SDLCALL RWops20to12_close(struct SDL12_RWops *rwops12) { int rc = 0; if (rwops12) { rc = rwops12->rwops20->close(rwops12->rwops20); if (rc == 0) { SDL_FreeRW(rwops12); } } return rc; } static SDL12_RWops * RWops20to12(SDL_RWops *rwops20) { SDL12_RWops *rwops12; if (!rwops20) { return NULL; } rwops12 = SDL_AllocRW(); if (!rwops12) { return NULL; } SDL20_zerop(rwops12); rwops12->type = rwops20->type; rwops12->rwops20 = rwops20; rwops12->seek = RWops20to12_seek; rwops12->read = RWops20to12_read; rwops12->write = RWops20to12_write; rwops12->close = RWops20to12_close; return rwops12; } DECLSPEC12 SDL12_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode) { if (!file || !*file || !mode || !*mode) { SDL20_SetError("SDL_RWFromFile(): No file or no mode specified"); return NULL; } return RWops20to12(SDL20_RWFromFile(file, mode)); } DECLSPEC12 SDL12_RWops * SDLCALL SDL_RWFromFP(void *io, int autoclose) { return RWops20to12(SDL20_RWFromFP(io, autoclose ? SDL_TRUE : SDL_FALSE)); } DECLSPEC12 SDL12_RWops * SDLCALL SDL_RWFromMem(void *mem, int size) { return RWops20to12(SDL20_RWFromMem(mem, size)); } DECLSPEC12 SDL12_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size) { return RWops20to12(SDL20_RWFromConstMem(mem, size)); } #define READ_AND_BYTESWAP(endian, bits) \ DECLSPEC12 Uint##bits SDLCALL \ SDL_Read##endian##bits(SDL12_RWops *rwops12) \ { \ Uint##bits val; \ rwops12->read(rwops12, &val, sizeof (val), 1); \ return SDL_Swap##endian##bits(val); \ } READ_AND_BYTESWAP(LE,16) READ_AND_BYTESWAP(BE,16) READ_AND_BYTESWAP(LE,32) READ_AND_BYTESWAP(BE,32) READ_AND_BYTESWAP(LE,64) READ_AND_BYTESWAP(BE,64) #undef READ_AND_BYTESWAP #define BYTESWAP_AND_WRITE(endian, bits) \ DECLSPEC12 int SDLCALL \ SDL_Write##endian##bits(SDL12_RWops *rwops12, Uint##bits val) \ { \ val = SDL_Swap##endian##bits(val); \ return rwops12->write(rwops12, &val, sizeof (val), 1); \ } BYTESWAP_AND_WRITE(LE,16) BYTESWAP_AND_WRITE(BE,16) BYTESWAP_AND_WRITE(LE,32) BYTESWAP_AND_WRITE(BE,32) BYTESWAP_AND_WRITE(LE,64) BYTESWAP_AND_WRITE(BE,64) #undef BYTESWAP_AND_WRITE static Sint64 SDLCALL RWops12to20_size(struct SDL_RWops *rwops20) { SDL12_RWops *rwops12 = (SDL12_RWops *) rwops20->hidden.unknown.data1; int size = (int) ((intptr_t) rwops20->hidden.unknown.data2); int pos; if (size != -1) { return size; } pos = rwops12->seek(rwops12, 0, RW_SEEK_CUR); if (pos == -1) { return SDL20_Error(SDL_EFSEEK); } size = rwops12->seek(rwops12, 0, RW_SEEK_END); rwops12->seek(rwops12, pos, RW_SEEK_SET); rwops20->hidden.unknown.data2 = (void *) ((intptr_t) size); return size; } static Sint64 SDLCALL RWops12to20_seek(struct SDL_RWops *rwops20, Sint64 offset, int whence) { SDL12_RWops *rwops12 = (SDL12_RWops *) rwops20->hidden.unknown.data1; if (offset < INT_MIN || offset > INT_MAX) { return SDL20_InvalidParamError("offset"); } return (Sint64) rwops12->seek(rwops12, (int) offset, whence); } static size_t SDLCALL RWops12to20_read(struct SDL_RWops *rwops20, void *ptr, size_t size, size_t maxnum) { SDL12_RWops *rwops12 = (SDL12_RWops *) rwops20->hidden.unknown.data1; if (size > INT_MAX || maxnum > INT_MAX) { SDL20_InvalidParamError("size' or 'num"); return 0; } return (size_t) rwops12->read(rwops12, ptr, (int) size, (int) maxnum); } static size_t SDLCALL RWops12to20_write(struct SDL_RWops *rwops20, const void *ptr, size_t size, size_t num) { SDL12_RWops *rwops12 = (SDL12_RWops *) rwops20->hidden.unknown.data1; if (size > INT_MAX || num > INT_MAX) { SDL20_InvalidParamError("size' or 'num"); return 0; } return (size_t) rwops12->write(rwops12, ptr, (int) size, (int) num); } static int SDLCALL RWops12to20_close(struct SDL_RWops *rwops20) { int rc = 0; if (rwops20) { SDL12_RWops *rwops12 = (SDL12_RWops *) rwops20->hidden.unknown.data1; rc = rwops12->close(rwops12); SDL20_FreeRW(rwops20); } return rc; } static SDL_RWops * RWops12to20(SDL12_RWops *rwops12) { SDL_RWops *rwops20; if (!rwops12) { return NULL; } rwops20 = SDL20_AllocRW(); if (!rwops20) { return NULL; } SDL20_zerop(rwops20); rwops20->type = rwops12->type; rwops20->hidden.unknown.data1 = rwops12; rwops20->hidden.unknown.data2 = (void *) ((intptr_t) -1); /* cached size of stream */ rwops20->size = RWops12to20_size; rwops20->seek = RWops12to20_seek; rwops20->read = RWops12to20_read; rwops20->write = RWops12to20_write; rwops20->close = RWops12to20_close; return rwops20; } DECLSPEC12 SDL12_Surface * SDLCALL SDL_LoadBMP_RW(SDL12_RWops *rwops12, int freerwops12) { SDL_RWops *rwops20 = RWops12to20(rwops12); SDL_Surface *surface20 = SDL20_LoadBMP_RW(rwops20, freerwops12); SDL12_Surface *surface12 = Surface20to12(surface20); if (!freerwops12) { /* free our wrapper if SDL2 didn't close it. */ SDL20_FreeRW(rwops20); } if ((!surface12) && (surface20)) { SDL20_FreeSurface(surface20); } return surface12; } DECLSPEC12 int SDLCALL SDL_SaveBMP_RW(SDL12_Surface *surface12, SDL12_RWops *rwops12, int freerwops12) { SDL_RWops *rwops20 = RWops12to20(rwops12); const int retval = SDL20_SaveBMP_RW(surface12->surface20, rwops20, freerwops12); if (!freerwops12) { /* free our wrapper if SDL2 didn't close it. */ SDL20_FreeRW(rwops20); } return retval; } DECLSPEC12 SDL_AudioSpec * SDLCALL SDL_LoadWAV_RW(SDL12_RWops *rwops12, int freerwops12, SDL_AudioSpec *spec, Uint8 **buf, Uint32 *len) { SDL_RWops *rwops20 = RWops12to20(rwops12); SDL_AudioSpec *retval = NULL; *buf = NULL; if (!rwops20) { return NULL; } /* SDL2's LoadWAV requires a seekable stream, but SDL 1.2 didn't, so if the stream appears unseekable, try to load it into a memory rwops that we _can_ seek in */ if (rwops20->seek(rwops20, 0, RW_SEEK_CUR) != -1) { /* if seekable */ retval = SDL20_LoadWAV_RW(rwops20, freerwops12, spec, buf, len); } else { size_t datasize = 0; void *buffer = SDL20_LoadFile_RW(rwops20, &datasize, freerwops12); if (buffer) { SDL_RWops *memrwops20 = SDL20_RWFromConstMem(buffer, (int) datasize); if (memrwops20) { retval = SDL20_LoadWAV_RW(memrwops20, 1, spec, buf, len); } SDL_free(buffer); } } if (retval && retval->format & 0x20) { SDL20_SetError("Unsupported 32-bit PCM data format"); SDL20_FreeWAV(*buf); *buf = NULL; retval = NULL; } if (!freerwops12) { /* free our wrapper if SDL2 didn't close it. */ SDL20_FreeRW(rwops20); } return retval; } /* CD-ROM API! We don't support physical CD drives in sdl12-compat. In modern times, it's hard to find discs at all, let alone discs with audio tracks. Drives are also getting scarce, and ones that are plugged into the sound output hardware moreso. With this in mind, sdl12-compat can be instructed to point to a filesystem directory full .mp3 files, and will pretend this is an audio CD-ROM, and will decode these files and mix them into an audio stream as if they were playing from a disc. */ #if defined(_MSC_VER) && defined(_M_IX86) #include "x86_msvc.h" #endif #define CDAUDIO_FPS 75 /* CD audio frames per second. */ /* public domain, single-header MP3 decoder for fake CD-ROM audio support! */ #define DR_MP3_IMPLEMENTATION #if defined(__GNUC__) && (__GNUC__ >= 4) && \ !(defined(_WIN32) || defined(__EMX__)) #define DRMP3_API __attribute__((visibility("hidden"))) #elif defined(__APPLE__) #define DRMP3_API __private_extern__ #else #define DRMP3_API /* just in case */ #endif #define DR_MP3_NO_STDIO 1 #define DR_MP3_NO_S16 1 #define DR_MP3_FLOAT_OUTPUT 1 #define DR_MP3_NO_FULL_READ 1 #define DRMP3_ASSERT(x) SDL_assert((x)) #define DRMP3_MALLOC(sz) SDL20_malloc((sz)) #define DRMP3_REALLOC(p, sz) SDL20_realloc((p), (sz)) #define DRMP3_FREE(p) SDL20_free((p)) #define DRMP3_COPY_MEMORY(dst, src, sz) SDL20_memcpy((dst), (src), (sz)) #define DRMP3_MOVE_MEMORY(dst, src, sz) SDL20_memmove((dst), (src), (sz)) #define DRMP3_ZERO_MEMORY(p, sz) SDL20_memset((p), 0, (sz)) #include "dr_mp3.h" static SDL_INLINE Sint64 SDLCALL SDL20_RWseek(SDL_RWops *ctx, Sint64 ofs, int whence) { return ctx->seek(ctx, ofs, whence); } static SDL_INLINE Sint64 SDLCALL SDL20_RWtell(SDL_RWops *ctx) { return ctx->seek(ctx, 0, RW_SEEK_CUR); } static SDL_INLINE size_t SDLCALL SDL20_RWread(SDL_RWops *ctx, void *ptr, size_t size, size_t n) { return ctx->read(ctx, ptr, size, n); } static SDL_INLINE int SDLCALL SDL20_RWclose(SDL_RWops *ctx) { return ctx->close(ctx); } static size_t mp3_sdlrwops_read(void *data, void *buf, size_t bytesToRead) { return SDL20_RWread((SDL_RWops *) data, buf, 1, bytesToRead); } static drmp3_bool32 mp3_sdlrwops_seek(void *data, int offset, drmp3_seek_origin origin) { int whence; switch (origin) { case DRMP3_SEEK_SET: whence = RW_SEEK_SET; break; case DRMP3_SEEK_CUR: whence = RW_SEEK_CUR; break; case DRMP3_SEEK_END: whence = RW_SEEK_END; break; default: return DRMP3_FALSE; } return (SDL20_RWseek((SDL_RWops *) data, offset, whence) == -1) ? DRMP3_FALSE : DRMP3_TRUE; } static drmp3_bool32 mp3_sdlrwops_tell(void *data, drmp3_int64 *pos) { *pos = SDL20_RWtell((SDL_RWops *) data); return (*pos != -1) ? DRMP3_TRUE : DRMP3_FALSE; } static SDL_bool OpenSDL2AudioDevice(SDL_AudioSpec *want); static int CloseSDL2AudioDevice(void); static SDL_bool ResetAudioStream(SDL_AudioStream **_stream, SDL_AudioSpec *spec, const SDL_AudioSpec *to, const SDL_AudioFormat fromfmt, const Uint8 fromchannels, const int fromfreq); typedef struct { SDL_AudioSpec device_format; SDL_bool app_callback_opened; SDL_AudioSpec app_callback_format; SDL_AudioStream *app_callback_stream; SDL_bool cdrom_opened; SDL_AudioSpec cdrom_format; SDL_AudioStream *cdrom_stream; SDL12_CDstatus cdrom_status; int cdrom_pcm_frames_written; int cdrom_cur_track; int cdrom_cur_frame; int cdrom_stop_ntracks; int cdrom_stop_nframes; drmp3 cdrom_mp3; Uint8 *mix_buffer; size_t mixbuflen; } AudioCallbackWrapperData; static AudioCallbackWrapperData *audio_cbdata = NULL; static SDL_atomic_t audio_callback_paused; static void FreeMp3(drmp3 *mp3) { SDL_RWops *rw = (SDL_RWops *) mp3->pUserData; if (rw) { drmp3_uninit(mp3); mp3->pUserData = NULL; SDL20_RWclose(rw); } } static SDL_bool CDSubsystemIsInitialized(void) { if (!CDRomInit) { SDL20_SetError("CD-ROM subsystem not initialized"); return SDL_FALSE; } return SDL_TRUE; } /* This never reports failure; if there's a problem, we report zero drives found. */ static void InitializeCDSubsystem(void) { const char *cdpath; if (CDRomInit) { return; } cdpath = SDL12Compat_GetHint("SDL12COMPAT_FAKE_CDROM_PATH"); if (cdpath) { CDRomPath = SDL_strdup(cdpath); } CDRomInit = SDL_TRUE; } static void QuitCDSubsystem(void) { if (!CDRomInit) { return; } SDL_free(CDRomPath); CDRomPath = NULL; CDRomInit = SDL_FALSE; } DECLSPEC12 int SDLCALL SDL_CDNumDrives(void) { if (!CDSubsystemIsInitialized()) { return -1; } if (!CDRomPath) { static SDL_bool warned_once = SDL_FALSE; if (!warned_once) { warned_once = SDL_TRUE; SDL20_Log("This app is looking for CD-ROM drives, but no path was specified"); SDL20_Log("Set the SDL12COMPAT_FAKE_CDROM_PATH environment variable to a directory"); SDL20_Log("of MP3 files named trackXX.mp3 where XX is a track number in two digits"); SDL20_Log("from 01 to 99"); } } return CDRomPath ? 1 : 0; } static SDL_bool ValidCDDriveIndex(const int drive) { if (!CDSubsystemIsInitialized()) { return SDL_FALSE; } if (!CDRomPath || (drive != 0)) { SDL20_SetError("Invalid CD-ROM drive index"); return SDL_FALSE; } return SDL_TRUE; } DECLSPEC12 const char * SDLCALL SDL_CDName(int drive) { return ValidCDDriveIndex(drive) ? CDRomPath : NULL; } DECLSPEC12 SDL12_CD * SDLCALL SDL_CDOpen(int drive) { SDL12_CD *retval; size_t alloclen; char *fullpath; drmp3 *mp3 = NULL; Uint32 total_track_offset = 0; SDL_bool has_audio = SDL_FALSE; if (!ValidCDDriveIndex(drive)) { return NULL; } retval = (SDL12_CD *) SDL20_calloc(1, sizeof(SDL12_CD)); if (!retval) { SDL20_OutOfMemory(); return NULL; } alloclen = SDL20_strlen(CDRomPath) + 32; fullpath = (char *) SDL20_malloc(alloclen); if (fullpath == NULL) { SDL20_free(retval); SDL20_OutOfMemory(); return NULL; } mp3 = (drmp3 *) SDL20_malloc(sizeof (drmp3)); if (!mp3) { SDL20_free(fullpath); SDL20_free(retval); SDL20_OutOfMemory(); return NULL; } /* We would do a proper enumeration of this directory, but that would need platform-specific code that SDL2 doesn't offer. readdir() is surprisingly hard to do without a bunch of different platform backends! We just open files until we fail to do so, and then stop. */ for (;;) { SDL_RWops *rw; drmp3_uint64 pcmframes; drmp3_uint32 samplerate; SDL12_CDtrack *track; SDL_bool fake_data_track = SDL_FALSE; int c; char c0, c1; c = retval->numtracks + 1; c0 = c / 10 + '0'; c1 = c % 10 + '0'; /* note that fake data track files just need to exist, they can be empty files. */ SDL20_snprintf(fullpath, alloclen, "%s%strack%c%c.dat", CDRomPath, DIRSEP, c0, c1); rw = SDL20_RWFromFile(fullpath, "rb"); if (rw) { /* fake data track. */ fake_data_track = SDL_TRUE; SDL20_RWclose(rw); rw = NULL; } else { SDL20_snprintf(fullpath, alloclen, "%s%strack%c%c.mp3", CDRomPath, DIRSEP, c0, c1); rw = SDL20_RWFromFile(fullpath, "rb"); /* if there isn't a track 1 specified, pretend it's a data track, which matches most games' needs. */ if (!rw && (c == 1)) { fake_data_track = SDL_TRUE; } } if (!rw && !fake_data_track) { break; /* ok, we're done looking for more. */ } track = &retval->track[retval->numtracks]; if (!fake_data_track) { SDL_assert(rw != NULL); if (!drmp3_init(mp3, mp3_sdlrwops_read, mp3_sdlrwops_seek, mp3_sdlrwops_tell, NULL, rw, NULL)) { SDL20_RWclose(rw); rw = NULL; fake_data_track = SDL_TRUE; /* congratulations, bogus or unsupported MP3, you just became data! */ } else { pcmframes = drmp3_get_pcm_frame_count(mp3); samplerate = mp3->sampleRate; FreeMp3(mp3); rw = NULL; track->id = retval->numtracks; track->type = 0; /* audio track. Data tracks are 4. */ track->length = (Uint32) ((((double) pcmframes) / ((double) samplerate)) * CDAUDIO_FPS); track->offset = total_track_offset; total_track_offset += track->length; has_audio = SDL_TRUE; } } SDL_assert(rw == NULL); /* we should have dealt with this in all paths. */ if (fake_data_track) { track->type = 4; /* data track. E.g.: quake's audio starts at track 2. */ } retval->numtracks++; if (retval->numtracks == 99) { break; /* max tracks you can have on an audio CD. */ } } if (!has_audio) { retval->numtracks = 0; /* data-only */ } SDL20_free(mp3); SDL20_free(fullpath); retval->id = 1; /* just to be non-zero, I guess. */ retval->status = (retval->numtracks > 0) ? SDL12_CD_STOPPED : SDL12_CD_TRAYEMPTY; if (retval->numtracks > 0) { SDL_AudioSpec want; SDL20_zero(want); want.freq = 44100; want.format = AUDIO_F32SYS; want.channels = 2; want.samples = 4096; if (!OpenSDL2AudioDevice(&want)) { retval->numtracks = 0; retval->status = SDL12_CD_TRAYEMPTY; } else { /* Device is locked now, even if was opened and playing before. Set up some things. */ SDL20_memcpy(&audio_cbdata->cdrom_format, &want, sizeof (SDL_AudioSpec)); audio_cbdata->cdrom_opened = SDL_TRUE; audio_cbdata->cdrom_status = SDL12_CD_STOPPED; audio_cbdata->cdrom_pcm_frames_written = 0; audio_cbdata->cdrom_cur_track = 0; audio_cbdata->cdrom_cur_frame = 0; SDL20_UnlockAudio(); } } CDRomDevice = retval; /* NULL API args use the last opened device. */ return retval; } static SDL12_CD * ValidCDDevice(SDL12_CD *cdrom) { if (!CDSubsystemIsInitialized()) { return NULL; } else if (!cdrom) { if (!CDRomDevice) { SDL20_SetError("CD-ROM not opened"); } else { cdrom = CDRomDevice; } } return cdrom; } DECLSPEC12 SDL12_CDstatus SDLCALL SDL_CDStatus(SDL12_CD *cdrom) { SDL12_CDstatus retval; if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return SDL12_CD_ERROR; } SDL20_LockAudio(); /* we update this during the audio callback. */ if (audio_cbdata) { cdrom->status = audio_cbdata->cdrom_status; cdrom->cur_track = audio_cbdata->cdrom_cur_track; cdrom->cur_frame = audio_cbdata->cdrom_cur_frame; } retval = cdrom->status; SDL20_UnlockAudio(); return retval; } static SDL_bool LoadCDTrack(const int tracknum, drmp3 *mp3) { const SDL_AudioSpec *have = &audio_cbdata->device_format; SDL_RWops *rw = NULL; const size_t alloclen = SDL20_strlen(CDRomPath) + 32; char *fullpath = (char *) SDL_malloc(alloclen); const int c = tracknum + 1; char c0, c1; if (!fullpath) { return SDL_FALSE; } c0 = c / 10 + '0'; c1 = c % 10 + '0'; SDL20_snprintf(fullpath, alloclen, "%s%strack%c%c.mp3", CDRomPath, DIRSEP, c0, c1); rw = SDL20_RWFromFile(fullpath, "rb"); SDL20_free(fullpath); if (!rw) { return SDL_FALSE; } if (!drmp3_init(mp3, mp3_sdlrwops_read, mp3_sdlrwops_seek, mp3_sdlrwops_tell, NULL, rw, NULL)) { SDL20_RWclose(rw); return SDL_FALSE; } if (!ResetAudioStream(&audio_cbdata->cdrom_stream, &audio_cbdata->cdrom_format, have, AUDIO_F32SYS, mp3->channels, mp3->sampleRate)) { FreeMp3(mp3); return SDL_FALSE; } return SDL_TRUE; } static int StartCDAudioPlaying(SDL12_CD *cdrom, const int start_track, const int start_frame, const int ntracks, const int nframes) { drmp3 *mp3 = (drmp3 *) SDL20_malloc(sizeof (drmp3)); const SDL_bool loaded = mp3 ? LoadCDTrack(start_track, mp3) : SDL_FALSE; const SDL_bool seeking = (loaded && (start_frame > 0))? SDL_TRUE : SDL_FALSE; const drmp3_uint32 pcm_frame = seeking ? (Uint32) ((start_frame / 75.0) * (Sint32)mp3->sampleRate) : 0; if (!mp3) { return SDL20_OutOfMemory(); } if (seeking) { /* do seeking before handing off to the audio thread. */ drmp3_seek_to_pcm_frame(mp3, pcm_frame); } SDL20_LockAudio(); if (audio_cbdata) { cdrom->status = audio_cbdata->cdrom_status = loaded ? SDL12_CD_PLAYING : SDL12_CD_TRAYEMPTY; audio_cbdata->cdrom_pcm_frames_written = (int) pcm_frame; audio_cbdata->cdrom_cur_track = start_track; audio_cbdata->cdrom_cur_frame = start_frame; audio_cbdata->cdrom_stop_ntracks = ntracks; audio_cbdata->cdrom_stop_nframes = nframes; FreeMp3(&audio_cbdata->cdrom_mp3); if (loaded) { SDL20_memcpy(&audio_cbdata->cdrom_mp3, mp3, sizeof (drmp3)); } } SDL20_UnlockAudio(); SDL20_free(mp3); return loaded ? 0 : SDL20_SetError("Failed to start CD track"); } DECLSPEC12 int SDLCALL SDL_CDPlayTracks(SDL12_CD *cdrom, int start_track, int start_frame, int ntracks, int nframes) { if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } if (cdrom->status == SDL12_CD_TRAYEMPTY) { return SDL20_SetError("Tray empty"); } if ((start_track < 0) || (start_track >= cdrom->numtracks)) { return SDL20_SetError("Invalid start track"); } if ((start_frame < 0) || (((Uint32) start_frame) >= cdrom->track[start_track].length)) { return SDL20_SetError("Invalid start frame"); } if ((ntracks < 0) || ((start_track + ntracks) >= cdrom->numtracks)) { return SDL20_SetError("Invalid number of tracks"); } if ((nframes < 0) || (((Uint32) nframes) >= cdrom->track[start_track + ntracks].length)) { return SDL20_SetError("Invalid number of frames"); } if (!ntracks && !nframes) { ntracks = cdrom->numtracks - start_track; nframes = cdrom->track[cdrom->numtracks - 1].length; } return StartCDAudioPlaying(cdrom, start_track, start_frame, ntracks, nframes); } DECLSPEC12 int SDLCALL SDL_CDPlay(SDL12_CD *cdrom, int start, int length) { const Uint32 ui32start = (Uint32) start; Uint32 remain = (Uint32) length; int start_track = -1; int start_frame = -1; int ntracks = -1; int nframes = -1; int i; if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } if (cdrom->status == SDL12_CD_TRAYEMPTY) { return SDL20_SetError("Tray empty"); } if (start < 0) { return SDL20_SetError("Invalid start"); } if (length < 0) { return SDL20_SetError("Invalid length"); } for (i = 0; i < cdrom->numtracks; i++) { if ((ui32start >= cdrom->track[i].offset) && (ui32start < (cdrom->track[i].offset + cdrom->track[i].length))) { start_track = i; break; } } if (start_track == -1) { return SDL20_SetError("Invalid start"); } start_frame = start - cdrom->track[start_track].offset; if (remain < (cdrom->track[start_track].length - start_frame)) { ntracks = 0; nframes = remain; remain = 0; } else { remain -= (cdrom->track[start_track].length - start_frame); for (i = start_track + 1; i < cdrom->numtracks; i++) { if (remain < cdrom->track[i].length) { ntracks = i - start_track; nframes = remain; remain = 0; break; } remain -= cdrom->track[i].length; } } if (remain) { ntracks = (cdrom->numtracks - start_track) - 1; nframes = cdrom->track[cdrom->numtracks - 1].length; } return StartCDAudioPlaying(cdrom, start_track, start_frame, ntracks, nframes); } DECLSPEC12 int SDLCALL SDL_CDPause(SDL12_CD *cdrom) { if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } if (cdrom->status == SDL12_CD_TRAYEMPTY) { return SDL20_SetError("Tray empty"); } SDL20_LockAudio(); if (audio_cbdata) { if (audio_cbdata->cdrom_status == SDL12_CD_PLAYING) { audio_cbdata->cdrom_status = SDL12_CD_PAUSED; } cdrom->status = audio_cbdata->cdrom_status; } SDL20_UnlockAudio(); return 0; } DECLSPEC12 int SDLCALL SDL_CDResume(SDL12_CD *cdrom) { if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } if (cdrom->status == SDL12_CD_TRAYEMPTY) { return SDL20_SetError("Tray empty"); } SDL20_LockAudio(); if (audio_cbdata) { if (audio_cbdata->cdrom_status == SDL12_CD_PAUSED) { audio_cbdata->cdrom_status = SDL12_CD_PLAYING; } cdrom->status = audio_cbdata->cdrom_status; } SDL20_UnlockAudio(); return 0; } DECLSPEC12 int SDLCALL SDL_CDStop(SDL12_CD *cdrom) { SDL_RWops *oldrw = NULL; if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } SDL20_LockAudio(); if (audio_cbdata) { if ((audio_cbdata->cdrom_status == SDL12_CD_PLAYING) || (audio_cbdata->cdrom_status == SDL12_CD_PAUSED)) { audio_cbdata->cdrom_status = SDL12_CD_STOPPED; FreeMp3(&audio_cbdata->cdrom_mp3); } cdrom->status = audio_cbdata->cdrom_status; } SDL20_UnlockAudio(); if (oldrw) { SDL20_RWclose(oldrw); } return 0; } DECLSPEC12 int SDLCALL SDL_CDEject(SDL12_CD *cdrom) { if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return -1; } SDL20_LockAudio(); if (audio_cbdata) { audio_cbdata->cdrom_status = SDL12_CD_TRAYEMPTY; FreeMp3(&audio_cbdata->cdrom_mp3); } cdrom->status = SDL12_CD_TRAYEMPTY; SDL20_UnlockAudio(); return 0; } DECLSPEC12 void SDLCALL SDL_CDClose(SDL12_CD *cdrom) { if ((cdrom = ValidCDDevice(cdrom)) == NULL) { return; } SDL20_LockAudio(); if (audio_cbdata) { audio_cbdata->cdrom_status = SDL12_CD_STOPPED; audio_cbdata->cdrom_opened = SDL_FALSE; } SDL20_UnlockAudio(); if (audio_cbdata) { FreeMp3(&audio_cbdata->cdrom_mp3); SDL20_FreeAudioStream(audio_cbdata->cdrom_stream); audio_cbdata->cdrom_stream = NULL; } CloseSDL2AudioDevice(); if (cdrom == CDRomDevice) { CDRomDevice = NULL; } SDL20_free(cdrom); } static void FakeCdRomAudioCallback(AudioCallbackWrapperData *data, Uint8 *stream, int len, const SDL_bool must_mix) { Uint32 total_available, available = 0; Uint32 channels, want_frames; if (data->cdrom_status != SDL12_CD_PLAYING) { if (!must_mix) { SDL20_memset(stream, data->device_format.silence, len); } return; } SDL_assert((data->cdrom_status == SDL12_CD_PLAYING) && (data->cdrom_mp3.pUserData != NULL)); channels = data->cdrom_format.channels; want_frames = data->cdrom_format.samples / channels; while ((!data->cdrom_mp3.atEnd) && (SDL20_AudioStreamAvailable(data->cdrom_stream) < len)) { const Uint32 frames_read = (Uint32) drmp3_read_pcm_frames_f32(&data->cdrom_mp3, want_frames, (float *) data->mix_buffer); const Uint32 bytes_read = frames_read * channels * sizeof (float); SDL_assert(bytes_read <= data->cdrom_format.size); if ((!bytes_read) || (SDL20_AudioStreamPut(data->cdrom_stream, data->mix_buffer, bytes_read) == -1)) { /* probably out of memory if failed */ data->cdrom_mp3.atEnd = DRMP3_TRUE; /* force this to fail from now on */ SDL20_AudioStreamFlush(data->cdrom_stream); /* make sure all we've put is available to get. */ break; } } total_available = SDL20_AudioStreamAvailable(data->cdrom_stream); available = total_available; if (((Uint32) len) < available) { available = (Uint32) len; } if (available > 0) { if (!must_mix) { SDL20_AudioStreamGet(data->cdrom_stream, stream, available); } else { SDL20_AudioStreamGet(data->cdrom_stream, data->mix_buffer, available); SDL20_MixAudioFormat(stream, data->mix_buffer, audio_cbdata->device_format.format, available, SDL_MIX_MAXVOLUME); } data->cdrom_pcm_frames_written += (int) ((available / ((double) SDL_AUDIO_BITSIZE(data->device_format.format) / 8.0)) / data->device_format.channels); data->cdrom_cur_frame = (int) ((((double)data->cdrom_pcm_frames_written) / ((double)data->device_format.freq)) * CDAUDIO_FPS); if (data->cdrom_stop_ntracks == 0) { if (data->cdrom_cur_frame >= data->cdrom_stop_nframes) { data->cdrom_mp3.atEnd = DRMP3_TRUE; /* played all that was requested! */ } } } if ((total_available == 0) && (data->cdrom_mp3.atEnd)) { /* mp3 is done for whatever reason */ SDL_bool silence = ((!must_mix) && (available < ((Uint32) len))) ? SDL_TRUE : SDL_FALSE; /* silence any section we couldn't provide */ FreeMp3(&data->cdrom_mp3); if (data->cdrom_stop_ntracks > 0) { data->cdrom_stop_ntracks--; data->cdrom_pcm_frames_written = 0; data->cdrom_cur_frame = 0; if (data->cdrom_status == SDL12_CD_PLAYING) { /* go on to next track? */ const SDL_bool loaded = LoadCDTrack(++data->cdrom_cur_track, &data->cdrom_mp3); if (!loaded) { data->cdrom_status = SDL12_CD_STOPPED; } else { /* let new track fill out rest of callback. */ if (available < ((Uint32) len)) { FakeCdRomAudioCallback(data, stream + available, len - available, must_mix); silence = SDL_FALSE; } } } } else { data->cdrom_status = SDL12_CD_STOPPED; /* played all that was requested! */ } if (silence) { SDL20_memset(stream + available, data->device_format.silence, len - available); } } } static void SDLCALL AudioCallbackWrapper(void *userdata, Uint8 *stream, int len) { AudioCallbackWrapperData *data = (AudioCallbackWrapperData *) userdata; SDL_bool must_mix = SDL_FALSE; if (data->app_callback_opened && !SDL20_AtomicGet(&audio_callback_paused)) { while (SDL20_AudioStreamAvailable(data->app_callback_stream) < len) { SDL20_memset(data->mix_buffer, data->app_callback_format.silence, data->app_callback_format.size); /* SDL2 doesn't clear the stream before calling in here, but 1.2 expects it. */ data->app_callback_format.callback(data->app_callback_format.userdata, data->mix_buffer, data->app_callback_format.size); if (SDL20_AudioStreamPut(data->app_callback_stream, data->mix_buffer, data->app_callback_format.size) == -1) { /* probably out of memory if failed */ break; /* this will make the AudioStreamGet call fail. */ } } if (SDL20_AudioStreamGet(data->app_callback_stream, stream, len) != len) { SDL20_memset(stream, data->device_format.silence, len); } else { must_mix = SDL_TRUE; } } FakeCdRomAudioCallback(data, stream, len, must_mix); } static SDL_bool ResetAudioStream(SDL_AudioStream **_stream, SDL_AudioSpec *spec, const SDL_AudioSpec *to, const SDL_AudioFormat fromfmt, const Uint8 fromchannels, const int fromfreq) { if ((!*_stream) || (spec->channels != fromchannels) || (spec->format != fromfmt) || (spec->freq != fromfreq)) { SDL20_FreeAudioStream(*_stream); *_stream = SDL20_NewAudioStream(fromfmt, fromchannels, fromfreq, to->format, to->channels, to->freq); if (!*_stream) { return SDL_FALSE; } spec->channels = fromchannels; spec->format = fromfmt; spec->freq = fromfreq; spec->size = spec->samples * spec->channels * (SDL_AUDIO_BITSIZE(spec->format) / 8); if (audio_cbdata->mixbuflen < spec->size) { void *ptr = SDL20_realloc(audio_cbdata->mix_buffer, spec->size); if (!ptr) { SDL20_FreeAudioStream(*_stream); *_stream = NULL; SDL20_OutOfMemory(); return SDL_FALSE; } audio_cbdata->mixbuflen = spec->size; audio_cbdata->mix_buffer = (Uint8 *) ptr; } } return SDL_TRUE; } static SDL_bool OpenSDL2AudioDevice(SDL_AudioSpec *appwant) { SDL_AudioSpec devwant; /* note that 0x80 isn't perfect silence for U16 formats, but we only have one byte that is used for memset() calls, so it has to do. SDL2 has the same bug. */ appwant->silence = SDL_AUDIO_ISSIGNED(appwant->format) ? 0x00 : 0x80; appwant->size = appwant->samples * appwant->channels * (SDL_AUDIO_BITSIZE(appwant->format) / 8); if (audio_cbdata != NULL) { /* device is already open. */ SDL20_LockAudio(); /* Device is already at acceptable parameters, just pause it for further setup by caller. */ return SDL_TRUE; } audio_cbdata = (AudioCallbackWrapperData *) SDL20_calloc(1, sizeof (AudioCallbackWrapperData)); if (!audio_cbdata) { SDL20_OutOfMemory(); return SDL_FALSE; } /* Two things use the audio device: the app, through 1.2's SDL_OpenAudio, and the fake CD-ROM device. Either can open the device, and both write to SDL_AudioStreams to buffer and convert data. We open the device in a format that accommodates both inputs. In case the app asks for something really low-quality--an old game playing 8-bit mono audio at 8000Hz or whatever--we force the audio hardware to something better, in case the app _also_ wants to play CD audio, so we can get good quality out of that without reopening the device. We have to be able to buffer and convert between the app's needs and SDL2's anyhow, so this isn't a big deal. If they ask for better than CD quality, we'll allow it and upsample any CD audio that is played. If the CD-ROM is opened first, and the app wants better-than-CD quality later, there's not much we can do, it'll have to downsample, but I suspect this is rare, and the audio will still be good enough. */ SDL20_memcpy(&devwant, appwant, sizeof (SDL_AudioSpec)); devwant.callback = AudioCallbackWrapper; devwant.userdata = audio_cbdata; devwant.freq = SDL_max(devwant.freq, 44100); devwant.channels = SDL_max(devwant.channels, 2); if (SDL_AUDIO_BITSIZE(devwant.format) < 16) { devwant.format = AUDIO_S16SYS; } if (SDL20_OpenAudio(&devwant, &audio_cbdata->device_format) == -1) { SDL_free(audio_cbdata); audio_cbdata = NULL; return SDL_FALSE; } SDL20_LockAudio(); SDL20_PauseAudio(0); /* always unpause, but caller will unlock after finalizing setup. */ return SDL_TRUE; } static int CloseSDL2AudioDevice(void) { SDL_bool close_sdl2_device; SDL20_LockAudio(); close_sdl2_device = (audio_cbdata && !audio_cbdata->app_callback_opened && !audio_cbdata->cdrom_opened) ? SDL_TRUE : SDL_FALSE; SDL20_UnlockAudio(); if (close_sdl2_device) { SDL20_CloseAudio(); SDL20_FreeAudioStream(audio_cbdata->app_callback_stream); SDL20_FreeAudioStream(audio_cbdata->cdrom_stream); SDL20_free(audio_cbdata->mix_buffer); SDL20_free(audio_cbdata); audio_cbdata = NULL; } return -1; } DECLSPEC12 int SDLCALL SDL_OpenAudio(SDL_AudioSpec *want, SDL_AudioSpec *obtained) { SDL_bool already_opened; /* SDL_OpenAudio() will init the subsystem for you if necessary, yuck. */ if ((InitializedSubsystems20 & SDL_INIT_AUDIO) != SDL_INIT_AUDIO) { if (SDL_InitSubSystem(SDL12_INIT_AUDIO) < 0) { return -1; } } /* SDL2 uses a NULL callback to mean "we plan to use SDL_QueueAudio()" */ if (want && (want->callback == NULL)) { return SDL20_SetError("Callback can't be NULL"); } SDL20_LockAudio(); already_opened = (audio_cbdata && audio_cbdata->app_callback_opened) ? SDL_TRUE : SDL_FALSE; SDL20_UnlockAudio(); if (already_opened) { return SDL20_SetError("Audio device already opened"); } if (!want->format) { const char *env = SDL12COMPAT_getenv_unsafe("SDL_AUDIO_FORMAT"); /* SDL 1.2 checks this. */ if (env != NULL) { if (SDL20_strcmp(env, "U8") == 0) { want->format = AUDIO_U8; } else if (SDL20_strcmp(env, "S8") == 0) { want->format = AUDIO_S8; } else if (SDL20_strcmp(env, "U16") == 0) { want->format = AUDIO_U16SYS; } else if (SDL20_strcmp(env, "S16") == 0) { want->format = AUDIO_S16SYS; } else if (SDL20_strcmp(env, "U16LSB") == 0) { want->format = AUDIO_U16LSB; } else if (SDL20_strcmp(env, "S16LSB") == 0) { want->format = AUDIO_S16LSB; } else if (SDL20_strcmp(env, "U16MSB") == 0) { want->format = AUDIO_U16MSB; } else if (SDL20_strcmp(env, "S16MSB") == 0) { want->format = AUDIO_S16MSB; } else if (SDL20_strcmp(env, "U16SYS") == 0) { want->format = AUDIO_U16SYS; } else if (SDL20_strcmp(env, "S16SYS") == 0) { want->format = AUDIO_S16SYS; } } if (!want->format) { want->format = AUDIO_S16SYS; } } if (!want->freq) { const char *env = SDL12COMPAT_getenv_unsafe("SDL_AUDIO_FREQUENCY"); /* SDL 1.2 checks this. */ if (env != NULL) { want->freq = SDL20_atoi(env); } if (!want->freq) { want->freq = 22050; } want->samples = 0; } if (!want->channels) { const char *env = SDL12COMPAT_getenv_unsafe("SDL_AUDIO_CHANNELS"); /* SDL 1.2 checks this. */ if (env != NULL) { want->channels = SDL20_atoi(env); } if (!want->channels) { want->channels = 2; } } if (!want->samples) { const char *env = SDL12COMPAT_getenv_unsafe("SDL_AUDIO_SAMPLES"); /* SDL 1.2 checks this. */ if (env != NULL) { want->samples = SDL20_atoi(env); } if (!want->samples) { const Uint32 samp = (want->freq / 1000) * 46; /* ~46 ms */ Uint32 pow2 = 1; while (pow2 < samp) { pow2 <<= 1; } want->samples = pow2; } } /* the app always passes callback data through an SDL_AudioStream, since it has to share with the fake CD-ROM support. This also avoids the risk of getting an incompatible device configuration from SDL2. As such, the app always gets the format it requests. */ if (!OpenSDL2AudioDevice(want)) { return -1; } /* Device is locked now, unconditionally. Set up some things. */ if (obtained) { /* the app always gets the format it requests */ SDL20_memcpy(obtained, want, sizeof (SDL_AudioSpec)); } SDL20_memcpy(&audio_cbdata->app_callback_format, want, sizeof (SDL_AudioSpec)); SDL20_AtomicSet(&audio_callback_paused, SDL_TRUE); /* app callback always starts paused after open. */ SDL_assert(audio_cbdata->app_callback_stream == NULL); if (!ResetAudioStream(&audio_cbdata->app_callback_stream, &audio_cbdata->app_callback_format, &audio_cbdata->device_format, want->format, want->channels, want->freq)) { SDL20_UnlockAudio(); /* make sure CD audio doesn't hang if it's playing. */ return CloseSDL2AudioDevice(); /* will stay open if CD audio is still playing, cleans up otherwise. */ } audio_cbdata->app_callback_opened = SDL_TRUE; SDL20_UnlockAudio(); /* we're off and going. */ return 0; } DECLSPEC12 void SDLCALL SDL_PauseAudio(int pause_on) { SDL20_AtomicSet(&audio_callback_paused, pause_on ? SDL_TRUE : SDL_FALSE); } DECLSPEC12 SDL_AudioStatus SDLCALL SDL_GetAudioStatus(void) { SDL_AudioStatus retval = SDL_AUDIO_STOPPED; SDL20_LockAudio(); if (audio_cbdata && audio_cbdata->app_callback_opened) { retval = SDL20_AtomicGet(&audio_callback_paused) ? SDL_AUDIO_PAUSED : SDL_AUDIO_PLAYING; } SDL20_UnlockAudio(); return retval; } DECLSPEC12 void SDLCALL SDL_MixAudio(Uint8 *dst, const Uint8 *src, Uint32 len, int volume) { SDL_AudioFormat fmt; if (volume == 0) { return; /* nothing to do. */ } /* in 1.2, if not the subsystem isn't initialized _at all_, it forces format to AUDIO_S16. If it's initialized but the device isn't opened, you get a format of zero and it returns an error without mixing anything. */ SDL20_LockAudio(); if ((InitializedSubsystems20 & SDL_INIT_AUDIO) != SDL_INIT_AUDIO) { fmt = AUDIO_S16; /* to quote 1.2: "HACK HACK HACK" */ } else if (!audio_cbdata || !audio_cbdata->app_callback_opened) { fmt = 0; /* this will fail, but drop the lock first. */ } else { fmt = audio_cbdata->app_callback_format.format; } SDL20_UnlockAudio(); if (fmt == 0) { SDL_SetError("SDL_MixAudio(): unknown audio format"); /* this is the exact error 1.2 reports for this. */ } else { SDL20_MixAudioFormat(dst, src, fmt, len, volume); } } DECLSPEC12 void SDLCALL SDL_CloseAudio(void) { SDL20_LockAudio(); if (audio_cbdata) { audio_cbdata->app_callback_opened = SDL_FALSE; SDL20_FreeAudioStream(audio_cbdata->app_callback_stream); audio_cbdata->app_callback_stream = NULL; } SDL20_UnlockAudio(); CloseSDL2AudioDevice(); } static SDL_AudioCVT * AudioCVT12to20(const SDL12_AudioCVT *cvt12, SDL_AudioCVT *cvt20) { SDL20_zerop(cvt20); cvt20->needed = cvt12->needed; cvt20->src_format = cvt12->src_format; cvt20->dst_format = cvt12->dst_format; cvt20->rate_incr = cvt12->rate_incr; cvt20->buf = cvt12->buf; cvt20->len = cvt12->len; cvt20->len_cvt = cvt12->len_cvt; cvt20->len_mult = cvt12->len_mult; cvt20->len_ratio = cvt12->len_ratio; SDL20_memcpy(cvt20->filters, cvt12->filters, sizeof (cvt12->filters)); cvt20->filter_index = cvt12->filter_index; return cvt20; } static SDL12_AudioCVT * AudioCVT20to12(const SDL_AudioCVT *cvt20, SDL12_AudioCVT *cvt12) { SDL20_zerop(cvt12); cvt12->needed = cvt20->needed; cvt12->src_format = cvt20->src_format; cvt12->dst_format = cvt20->dst_format; cvt12->rate_incr = cvt20->rate_incr; cvt12->buf = cvt20->buf; cvt12->len = cvt20->len; cvt12->len_cvt = cvt20->len_cvt; cvt12->len_mult = cvt20->len_mult; cvt12->len_ratio = cvt20->len_ratio; SDL20_memcpy(cvt12->filters, cvt20->filters, sizeof (cvt20->filters)); cvt12->filter_index = cvt20->filter_index; return cvt12; } static void SDLCALL CompatibilityCVT_RunStream(SDL12_AudioCVT *cvt12, Uint16 format) { const size_t channel_mash = (size_t) cvt12->filters[SDL_arraysize(cvt12->filters) - 1]; const Uint8 src_channels = (Uint8) (channel_mash & 0xFF); const Uint8 dst_channels = (Uint8) ((channel_mash >> 8) & 0xFF); /* use an audiostream, so we can allocate a dynamic buffer for the work, even if the app screwed up their allocation. */ SDL_AudioStream *stream = SDL20_NewAudioStream(format, src_channels, 44100, cvt12->dst_format, dst_channels, 44100); /* don't resample here! */ if (stream == NULL) { return; /* oh well. */ } if ((SDL20_AudioStreamPut(stream, cvt12->buf, cvt12->len_cvt) == -1) || (SDL20_AudioStreamFlush(stream) == -1)) { /* probably out of memory if failed. */ SDL20_FreeAudioStream(stream); return; /* oh well. */ } cvt12->len_cvt = SDL20_AudioStreamAvailable(stream); SDL20_AudioStreamGet(stream, cvt12->buf, cvt12->len_cvt); SDL20_FreeAudioStream(stream); if (cvt12->filters[++cvt12->filter_index]) { cvt12->filters[cvt12->filter_index](cvt12, cvt12->dst_format); } } /* this is an extremely low-quality resampler: it only doubles or halves the sample rate and offers no interpolation...but it's also how SDL 1.2 did it. Notably: it can resample in-place, so this avoids bugs in apps that don't set up SDL_AudioCVT's buffer correctly, or expect this weird 1.2 behavior for whatever reason. */ static void SDLCALL CompatibilityCVT_Resampler(SDL12_AudioCVT *cvt12, Uint16 format) { const int bitsize = (int) SDL_AUDIO_BITSIZE(format); int i; SDL_assert((bitsize == 8) || (bitsize == 16)); /* there were no 32-bit audio types in 1.2. */ if (cvt12->rate_incr < 1.0) { /* upsampling */ /*printf("2x Upsampling!\n");*/ #define DO_RESAMPLE(typ) \ const typ *src = (const typ *) (cvt12->buf + cvt12->len_cvt); \ typ *dst = (typ *) (cvt12->buf + (cvt12->len_cvt * 2)); \ for (i = cvt12->len_cvt / sizeof (typ); i; i--) { \ const typ sample = *(--src); \ dst -= 2; \ dst[0] = dst[1] = sample; \ } if (bitsize == 8) { DO_RESAMPLE(Uint8); } else if (bitsize == 16) { DO_RESAMPLE(Uint16); } #undef DO_RESAMPLE cvt12->len_cvt *= 2; } else { /* downsampling. */ /*printf("2x Downsampling!\n");*/ #define DO_RESAMPLE(typ) \ const typ *src = (const typ *) cvt12->buf; \ typ *dst = (typ *) cvt12->buf; \ for (i = cvt12->len_cvt / (sizeof (typ) * 2); i; i--, src += 2) { \ *(dst++) = *src; \ } if (bitsize == 8) { DO_RESAMPLE(Uint8); } else if (bitsize == 16) { DO_RESAMPLE(Uint16); } #undef DO_RESAMPLE cvt12->len_cvt /= 2; } if (cvt12->filters[++cvt12->filter_index]) { cvt12->filters[cvt12->filter_index](cvt12, format); } } DECLSPEC12 int SDLCALL SDL_BuildAudioCVT(SDL12_AudioCVT *cvt12, Uint16 src_format, Uint8 src_channels, int src_rate, Uint16 dst_format, Uint8 dst_channels, int dst_rate) { int retval = 0; SDL20_zerop(cvt12); /* SDL 1.2 derefences cvt12 without checking for NULL */ if (!WantCompatibilityAudioCVT) { SDL_AudioCVT cvt20; retval = SDL20_BuildAudioCVT(&cvt20, src_format, src_channels, src_rate, dst_format, dst_channels, dst_rate); AudioCVT20to12(&cvt20, cvt12); } else { const size_t channel_mash = ((size_t) src_channels) | (((size_t) dst_channels) << 8); if ((src_format == dst_format) && (src_channels == dst_channels) && (src_rate == dst_rate)) { return 0; /* no conversion needed. */ } cvt12->needed = 1; cvt12->len_mult = 1; cvt12->len_ratio = 1.0; cvt12->src_format = src_format; cvt12->dst_format = dst_format; if ((src_format != dst_format) || (src_channels != dst_channels)) { if (src_format != dst_format) { /* there are only 8 and 16 bit formats in SDL 1.2 */ if (SDL_AUDIO_BITSIZE(src_format) < SDL_AUDIO_BITSIZE(dst_format)) { cvt12->len_mult *= 2; cvt12->len_ratio *= 2.0; } else { cvt12->len_ratio /= 2.0; } } /* SDL 1.2 only supported 1, 2, 4, and 6 channels, and would fail to convert between 4 and 6 at all. :O */ if (src_channels < dst_channels) { const int diff = (int) (dst_channels / src_channels); cvt12->len_mult *= diff; cvt12->len_ratio *= (double) diff; } else if (src_channels > dst_channels) { const int diff = (int) (src_channels / dst_channels); cvt12->len_ratio /= (double) diff; } cvt12->filters[cvt12->filter_index++] = CompatibilityCVT_RunStream; cvt12->filters[SDL_arraysize(cvt12->filters) - 1] = (SDL12_AudioCVTFilter) channel_mash; /* cheat by hiding this info at end of array. */ } if (src_rate != dst_rate) { Uint32 hi_rate = src_rate; Uint32 lo_rate = dst_rate; int len_mult = 1; double len_ratio = 0.5; if (src_rate < dst_rate) { /* flip everything. */ hi_rate = dst_rate; lo_rate = src_rate; len_mult = 2; len_ratio = 2.0; } while (((lo_rate * 2) / 100) <= (hi_rate / 100)) { /* this is what SDL 1.2 does. *shrug* */ if (cvt12->filter_index >= (int)(SDL_arraysize(cvt12->filters) - 2)) { return SDL20_SetError("Too many conversion filters needed"); } cvt12->filters[cvt12->filter_index++] = CompatibilityCVT_Resampler; cvt12->len_mult *= len_mult; lo_rate *= 2; cvt12->len_ratio *= len_ratio; } cvt12->rate_incr = ((double) src_rate) / ((double) dst_rate); } retval = 1; /* conversion definitely needed. */ } return retval; } DECLSPEC12 int SDLCALL SDL_ConvertAudio(SDL12_AudioCVT *cvt12) { int retval = 0; if (!cvt12->buf) { /* neither SDL 1.2 nor 2.0 makes sure cvt12 isn't NULL here. :/ */ retval = SDL20_SetError("No buffer allocated for conversion"); } else if (!WantCompatibilityAudioCVT) { SDL_AudioCVT cvt20; retval = SDL20_ConvertAudio(AudioCVT12to20(cvt12, &cvt20)); AudioCVT20to12(&cvt20, cvt12); } else { cvt12->len_cvt = cvt12->len; cvt12->filter_index = 0; if (cvt12->filters[0]) { cvt12->filters[0](cvt12, cvt12->src_format); } } return retval; } /* SDL_GL_DisableContext and SDL_GL_EnableContext_Thread are not real SDL 1.2 APIs, but some idTech4 games shipped with a custom SDL 1.2 build that added these functions, to let them make a GL context current on a background thread, so we supply them as well to be binary compatible for those games. */ DECLSPEC12 void SDLCALL SDL_GL_DisableContext(void) { SDL20_GL_MakeCurrent(NULL, NULL); } DECLSPEC12 void SDLCALL SDL_GL_EnableContext_Thread(void) { const SDL_bool enable = (VideoGLContext20 && VideoWindow20) ? SDL_TRUE : SDL_FALSE; SDL20_GL_MakeCurrent(enable ? VideoWindow20 : NULL, enable ? VideoGLContext20 : NULL); } /* X11_KeyToUnicode is an internal function in the SDL 1.2 x11 backend that some Linux software (older versions of the Torque Engine, for example) would call directly, so we're supplying an extremely naive implementation here. Apps using this should be fixed if possible, and this implementation is generally incorrect but hopefully enough to get apps to limp along. As this isn't X11-specific, we supply it globally, so x11 binaries can transition to Wayland, and if there's some wildly-misbuilt win32 software, they can call it too. :) */ #if !(defined(_WIN32) || defined(__OS2__)) /* #if defined(__unix__) || defined(__APPLE__) ?? */ DECLSPEC12 Uint16 SDLCALL X11_KeyToUnicode(SDL12Key key, SDL12Mod mod) { if (((int) key) >= 127) { return 0; } if ((key >= SDLK12_a) && (key <= SDLK12_z)) { const int shifted = ((mod & (KMOD12_LSHIFT|KMOD12_RSHIFT)) != 0) ? 1 : 0; int capital = ((mod & KMOD12_CAPS) != 0) ? 1 : 0; if (shifted) { capital = !capital; } return (Uint16) ((capital ? 'A' : 'a') + (key - SDLK12_a)); } return (Uint16) key; } #endif #ifdef __cplusplus } #endif /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/src/SDL12_compat_objc.m0000664000000000000000000000552215125533266015051 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* This file contains some macOS-specific support code */ #ifdef __APPLE__ #include #if __GNUC__ >= 4 #define SDL12_PRIVATE __attribute__((visibility("hidden"))) #else #define SDL12_PRIVATE __private_extern__ #endif /* This has to be in a separate, Objective-C source file because it calls into Cocoa. The issue is that SDL 1.2 apps on macOS are statically linked with SDLmain, which does something mac-specific that conflicts with SDL2 before the app's main() is even called, and we have to counteract that. */ SDL12_PRIVATE void sdl12_compat_macos_init(void) { [NSApp setActivationPolicy:NSApplicationActivationPolicyRegular]; } #ifndef MAC_OS_X_VERSION_10_12 #define NSAlertStyleCritical NSCriticalAlertStyle #endif SDL12_PRIVATE void error_dialog(const char *errorMsg) { NSAlert *alert; if (NSApp == nil) { ProcessSerialNumber psn = { 0, kCurrentProcess }; TransformProcessType(&psn, kProcessTransformToForegroundApplication); [NSApplication sharedApplication]; [NSApp setActivationPolicy:NSApplicationActivationPolicyRegular]; [NSApp finishLaunching]; } [NSApp activateIgnoringOtherApps:YES]; alert = [[[NSAlert alloc] init] autorelease]; alert.alertStyle = NSAlertStyleCritical; alert.messageText = @"Fatal error! Cannot continue!"; alert.informativeText = [NSString stringWithCString:errorMsg encoding:NSASCIIStringEncoding]; [alert runModal]; } SDL12_PRIVATE void SDL12COMPAT_NSLog(const char *prefix, const char *text) { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; { NSString *nsText = [NSString stringWithUTF8String:text]; if (prefix && *prefix) { NSString *nsPrefix = [NSString stringWithUTF8String:prefix]; NSLog(@"%@%@", nsPrefix, nsText); } else { NSLog(@"%@", nsText); } } [pool drain]; } #endif /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/src/SDL20_include_wrapper.h0000664000000000000000000035122115125533266015746 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* * This file #includes the proper SDL 2.0 headers, but #defines a whole * bunch of stuff so we don't conflict with symbols we plan to offer with * the 1.2 signatures. Ugly business. */ #ifndef _INCL_SDL20_INCLUDE_WRAPPER_H_ #define _INCL_SDL20_INCLUDE_WRAPPER_H_ #define SDL_SetError IGNORE_THIS_VERSION_OF_SDL_SetError #define SDL_Log IGNORE_THIS_VERSION_OF_SDL_Log #define SDL_LogVerbose IGNORE_THIS_VERSION_OF_SDL_LogVerbose #define SDL_LogDebug IGNORE_THIS_VERSION_OF_SDL_LogDebug #define SDL_LogInfo IGNORE_THIS_VERSION_OF_SDL_LogInfo #define SDL_LogWarn IGNORE_THIS_VERSION_OF_SDL_LogWarn #define SDL_LogError IGNORE_THIS_VERSION_OF_SDL_LogError #define SDL_LogCritical IGNORE_THIS_VERSION_OF_SDL_LogCritical #define SDL_LogMessage IGNORE_THIS_VERSION_OF_SDL_LogMessage #define SDL_sscanf IGNORE_THIS_VERSION_OF_SDL_sscanf #define SDL_snprintf IGNORE_THIS_VERSION_OF_SDL_snprintf #define SDL_CreateThread IGNORE_THIS_VERSION_OF_SDL_CreateThread #define SDL_RWFromFP IGNORE_THIS_VERSION_OF_SDL_RWFromFP #define SDL_RegisterApp IGNORE_THIS_VERSION_OF_SDL_RegisterApp #define SDL_UnregisterApp IGNORE_THIS_VERSION_OF_SDL_UnregisterApp #define SDL_Direct3D9GetAdapterIndex IGNORE_THIS_VERSION_OF_SDL_Direct3D9GetAdapterIndex #define SDL_RenderGetD3D9Device IGNORE_THIS_VERSION_OF_SDL_RenderGetD3D9Device #define SDL_iPhoneSetAnimationCallback IGNORE_THIS_VERSION_OF_SDL_iPhoneSetAnimationCallback #define SDL_iPhoneSetEventPump IGNORE_THIS_VERSION_OF_SDL_iPhoneSetEventPump #define SDL_AndroidGetJNIEnv IGNORE_THIS_VERSION_OF_SDL_AndroidGetJNIEnv #define SDL_AndroidGetActivity IGNORE_THIS_VERSION_OF_SDL_AndroidGetActivity #define SDL_AndroidGetInternalStoragePath IGNORE_THIS_VERSION_OF_SDL_AndroidGetInternalStoragePath #define SDL_AndroidGetExternalStorageState IGNORE_THIS_VERSION_OF_SDL_AndroidGetExternalStorageState #define SDL_AndroidGetExternalStoragePath IGNORE_THIS_VERSION_OF_SDL_AndroidGetExternalStoragePath #define SDL_Init IGNORE_THIS_VERSION_OF_SDL_Init #define SDL_InitSubSystem IGNORE_THIS_VERSION_OF_SDL_InitSubSystem #define SDL_QuitSubSystem IGNORE_THIS_VERSION_OF_SDL_QuitSubSystem #define SDL_WasInit IGNORE_THIS_VERSION_OF_SDL_WasInit #define SDL_Quit IGNORE_THIS_VERSION_OF_SDL_Quit #define SDL_ReportAssertion IGNORE_THIS_VERSION_OF_SDL_ReportAssertion #define SDL_SetAssertionHandler IGNORE_THIS_VERSION_OF_SDL_SetAssertionHandler #define SDL_GetAssertionReport IGNORE_THIS_VERSION_OF_SDL_GetAssertionReport #define SDL_ResetAssertionReport IGNORE_THIS_VERSION_OF_SDL_ResetAssertionReport #define SDL_AtomicTryLock IGNORE_THIS_VERSION_OF_SDL_AtomicTryLock #define SDL_AtomicLock IGNORE_THIS_VERSION_OF_SDL_AtomicLock #define SDL_AtomicUnlock IGNORE_THIS_VERSION_OF_SDL_AtomicUnlock #define SDL_AtomicCAS IGNORE_THIS_VERSION_OF_SDL_AtomicCAS #define SDL_AtomicSet IGNORE_THIS_VERSION_OF_SDL_AtomicSet #define SDL_AtomicGet IGNORE_THIS_VERSION_OF_SDL_AtomicGet #define SDL_AtomicAdd IGNORE_THIS_VERSION_OF_SDL_AtomicAdd #define SDL_AtomicCASPtr IGNORE_THIS_VERSION_OF_SDL_AtomicCASPtr #define SDL_AtomicSetPtr IGNORE_THIS_VERSION_OF_SDL_AtomicSetPtr #define SDL_AtomicGetPtr IGNORE_THIS_VERSION_OF_SDL_AtomicGetPtr #define SDL_GetNumAudioDrivers IGNORE_THIS_VERSION_OF_SDL_GetNumAudioDrivers #define SDL_GetAudioDriver IGNORE_THIS_VERSION_OF_SDL_GetAudioDriver #define SDL_AudioInit IGNORE_THIS_VERSION_OF_SDL_AudioInit #define SDL_AudioQuit IGNORE_THIS_VERSION_OF_SDL_AudioQuit #define SDL_GetCurrentAudioDriver IGNORE_THIS_VERSION_OF_SDL_GetCurrentAudioDriver #define SDL_OpenAudio IGNORE_THIS_VERSION_OF_SDL_OpenAudio #define SDL_GetNumAudioDevices IGNORE_THIS_VERSION_OF_SDL_GetNumAudioDevices #define SDL_GetAudioDeviceName IGNORE_THIS_VERSION_OF_SDL_GetAudioDeviceName #define SDL_OpenAudioDevice IGNORE_THIS_VERSION_OF_SDL_OpenAudioDevice #define SDL_GetAudioStatus IGNORE_THIS_VERSION_OF_SDL_GetAudioStatus #define SDL_GetAudioDeviceStatus IGNORE_THIS_VERSION_OF_SDL_GetAudioDeviceStatus #define SDL_PauseAudio IGNORE_THIS_VERSION_OF_SDL_PauseAudio #define SDL_PauseAudioDevice IGNORE_THIS_VERSION_OF_SDL_PauseAudioDevice #define SDL_LoadWAV_RW IGNORE_THIS_VERSION_OF_SDL_LoadWAV_RW #define SDL_FreeWAV IGNORE_THIS_VERSION_OF_SDL_FreeWAV #define SDL_BuildAudioCVT IGNORE_THIS_VERSION_OF_SDL_BuildAudioCVT #define SDL_ConvertAudio IGNORE_THIS_VERSION_OF_SDL_ConvertAudio #define SDL_MixAudio IGNORE_THIS_VERSION_OF_SDL_MixAudio #define SDL_MixAudioFormat IGNORE_THIS_VERSION_OF_SDL_MixAudioFormat #define SDL_LockAudio IGNORE_THIS_VERSION_OF_SDL_LockAudio #define SDL_LockAudioDevice IGNORE_THIS_VERSION_OF_SDL_LockAudioDevice #define SDL_UnlockAudio IGNORE_THIS_VERSION_OF_SDL_UnlockAudio #define SDL_UnlockAudioDevice IGNORE_THIS_VERSION_OF_SDL_UnlockAudioDevice #define SDL_CloseAudio IGNORE_THIS_VERSION_OF_SDL_CloseAudio #define SDL_CloseAudioDevice IGNORE_THIS_VERSION_OF_SDL_CloseAudioDevice #define SDL_SetClipboardText IGNORE_THIS_VERSION_OF_SDL_SetClipboardText #define SDL_GetClipboardText IGNORE_THIS_VERSION_OF_SDL_GetClipboardText #define SDL_HasClipboardText IGNORE_THIS_VERSION_OF_SDL_HasClipboardText #define SDL_GetCPUCount IGNORE_THIS_VERSION_OF_SDL_GetCPUCount #define SDL_GetCPUCacheLineSize IGNORE_THIS_VERSION_OF_SDL_GetCPUCacheLineSize #define SDL_HasRDTSC IGNORE_THIS_VERSION_OF_SDL_HasRDTSC #define SDL_HasAltiVec IGNORE_THIS_VERSION_OF_SDL_HasAltiVec #define SDL_HasMMX IGNORE_THIS_VERSION_OF_SDL_HasMMX #define SDL_Has3DNow IGNORE_THIS_VERSION_OF_SDL_Has3DNow #define SDL_HasSSE IGNORE_THIS_VERSION_OF_SDL_HasSSE #define SDL_HasSSE2 IGNORE_THIS_VERSION_OF_SDL_HasSSE2 #define SDL_HasSSE3 IGNORE_THIS_VERSION_OF_SDL_HasSSE3 #define SDL_HasSSE41 IGNORE_THIS_VERSION_OF_SDL_HasSSE41 #define SDL_HasSSE42 IGNORE_THIS_VERSION_OF_SDL_HasSSE42 #define SDL_GetSystemRAM IGNORE_THIS_VERSION_OF_SDL_GetSystemRAM #define SDL_GetError IGNORE_THIS_VERSION_OF_SDL_GetError #define SDL_ClearError IGNORE_THIS_VERSION_OF_SDL_ClearError #define SDL_Error IGNORE_THIS_VERSION_OF_SDL_Error #define SDL_PumpEvents IGNORE_THIS_VERSION_OF_SDL_PumpEvents #define SDL_PeepEvents IGNORE_THIS_VERSION_OF_SDL_PeepEvents #define SDL_HasEvent IGNORE_THIS_VERSION_OF_SDL_HasEvent #define SDL_HasEvents IGNORE_THIS_VERSION_OF_SDL_HasEvents #define SDL_FlushEvent IGNORE_THIS_VERSION_OF_SDL_FlushEvent #define SDL_FlushEvents IGNORE_THIS_VERSION_OF_SDL_FlushEvents #define SDL_PollEvent IGNORE_THIS_VERSION_OF_SDL_PollEvent #define SDL_WaitEvent IGNORE_THIS_VERSION_OF_SDL_WaitEvent #define SDL_WaitEventTimeout IGNORE_THIS_VERSION_OF_SDL_WaitEventTimeout #define SDL_PushEvent IGNORE_THIS_VERSION_OF_SDL_PushEvent #define SDL_SetEventFilter IGNORE_THIS_VERSION_OF_SDL_SetEventFilter #define SDL_GetEventFilter IGNORE_THIS_VERSION_OF_SDL_GetEventFilter #define SDL_AddEventWatch IGNORE_THIS_VERSION_OF_SDL_AddEventWatch #define SDL_DelEventWatch IGNORE_THIS_VERSION_OF_SDL_DelEventWatch #define SDL_FilterEvents IGNORE_THIS_VERSION_OF_SDL_FilterEvents #define SDL_EventState IGNORE_THIS_VERSION_OF_SDL_EventState #define SDL_RegisterEvents IGNORE_THIS_VERSION_OF_SDL_RegisterEvents #define SDL_GetBasePath IGNORE_THIS_VERSION_OF_SDL_GetBasePath #define SDL_GetPrefPath IGNORE_THIS_VERSION_OF_SDL_GetPrefPath #define SDL_GameControllerAddMapping IGNORE_THIS_VERSION_OF_SDL_GameControllerAddMapping #define SDL_GameControllerMappingForGUID IGNORE_THIS_VERSION_OF_SDL_GameControllerMappingForGUID #define SDL_GameControllerMapping IGNORE_THIS_VERSION_OF_SDL_GameControllerMapping #define SDL_IsGameController IGNORE_THIS_VERSION_OF_SDL_IsGameController #define SDL_GameControllerNameForIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerNameForIndex #define SDL_GameControllerOpen IGNORE_THIS_VERSION_OF_SDL_GameControllerOpen #define SDL_GameControllerName IGNORE_THIS_VERSION_OF_SDL_GameControllerName #define SDL_GameControllerGetAttached IGNORE_THIS_VERSION_OF_SDL_GameControllerGetAttached #define SDL_GameControllerGetJoystick IGNORE_THIS_VERSION_OF_SDL_GameControllerGetJoystick #define SDL_GameControllerEventState IGNORE_THIS_VERSION_OF_SDL_GameControllerEventState #define SDL_GameControllerUpdate IGNORE_THIS_VERSION_OF_SDL_GameControllerUpdate #define SDL_GameControllerGetAxisFromString IGNORE_THIS_VERSION_OF_SDL_GameControllerGetAxisFromString #define SDL_GameControllerGetStringForAxis IGNORE_THIS_VERSION_OF_SDL_GameControllerGetStringForAxis #define SDL_GameControllerGetBindForAxis IGNORE_THIS_VERSION_OF_SDL_GameControllerGetBindForAxis #define SDL_GameControllerGetAxis IGNORE_THIS_VERSION_OF_SDL_GameControllerGetAxis #define SDL_GameControllerGetButtonFromString IGNORE_THIS_VERSION_OF_SDL_GameControllerGetButtonFromString #define SDL_GameControllerGetStringForButton IGNORE_THIS_VERSION_OF_SDL_GameControllerGetStringForButton #define SDL_GameControllerGetBindForButton IGNORE_THIS_VERSION_OF_SDL_GameControllerGetBindForButton #define SDL_GameControllerGetButton IGNORE_THIS_VERSION_OF_SDL_GameControllerGetButton #define SDL_GameControllerClose IGNORE_THIS_VERSION_OF_SDL_GameControllerClose #define SDL_RecordGesture IGNORE_THIS_VERSION_OF_SDL_RecordGesture #define SDL_SaveAllDollarTemplates IGNORE_THIS_VERSION_OF_SDL_SaveAllDollarTemplates #define SDL_SaveDollarTemplate IGNORE_THIS_VERSION_OF_SDL_SaveDollarTemplate #define SDL_LoadDollarTemplates IGNORE_THIS_VERSION_OF_SDL_LoadDollarTemplates #define SDL_NumHaptics IGNORE_THIS_VERSION_OF_SDL_NumHaptics #define SDL_HapticName IGNORE_THIS_VERSION_OF_SDL_HapticName #define SDL_HapticOpen IGNORE_THIS_VERSION_OF_SDL_HapticOpen #define SDL_HapticOpened IGNORE_THIS_VERSION_OF_SDL_HapticOpened #define SDL_HapticIndex IGNORE_THIS_VERSION_OF_SDL_HapticIndex #define SDL_MouseIsHaptic IGNORE_THIS_VERSION_OF_SDL_MouseIsHaptic #define SDL_HapticOpenFromMouse IGNORE_THIS_VERSION_OF_SDL_HapticOpenFromMouse #define SDL_JoystickIsHaptic IGNORE_THIS_VERSION_OF_SDL_JoystickIsHaptic #define SDL_HapticOpenFromJoystick IGNORE_THIS_VERSION_OF_SDL_HapticOpenFromJoystick #define SDL_HapticClose IGNORE_THIS_VERSION_OF_SDL_HapticClose #define SDL_HapticNumEffects IGNORE_THIS_VERSION_OF_SDL_HapticNumEffects #define SDL_HapticNumEffectsPlaying IGNORE_THIS_VERSION_OF_SDL_HapticNumEffectsPlaying #define SDL_HapticQuery IGNORE_THIS_VERSION_OF_SDL_HapticQuery #define SDL_HapticNumAxes IGNORE_THIS_VERSION_OF_SDL_HapticNumAxes #define SDL_HapticEffectSupported IGNORE_THIS_VERSION_OF_SDL_HapticEffectSupported #define SDL_HapticNewEffect IGNORE_THIS_VERSION_OF_SDL_HapticNewEffect #define SDL_HapticUpdateEffect IGNORE_THIS_VERSION_OF_SDL_HapticUpdateEffect #define SDL_HapticRunEffect IGNORE_THIS_VERSION_OF_SDL_HapticRunEffect #define SDL_HapticStopEffect IGNORE_THIS_VERSION_OF_SDL_HapticStopEffect #define SDL_HapticDestroyEffect IGNORE_THIS_VERSION_OF_SDL_HapticDestroyEffect #define SDL_HapticGetEffectStatus IGNORE_THIS_VERSION_OF_SDL_HapticGetEffectStatus #define SDL_HapticSetGain IGNORE_THIS_VERSION_OF_SDL_HapticSetGain #define SDL_HapticSetAutocenter IGNORE_THIS_VERSION_OF_SDL_HapticSetAutocenter #define SDL_HapticPause IGNORE_THIS_VERSION_OF_SDL_HapticPause #define SDL_HapticUnpause IGNORE_THIS_VERSION_OF_SDL_HapticUnpause #define SDL_HapticStopAll IGNORE_THIS_VERSION_OF_SDL_HapticStopAll #define SDL_HapticRumbleSupported IGNORE_THIS_VERSION_OF_SDL_HapticRumbleSupported #define SDL_HapticRumbleInit IGNORE_THIS_VERSION_OF_SDL_HapticRumbleInit #define SDL_HapticRumblePlay IGNORE_THIS_VERSION_OF_SDL_HapticRumblePlay #define SDL_HapticRumbleStop IGNORE_THIS_VERSION_OF_SDL_HapticRumbleStop #define SDL_SetHintWithPriority IGNORE_THIS_VERSION_OF_SDL_SetHintWithPriority #define SDL_SetHint IGNORE_THIS_VERSION_OF_SDL_SetHint #define SDL_GetHint IGNORE_THIS_VERSION_OF_SDL_GetHint #define SDL_AddHintCallback IGNORE_THIS_VERSION_OF_SDL_AddHintCallback #define SDL_DelHintCallback IGNORE_THIS_VERSION_OF_SDL_DelHintCallback #define SDL_ClearHints IGNORE_THIS_VERSION_OF_SDL_ClearHints #define SDL_NumJoysticks IGNORE_THIS_VERSION_OF_SDL_NumJoysticks #define SDL_JoystickNameForIndex IGNORE_THIS_VERSION_OF_SDL_JoystickNameForIndex #define SDL_JoystickOpen IGNORE_THIS_VERSION_OF_SDL_JoystickOpen #define SDL_JoystickName IGNORE_THIS_VERSION_OF_SDL_JoystickName #define SDL_JoystickGetDeviceGUID IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceGUID #define SDL_JoystickGetGUID IGNORE_THIS_VERSION_OF_SDL_JoystickGetGUID #define SDL_JoystickGetGUIDString IGNORE_THIS_VERSION_OF_SDL_JoystickGetGUIDString #define SDL_JoystickGetGUIDFromString IGNORE_THIS_VERSION_OF_SDL_JoystickGetGUIDFromString #define SDL_JoystickGetAttached IGNORE_THIS_VERSION_OF_SDL_JoystickGetAttached #define SDL_JoystickInstanceID IGNORE_THIS_VERSION_OF_SDL_JoystickInstanceID #define SDL_JoystickNumAxes IGNORE_THIS_VERSION_OF_SDL_JoystickNumAxes #define SDL_JoystickNumBalls IGNORE_THIS_VERSION_OF_SDL_JoystickNumBalls #define SDL_JoystickNumHats IGNORE_THIS_VERSION_OF_SDL_JoystickNumHats #define SDL_JoystickNumButtons IGNORE_THIS_VERSION_OF_SDL_JoystickNumButtons #define SDL_JoystickUpdate IGNORE_THIS_VERSION_OF_SDL_JoystickUpdate #define SDL_JoystickEventState IGNORE_THIS_VERSION_OF_SDL_JoystickEventState #define SDL_JoystickGetAxis IGNORE_THIS_VERSION_OF_SDL_JoystickGetAxis #define SDL_JoystickGetHat IGNORE_THIS_VERSION_OF_SDL_JoystickGetHat #define SDL_JoystickGetBall IGNORE_THIS_VERSION_OF_SDL_JoystickGetBall #define SDL_JoystickGetButton IGNORE_THIS_VERSION_OF_SDL_JoystickGetButton #define SDL_JoystickClose IGNORE_THIS_VERSION_OF_SDL_JoystickClose #define SDL_GetKeyboardFocus IGNORE_THIS_VERSION_OF_SDL_GetKeyboardFocus #define SDL_GetKeyboardState IGNORE_THIS_VERSION_OF_SDL_GetKeyboardState #define SDL_GetModState IGNORE_THIS_VERSION_OF_SDL_GetModState #define SDL_SetModState IGNORE_THIS_VERSION_OF_SDL_SetModState #define SDL_GetKeyFromScancode IGNORE_THIS_VERSION_OF_SDL_GetKeyFromScancode #define SDL_GetScancodeFromKey IGNORE_THIS_VERSION_OF_SDL_GetScancodeFromKey #define SDL_GetScancodeName IGNORE_THIS_VERSION_OF_SDL_GetScancodeName #define SDL_GetScancodeFromName IGNORE_THIS_VERSION_OF_SDL_GetScancodeFromName #define SDL_GetKeyName IGNORE_THIS_VERSION_OF_SDL_GetKeyName #define SDL_GetKeyFromName IGNORE_THIS_VERSION_OF_SDL_GetKeyFromName #define SDL_StartTextInput IGNORE_THIS_VERSION_OF_SDL_StartTextInput #define SDL_IsTextInputActive IGNORE_THIS_VERSION_OF_SDL_IsTextInputActive #define SDL_StopTextInput IGNORE_THIS_VERSION_OF_SDL_StopTextInput #define SDL_SetTextInputRect IGNORE_THIS_VERSION_OF_SDL_SetTextInputRect #define SDL_HasScreenKeyboardSupport IGNORE_THIS_VERSION_OF_SDL_HasScreenKeyboardSupport #define SDL_IsScreenKeyboardShown IGNORE_THIS_VERSION_OF_SDL_IsScreenKeyboardShown #define SDL_LoadObject IGNORE_THIS_VERSION_OF_SDL_LoadObject #define SDL_LoadFunction IGNORE_THIS_VERSION_OF_SDL_LoadFunction #define SDL_UnloadObject IGNORE_THIS_VERSION_OF_SDL_UnloadObject #define SDL_LogSetAllPriority IGNORE_THIS_VERSION_OF_SDL_LogSetAllPriority #define SDL_LogSetPriority IGNORE_THIS_VERSION_OF_SDL_LogSetPriority #define SDL_LogGetPriority IGNORE_THIS_VERSION_OF_SDL_LogGetPriority #define SDL_LogResetPriorities IGNORE_THIS_VERSION_OF_SDL_LogResetPriorities #define SDL_LogMessageV IGNORE_THIS_VERSION_OF_SDL_LogMessageV #define SDL_LogGetOutputFunction IGNORE_THIS_VERSION_OF_SDL_LogGetOutputFunction #define SDL_LogSetOutputFunction IGNORE_THIS_VERSION_OF_SDL_LogSetOutputFunction #define SDL_SetMainReady IGNORE_THIS_VERSION_OF_SDL_SetMainReady #define SDL_ShowMessageBox IGNORE_THIS_VERSION_OF_SDL_ShowMessageBox #define SDL_ShowSimpleMessageBox IGNORE_THIS_VERSION_OF_SDL_ShowSimpleMessageBox #define SDL_GetMouseFocus IGNORE_THIS_VERSION_OF_SDL_GetMouseFocus #define SDL_GetMouseState IGNORE_THIS_VERSION_OF_SDL_GetMouseState #define SDL_GetRelativeMouseState IGNORE_THIS_VERSION_OF_SDL_GetRelativeMouseState #define SDL_WarpMouseInWindow IGNORE_THIS_VERSION_OF_SDL_WarpMouseInWindow #define SDL_SetRelativeMouseMode IGNORE_THIS_VERSION_OF_SDL_SetRelativeMouseMode #define SDL_GetRelativeMouseMode IGNORE_THIS_VERSION_OF_SDL_GetRelativeMouseMode #define SDL_CreateCursor IGNORE_THIS_VERSION_OF_SDL_CreateCursor #define SDL_CreateColorCursor IGNORE_THIS_VERSION_OF_SDL_CreateColorCursor #define SDL_CreateSystemCursor IGNORE_THIS_VERSION_OF_SDL_CreateSystemCursor #define SDL_SetCursor IGNORE_THIS_VERSION_OF_SDL_SetCursor #define SDL_GetCursor IGNORE_THIS_VERSION_OF_SDL_GetCursor #define SDL_GetDefaultCursor IGNORE_THIS_VERSION_OF_SDL_GetDefaultCursor #define SDL_FreeCursor IGNORE_THIS_VERSION_OF_SDL_FreeCursor #define SDL_ShowCursor IGNORE_THIS_VERSION_OF_SDL_ShowCursor #define SDL_CreateMutex IGNORE_THIS_VERSION_OF_SDL_CreateMutex #define SDL_LockMutex IGNORE_THIS_VERSION_OF_SDL_LockMutex #define SDL_TryLockMutex IGNORE_THIS_VERSION_OF_SDL_TryLockMutex #define SDL_UnlockMutex IGNORE_THIS_VERSION_OF_SDL_UnlockMutex #define SDL_DestroyMutex IGNORE_THIS_VERSION_OF_SDL_DestroyMutex #define SDL_CreateSemaphore IGNORE_THIS_VERSION_OF_SDL_CreateSemaphore #define SDL_DestroySemaphore IGNORE_THIS_VERSION_OF_SDL_DestroySemaphore #define SDL_SemWait IGNORE_THIS_VERSION_OF_SDL_SemWait #define SDL_SemTryWait IGNORE_THIS_VERSION_OF_SDL_SemTryWait #define SDL_SemWaitTimeout IGNORE_THIS_VERSION_OF_SDL_SemWaitTimeout #define SDL_SemPost IGNORE_THIS_VERSION_OF_SDL_SemPost #define SDL_SemValue IGNORE_THIS_VERSION_OF_SDL_SemValue #define SDL_CreateCond IGNORE_THIS_VERSION_OF_SDL_CreateCond #define SDL_DestroyCond IGNORE_THIS_VERSION_OF_SDL_DestroyCond #define SDL_CondSignal IGNORE_THIS_VERSION_OF_SDL_CondSignal #define SDL_CondBroadcast IGNORE_THIS_VERSION_OF_SDL_CondBroadcast #define SDL_CondWait IGNORE_THIS_VERSION_OF_SDL_CondWait #define SDL_CondWaitTimeout IGNORE_THIS_VERSION_OF_SDL_CondWaitTimeout #define SDL_GetPixelFormatName IGNORE_THIS_VERSION_OF_SDL_GetPixelFormatName #define SDL_PixelFormatEnumToMasks IGNORE_THIS_VERSION_OF_SDL_PixelFormatEnumToMasks #define SDL_MasksToPixelFormatEnum IGNORE_THIS_VERSION_OF_SDL_MasksToPixelFormatEnum #define SDL_AllocFormat IGNORE_THIS_VERSION_OF_SDL_AllocFormat #define SDL_FreeFormat IGNORE_THIS_VERSION_OF_SDL_FreeFormat #define SDL_AllocPalette IGNORE_THIS_VERSION_OF_SDL_AllocPalette #define SDL_SetPixelFormatPalette IGNORE_THIS_VERSION_OF_SDL_SetPixelFormatPalette #define SDL_SetPaletteColors IGNORE_THIS_VERSION_OF_SDL_SetPaletteColors #define SDL_FreePalette IGNORE_THIS_VERSION_OF_SDL_FreePalette #define SDL_MapRGB IGNORE_THIS_VERSION_OF_SDL_MapRGB #define SDL_MapRGBA IGNORE_THIS_VERSION_OF_SDL_MapRGBA #define SDL_GetRGB IGNORE_THIS_VERSION_OF_SDL_GetRGB #define SDL_GetRGBA IGNORE_THIS_VERSION_OF_SDL_GetRGBA #define SDL_CalculateGammaRamp IGNORE_THIS_VERSION_OF_SDL_CalculateGammaRamp #define SDL_GetPlatform IGNORE_THIS_VERSION_OF_SDL_GetPlatform #define SDL_GetPowerInfo IGNORE_THIS_VERSION_OF_SDL_GetPowerInfo #define SDL_HasIntersection IGNORE_THIS_VERSION_OF_SDL_HasIntersection #define SDL_IntersectRect IGNORE_THIS_VERSION_OF_SDL_IntersectRect #define SDL_UnionRect IGNORE_THIS_VERSION_OF_SDL_UnionRect #define SDL_EnclosePoints IGNORE_THIS_VERSION_OF_SDL_EnclosePoints #define SDL_IntersectRectAndLine IGNORE_THIS_VERSION_OF_SDL_IntersectRectAndLine #define SDL_GetNumRenderDrivers IGNORE_THIS_VERSION_OF_SDL_GetNumRenderDrivers #define SDL_GetRenderDriverInfo IGNORE_THIS_VERSION_OF_SDL_GetRenderDriverInfo #define SDL_CreateWindowAndRenderer IGNORE_THIS_VERSION_OF_SDL_CreateWindowAndRenderer #define SDL_CreateRenderer IGNORE_THIS_VERSION_OF_SDL_CreateRenderer #define SDL_CreateSoftwareRenderer IGNORE_THIS_VERSION_OF_SDL_CreateSoftwareRenderer #define SDL_GetRenderer IGNORE_THIS_VERSION_OF_SDL_GetRenderer #define SDL_GetRendererInfo IGNORE_THIS_VERSION_OF_SDL_GetRendererInfo #define SDL_GetRendererOutputSize IGNORE_THIS_VERSION_OF_SDL_GetRendererOutputSize #define SDL_CreateTexture IGNORE_THIS_VERSION_OF_SDL_CreateTexture #define SDL_CreateTextureFromSurface IGNORE_THIS_VERSION_OF_SDL_CreateTextureFromSurface #define SDL_QueryTexture IGNORE_THIS_VERSION_OF_SDL_QueryTexture #define SDL_SetTextureColorMod IGNORE_THIS_VERSION_OF_SDL_SetTextureColorMod #define SDL_GetTextureColorMod IGNORE_THIS_VERSION_OF_SDL_GetTextureColorMod #define SDL_SetTextureAlphaMod IGNORE_THIS_VERSION_OF_SDL_SetTextureAlphaMod #define SDL_GetTextureAlphaMod IGNORE_THIS_VERSION_OF_SDL_GetTextureAlphaMod #define SDL_SetTextureBlendMode IGNORE_THIS_VERSION_OF_SDL_SetTextureBlendMode #define SDL_GetTextureBlendMode IGNORE_THIS_VERSION_OF_SDL_GetTextureBlendMode #define SDL_UpdateTexture IGNORE_THIS_VERSION_OF_SDL_UpdateTexture #define SDL_UpdateYUVTexture IGNORE_THIS_VERSION_OF_SDL_UpdateYUVTexture #define SDL_LockTexture IGNORE_THIS_VERSION_OF_SDL_LockTexture #define SDL_UnlockTexture IGNORE_THIS_VERSION_OF_SDL_UnlockTexture #define SDL_RenderTargetSupported IGNORE_THIS_VERSION_OF_SDL_RenderTargetSupported #define SDL_SetRenderTarget IGNORE_THIS_VERSION_OF_SDL_SetRenderTarget #define SDL_GetRenderTarget IGNORE_THIS_VERSION_OF_SDL_GetRenderTarget #define SDL_RenderSetLogicalSize IGNORE_THIS_VERSION_OF_SDL_RenderSetLogicalSize #define SDL_RenderGetLogicalSize IGNORE_THIS_VERSION_OF_SDL_RenderGetLogicalSize #define SDL_RenderSetViewport IGNORE_THIS_VERSION_OF_SDL_RenderSetViewport #define SDL_RenderGetViewport IGNORE_THIS_VERSION_OF_SDL_RenderGetViewport #define SDL_RenderSetClipRect IGNORE_THIS_VERSION_OF_SDL_RenderSetClipRect #define SDL_RenderGetClipRect IGNORE_THIS_VERSION_OF_SDL_RenderGetClipRect #define SDL_RenderSetScale IGNORE_THIS_VERSION_OF_SDL_RenderSetScale #define SDL_RenderGetScale IGNORE_THIS_VERSION_OF_SDL_RenderGetScale #define SDL_SetRenderDrawColor IGNORE_THIS_VERSION_OF_SDL_SetRenderDrawColor #define SDL_GetRenderDrawColor IGNORE_THIS_VERSION_OF_SDL_GetRenderDrawColor #define SDL_SetRenderDrawBlendMode IGNORE_THIS_VERSION_OF_SDL_SetRenderDrawBlendMode #define SDL_GetRenderDrawBlendMode IGNORE_THIS_VERSION_OF_SDL_GetRenderDrawBlendMode #define SDL_RenderClear IGNORE_THIS_VERSION_OF_SDL_RenderClear #define SDL_RenderDrawPoint IGNORE_THIS_VERSION_OF_SDL_RenderDrawPoint #define SDL_RenderDrawPoints IGNORE_THIS_VERSION_OF_SDL_RenderDrawPoints #define SDL_RenderDrawLine IGNORE_THIS_VERSION_OF_SDL_RenderDrawLine #define SDL_RenderDrawLines IGNORE_THIS_VERSION_OF_SDL_RenderDrawLines #define SDL_RenderDrawRect IGNORE_THIS_VERSION_OF_SDL_RenderDrawRect #define SDL_RenderDrawRects IGNORE_THIS_VERSION_OF_SDL_RenderDrawRects #define SDL_RenderFillRect IGNORE_THIS_VERSION_OF_SDL_RenderFillRect #define SDL_RenderFillRects IGNORE_THIS_VERSION_OF_SDL_RenderFillRects #define SDL_RenderCopy IGNORE_THIS_VERSION_OF_SDL_RenderCopy #define SDL_RenderCopyEx IGNORE_THIS_VERSION_OF_SDL_RenderCopyEx #define SDL_RenderReadPixels IGNORE_THIS_VERSION_OF_SDL_RenderReadPixels #define SDL_RenderPresent IGNORE_THIS_VERSION_OF_SDL_RenderPresent #define SDL_DestroyTexture IGNORE_THIS_VERSION_OF_SDL_DestroyTexture #define SDL_DestroyRenderer IGNORE_THIS_VERSION_OF_SDL_DestroyRenderer #define SDL_GL_BindTexture IGNORE_THIS_VERSION_OF_SDL_GL_BindTexture #define SDL_GL_UnbindTexture IGNORE_THIS_VERSION_OF_SDL_GL_UnbindTexture #define SDL_RWFromFile IGNORE_THIS_VERSION_OF_SDL_RWFromFile #define SDL_RWFromMem IGNORE_THIS_VERSION_OF_SDL_RWFromMem #define SDL_RWFromConstMem IGNORE_THIS_VERSION_OF_SDL_RWFromConstMem #define SDL_AllocRW IGNORE_THIS_VERSION_OF_SDL_AllocRW #define SDL_FreeRW IGNORE_THIS_VERSION_OF_SDL_FreeRW #define SDL_ReadU8 IGNORE_THIS_VERSION_OF_SDL_ReadU8 #define SDL_ReadLE16 IGNORE_THIS_VERSION_OF_SDL_ReadLE16 #define SDL_ReadBE16 IGNORE_THIS_VERSION_OF_SDL_ReadBE16 #define SDL_ReadLE32 IGNORE_THIS_VERSION_OF_SDL_ReadLE32 #define SDL_ReadBE32 IGNORE_THIS_VERSION_OF_SDL_ReadBE32 #define SDL_ReadLE64 IGNORE_THIS_VERSION_OF_SDL_ReadLE64 #define SDL_ReadBE64 IGNORE_THIS_VERSION_OF_SDL_ReadBE64 #define SDL_WriteU8 IGNORE_THIS_VERSION_OF_SDL_WriteU8 #define SDL_WriteLE16 IGNORE_THIS_VERSION_OF_SDL_WriteLE16 #define SDL_WriteBE16 IGNORE_THIS_VERSION_OF_SDL_WriteBE16 #define SDL_WriteLE32 IGNORE_THIS_VERSION_OF_SDL_WriteLE32 #define SDL_WriteBE32 IGNORE_THIS_VERSION_OF_SDL_WriteBE32 #define SDL_WriteLE64 IGNORE_THIS_VERSION_OF_SDL_WriteLE64 #define SDL_WriteBE64 IGNORE_THIS_VERSION_OF_SDL_WriteBE64 #define SDL_CreateShapedWindow IGNORE_THIS_VERSION_OF_SDL_CreateShapedWindow #define SDL_IsShapedWindow IGNORE_THIS_VERSION_OF_SDL_IsShapedWindow #define SDL_SetWindowShape IGNORE_THIS_VERSION_OF_SDL_SetWindowShape #define SDL_GetShapedWindowMode IGNORE_THIS_VERSION_OF_SDL_GetShapedWindowMode #define SDL_malloc IGNORE_THIS_VERSION_OF_SDL_malloc #define SDL_calloc IGNORE_THIS_VERSION_OF_SDL_calloc #define SDL_realloc IGNORE_THIS_VERSION_OF_SDL_realloc #define SDL_free IGNORE_THIS_VERSION_OF_SDL_free #define SDL_getenv IGNORE_THIS_VERSION_OF_SDL_getenv #define SDL_setenv IGNORE_THIS_VERSION_OF_SDL_setenv #define SDL_qsort IGNORE_THIS_VERSION_OF_SDL_qsort #define SDL_abs IGNORE_THIS_VERSION_OF_SDL_abs #define SDL_isdigit IGNORE_THIS_VERSION_OF_SDL_isdigit #define SDL_isspace IGNORE_THIS_VERSION_OF_SDL_isspace #define SDL_toupper IGNORE_THIS_VERSION_OF_SDL_toupper #define SDL_tolower IGNORE_THIS_VERSION_OF_SDL_tolower #define SDL_memset IGNORE_THIS_VERSION_OF_SDL_memset #define SDL_memcpy IGNORE_THIS_VERSION_OF_SDL_memcpy #define SDL_memmove IGNORE_THIS_VERSION_OF_SDL_memmove #define SDL_memcmp IGNORE_THIS_VERSION_OF_SDL_memcmp #define SDL_wcslen IGNORE_THIS_VERSION_OF_SDL_wcslen #define SDL_wcslcpy IGNORE_THIS_VERSION_OF_SDL_wcslcpy #define SDL_wcslcat IGNORE_THIS_VERSION_OF_SDL_wcslcat #define SDL_strlen IGNORE_THIS_VERSION_OF_SDL_strlen #define SDL_strlcpy IGNORE_THIS_VERSION_OF_SDL_strlcpy #define SDL_utf8strlcpy IGNORE_THIS_VERSION_OF_SDL_utf8strlcpy #define SDL_strlcat IGNORE_THIS_VERSION_OF_SDL_strlcat #define SDL_strdup IGNORE_THIS_VERSION_OF_SDL_strdup #define SDL_strrev IGNORE_THIS_VERSION_OF_SDL_strrev #define SDL_strupr IGNORE_THIS_VERSION_OF_SDL_strupr #define SDL_strlwr IGNORE_THIS_VERSION_OF_SDL_strlwr #define SDL_strchr IGNORE_THIS_VERSION_OF_SDL_strchr #define SDL_strrchr IGNORE_THIS_VERSION_OF_SDL_strrchr #define SDL_strstr IGNORE_THIS_VERSION_OF_SDL_strstr #define SDL_itoa IGNORE_THIS_VERSION_OF_SDL_itoa #define SDL_uitoa IGNORE_THIS_VERSION_OF_SDL_uitoa #define SDL_ltoa IGNORE_THIS_VERSION_OF_SDL_ltoa #define SDL_ultoa IGNORE_THIS_VERSION_OF_SDL_ultoa #define SDL_lltoa IGNORE_THIS_VERSION_OF_SDL_lltoa #define SDL_ulltoa IGNORE_THIS_VERSION_OF_SDL_ulltoa #define SDL_atoi IGNORE_THIS_VERSION_OF_SDL_atoi #define SDL_atof IGNORE_THIS_VERSION_OF_SDL_atof #define SDL_strtol IGNORE_THIS_VERSION_OF_SDL_strtol #define SDL_strtoul IGNORE_THIS_VERSION_OF_SDL_strtoul #define SDL_strtoll IGNORE_THIS_VERSION_OF_SDL_strtoll #define SDL_strtoull IGNORE_THIS_VERSION_OF_SDL_strtoull #define SDL_strtod IGNORE_THIS_VERSION_OF_SDL_strtod #define SDL_strcmp IGNORE_THIS_VERSION_OF_SDL_strcmp #define SDL_strncmp IGNORE_THIS_VERSION_OF_SDL_strncmp #define SDL_strcasecmp IGNORE_THIS_VERSION_OF_SDL_strcasecmp #define SDL_strncasecmp IGNORE_THIS_VERSION_OF_SDL_strncasecmp #define SDL_vsnprintf IGNORE_THIS_VERSION_OF_SDL_vsnprintf #define SDL_acos IGNORE_THIS_VERSION_OF_SDL_acos #define SDL_asin IGNORE_THIS_VERSION_OF_SDL_asin #define SDL_atan IGNORE_THIS_VERSION_OF_SDL_atan #define SDL_atan2 IGNORE_THIS_VERSION_OF_SDL_atan2 #define SDL_ceil IGNORE_THIS_VERSION_OF_SDL_ceil #define SDL_copysign IGNORE_THIS_VERSION_OF_SDL_copysign #define SDL_cos IGNORE_THIS_VERSION_OF_SDL_cos #define SDL_cosf IGNORE_THIS_VERSION_OF_SDL_cosf #define SDL_fabs IGNORE_THIS_VERSION_OF_SDL_fabs #define SDL_floor IGNORE_THIS_VERSION_OF_SDL_floor #define SDL_log IGNORE_THIS_VERSION_OF_SDL_log #define SDL_pow IGNORE_THIS_VERSION_OF_SDL_pow #define SDL_scalbn IGNORE_THIS_VERSION_OF_SDL_scalbn #define SDL_sin IGNORE_THIS_VERSION_OF_SDL_sin #define SDL_sinf IGNORE_THIS_VERSION_OF_SDL_sinf #define SDL_sqrt IGNORE_THIS_VERSION_OF_SDL_sqrt #define SDL_iconv_open IGNORE_THIS_VERSION_OF_SDL_iconv_open #define SDL_iconv_close IGNORE_THIS_VERSION_OF_SDL_iconv_close #define SDL_iconv IGNORE_THIS_VERSION_OF_SDL_iconv #define SDL_iconv_string IGNORE_THIS_VERSION_OF_SDL_iconv_string #define SDL_CreateRGBSurface IGNORE_THIS_VERSION_OF_SDL_CreateRGBSurface #define SDL_CreateRGBSurfaceFrom IGNORE_THIS_VERSION_OF_SDL_CreateRGBSurfaceFrom #define SDL_FreeSurface IGNORE_THIS_VERSION_OF_SDL_FreeSurface #define SDL_SetSurfacePalette IGNORE_THIS_VERSION_OF_SDL_SetSurfacePalette #define SDL_LockSurface IGNORE_THIS_VERSION_OF_SDL_LockSurface #define SDL_UnlockSurface IGNORE_THIS_VERSION_OF_SDL_UnlockSurface #define SDL_LoadBMP_RW IGNORE_THIS_VERSION_OF_SDL_LoadBMP_RW #define SDL_SaveBMP_RW IGNORE_THIS_VERSION_OF_SDL_SaveBMP_RW #define SDL_SetSurfaceRLE IGNORE_THIS_VERSION_OF_SDL_SetSurfaceRLE #define SDL_SetColorKey IGNORE_THIS_VERSION_OF_SDL_SetColorKey #define SDL_GetColorKey IGNORE_THIS_VERSION_OF_SDL_GetColorKey #define SDL_SetSurfaceColorMod IGNORE_THIS_VERSION_OF_SDL_SetSurfaceColorMod #define SDL_GetSurfaceColorMod IGNORE_THIS_VERSION_OF_SDL_GetSurfaceColorMod #define SDL_SetSurfaceAlphaMod IGNORE_THIS_VERSION_OF_SDL_SetSurfaceAlphaMod #define SDL_GetSurfaceAlphaMod IGNORE_THIS_VERSION_OF_SDL_GetSurfaceAlphaMod #define SDL_SetSurfaceBlendMode IGNORE_THIS_VERSION_OF_SDL_SetSurfaceBlendMode #define SDL_GetSurfaceBlendMode IGNORE_THIS_VERSION_OF_SDL_GetSurfaceBlendMode #define SDL_SetClipRect IGNORE_THIS_VERSION_OF_SDL_SetClipRect #define SDL_GetClipRect IGNORE_THIS_VERSION_OF_SDL_GetClipRect #define SDL_ConvertSurface IGNORE_THIS_VERSION_OF_SDL_ConvertSurface #define SDL_ConvertSurfaceFormat IGNORE_THIS_VERSION_OF_SDL_ConvertSurfaceFormat #define SDL_ConvertPixels IGNORE_THIS_VERSION_OF_SDL_ConvertPixels #define SDL_FillRect IGNORE_THIS_VERSION_OF_SDL_FillRect #define SDL_FillRects IGNORE_THIS_VERSION_OF_SDL_FillRects #define SDL_UpperBlit IGNORE_THIS_VERSION_OF_SDL_UpperBlit #define SDL_LowerBlit IGNORE_THIS_VERSION_OF_SDL_LowerBlit #define SDL_SoftStretch IGNORE_THIS_VERSION_OF_SDL_SoftStretch #define SDL_UpperBlitScaled IGNORE_THIS_VERSION_OF_SDL_UpperBlitScaled #define SDL_LowerBlitScaled IGNORE_THIS_VERSION_OF_SDL_LowerBlitScaled #define SDL_GetWindowWMInfo IGNORE_THIS_VERSION_OF_SDL_GetWindowWMInfo #define SDL_GetThreadName IGNORE_THIS_VERSION_OF_SDL_GetThreadName #define SDL_ThreadID IGNORE_THIS_VERSION_OF_SDL_ThreadID #define SDL_GetThreadID IGNORE_THIS_VERSION_OF_SDL_GetThreadID #define SDL_SetThreadPriority IGNORE_THIS_VERSION_OF_SDL_SetThreadPriority #define SDL_WaitThread IGNORE_THIS_VERSION_OF_SDL_WaitThread #define SDL_DetachThread IGNORE_THIS_VERSION_OF_SDL_DetachThread #define SDL_TLSCreate IGNORE_THIS_VERSION_OF_SDL_TLSCreate #define SDL_TLSGet IGNORE_THIS_VERSION_OF_SDL_TLSGet #define SDL_TLSSet IGNORE_THIS_VERSION_OF_SDL_TLSSet #define SDL_GetTicks IGNORE_THIS_VERSION_OF_SDL_GetTicks #define SDL_GetPerformanceCounter IGNORE_THIS_VERSION_OF_SDL_GetPerformanceCounter #define SDL_GetPerformanceFrequency IGNORE_THIS_VERSION_OF_SDL_GetPerformanceFrequency #define SDL_Delay IGNORE_THIS_VERSION_OF_SDL_Delay #define SDL_AddTimer IGNORE_THIS_VERSION_OF_SDL_AddTimer #define SDL_RemoveTimer IGNORE_THIS_VERSION_OF_SDL_RemoveTimer #define SDL_GetNumTouchDevices IGNORE_THIS_VERSION_OF_SDL_GetNumTouchDevices #define SDL_GetTouchDevice IGNORE_THIS_VERSION_OF_SDL_GetTouchDevice #define SDL_GetNumTouchFingers IGNORE_THIS_VERSION_OF_SDL_GetNumTouchFingers #define SDL_GetTouchFinger IGNORE_THIS_VERSION_OF_SDL_GetTouchFinger #define SDL_GetVersion IGNORE_THIS_VERSION_OF_SDL_GetVersion #define SDL_GetRevision IGNORE_THIS_VERSION_OF_SDL_GetRevision #define SDL_GetRevisionNumber IGNORE_THIS_VERSION_OF_SDL_GetRevisionNumber #define SDL_GetNumVideoDrivers IGNORE_THIS_VERSION_OF_SDL_GetNumVideoDrivers #define SDL_GetVideoDriver IGNORE_THIS_VERSION_OF_SDL_GetVideoDriver #define SDL_VideoInit IGNORE_THIS_VERSION_OF_SDL_VideoInit #define SDL_VideoQuit IGNORE_THIS_VERSION_OF_SDL_VideoQuit #define SDL_GetCurrentVideoDriver IGNORE_THIS_VERSION_OF_SDL_GetCurrentVideoDriver #define SDL_GetNumVideoDisplays IGNORE_THIS_VERSION_OF_SDL_GetNumVideoDisplays #define SDL_GetDisplayName IGNORE_THIS_VERSION_OF_SDL_GetDisplayName #define SDL_GetDisplayBounds IGNORE_THIS_VERSION_OF_SDL_GetDisplayBounds #define SDL_GetDisplayDPI IGNORE_THIS_VERSION_OF_SDL_GetDisplayDPI #define SDL_GetNumDisplayModes IGNORE_THIS_VERSION_OF_SDL_GetNumDisplayModes #define SDL_GetDisplayMode IGNORE_THIS_VERSION_OF_SDL_GetDisplayMode #define SDL_GetDesktopDisplayMode IGNORE_THIS_VERSION_OF_SDL_GetDesktopDisplayMode #define SDL_GetCurrentDisplayMode IGNORE_THIS_VERSION_OF_SDL_GetCurrentDisplayMode #define SDL_GetClosestDisplayMode IGNORE_THIS_VERSION_OF_SDL_GetClosestDisplayMode #define SDL_GetWindowDisplayIndex IGNORE_THIS_VERSION_OF_SDL_GetWindowDisplayIndex #define SDL_SetWindowDisplayMode IGNORE_THIS_VERSION_OF_SDL_SetWindowDisplayMode #define SDL_GetWindowDisplayMode IGNORE_THIS_VERSION_OF_SDL_GetWindowDisplayMode #define SDL_GetWindowPixelFormat IGNORE_THIS_VERSION_OF_SDL_GetWindowPixelFormat #define SDL_CreateWindow IGNORE_THIS_VERSION_OF_SDL_CreateWindow #define SDL_CreateWindowFrom IGNORE_THIS_VERSION_OF_SDL_CreateWindowFrom #define SDL_GetWindowID IGNORE_THIS_VERSION_OF_SDL_GetWindowID #define SDL_GetWindowFromID IGNORE_THIS_VERSION_OF_SDL_GetWindowFromID #define SDL_GetWindowFlags IGNORE_THIS_VERSION_OF_SDL_GetWindowFlags #define SDL_SetWindowTitle IGNORE_THIS_VERSION_OF_SDL_SetWindowTitle #define SDL_GetWindowTitle IGNORE_THIS_VERSION_OF_SDL_GetWindowTitle #define SDL_SetWindowIcon IGNORE_THIS_VERSION_OF_SDL_SetWindowIcon #define SDL_SetWindowData IGNORE_THIS_VERSION_OF_SDL_SetWindowData #define SDL_GetWindowData IGNORE_THIS_VERSION_OF_SDL_GetWindowData #define SDL_SetWindowPosition IGNORE_THIS_VERSION_OF_SDL_SetWindowPosition #define SDL_GetWindowPosition IGNORE_THIS_VERSION_OF_SDL_GetWindowPosition #define SDL_SetWindowSize IGNORE_THIS_VERSION_OF_SDL_SetWindowSize #define SDL_GetWindowSize IGNORE_THIS_VERSION_OF_SDL_GetWindowSize #define SDL_SetWindowMinimumSize IGNORE_THIS_VERSION_OF_SDL_SetWindowMinimumSize #define SDL_GetWindowMinimumSize IGNORE_THIS_VERSION_OF_SDL_GetWindowMinimumSize #define SDL_SetWindowMaximumSize IGNORE_THIS_VERSION_OF_SDL_SetWindowMaximumSize #define SDL_GetWindowMaximumSize IGNORE_THIS_VERSION_OF_SDL_GetWindowMaximumSize #define SDL_SetWindowBordered IGNORE_THIS_VERSION_OF_SDL_SetWindowBordered #define SDL_ShowWindow IGNORE_THIS_VERSION_OF_SDL_ShowWindow #define SDL_HideWindow IGNORE_THIS_VERSION_OF_SDL_HideWindow #define SDL_RaiseWindow IGNORE_THIS_VERSION_OF_SDL_RaiseWindow #define SDL_MaximizeWindow IGNORE_THIS_VERSION_OF_SDL_MaximizeWindow #define SDL_MinimizeWindow IGNORE_THIS_VERSION_OF_SDL_MinimizeWindow #define SDL_RestoreWindow IGNORE_THIS_VERSION_OF_SDL_RestoreWindow #define SDL_SetWindowFullscreen IGNORE_THIS_VERSION_OF_SDL_SetWindowFullscreen #define SDL_GetWindowSurface IGNORE_THIS_VERSION_OF_SDL_GetWindowSurface #define SDL_UpdateWindowSurface IGNORE_THIS_VERSION_OF_SDL_UpdateWindowSurface #define SDL_UpdateWindowSurfaceRects IGNORE_THIS_VERSION_OF_SDL_UpdateWindowSurfaceRects #define SDL_SetWindowGrab IGNORE_THIS_VERSION_OF_SDL_SetWindowGrab #define SDL_GetWindowGrab IGNORE_THIS_VERSION_OF_SDL_GetWindowGrab #define SDL_SetWindowBrightness IGNORE_THIS_VERSION_OF_SDL_SetWindowBrightness #define SDL_GetWindowBrightness IGNORE_THIS_VERSION_OF_SDL_GetWindowBrightness #define SDL_SetWindowGammaRamp IGNORE_THIS_VERSION_OF_SDL_SetWindowGammaRamp #define SDL_GetWindowGammaRamp IGNORE_THIS_VERSION_OF_SDL_GetWindowGammaRamp #define SDL_DestroyWindow IGNORE_THIS_VERSION_OF_SDL_DestroyWindow #define SDL_IsScreenSaverEnabled IGNORE_THIS_VERSION_OF_SDL_IsScreenSaverEnabled #define SDL_EnableScreenSaver IGNORE_THIS_VERSION_OF_SDL_EnableScreenSaver #define SDL_DisableScreenSaver IGNORE_THIS_VERSION_OF_SDL_DisableScreenSaver #define SDL_GL_LoadLibrary IGNORE_THIS_VERSION_OF_SDL_GL_LoadLibrary #define SDL_GL_GetProcAddress IGNORE_THIS_VERSION_OF_SDL_GL_GetProcAddress #define SDL_GL_UnloadLibrary IGNORE_THIS_VERSION_OF_SDL_GL_UnloadLibrary #define SDL_GL_ExtensionSupported IGNORE_THIS_VERSION_OF_SDL_GL_ExtensionSupported #define SDL_GL_SetAttribute IGNORE_THIS_VERSION_OF_SDL_GL_SetAttribute #define SDL_GL_GetAttribute IGNORE_THIS_VERSION_OF_SDL_GL_GetAttribute #define SDL_GL_CreateContext IGNORE_THIS_VERSION_OF_SDL_GL_CreateContext #define SDL_GL_MakeCurrent IGNORE_THIS_VERSION_OF_SDL_GL_MakeCurrent #define SDL_GL_GetCurrentWindow IGNORE_THIS_VERSION_OF_SDL_GL_GetCurrentWindow #define SDL_GL_GetCurrentContext IGNORE_THIS_VERSION_OF_SDL_GL_GetCurrentContext #define SDL_GL_GetDrawableSize IGNORE_THIS_VERSION_OF_SDL_GL_GetDrawableSize #define SDL_GL_SetSwapInterval IGNORE_THIS_VERSION_OF_SDL_GL_SetSwapInterval #define SDL_GL_GetSwapInterval IGNORE_THIS_VERSION_OF_SDL_GL_GetSwapInterval #define SDL_GL_SwapWindow IGNORE_THIS_VERSION_OF_SDL_GL_SwapWindow #define SDL_GL_DeleteContext IGNORE_THIS_VERSION_OF_SDL_GL_DeleteContext #define SDL_vsscanf IGNORE_THIS_VERSION_OF_SDL_vsscanf #define SDL_GameControllerAddMappingsFromRW IGNORE_THIS_VERSION_OF_SDL_GameControllerAddMappingsFromRW #define SDL_GL_ResetAttributes IGNORE_THIS_VERSION_OF_SDL_GL_ResetAttributes #define SDL_HasAVX IGNORE_THIS_VERSION_OF_SDL_HasAVX #define SDL_GetDefaultAssertionHandler IGNORE_THIS_VERSION_OF_SDL_GetDefaultAssertionHandler #define SDL_GetAssertionHandler IGNORE_THIS_VERSION_OF_SDL_GetAssertionHandler #define SDL_DXGIGetOutputInfo IGNORE_THIS_VERSION_OF_SDL_DXGIGetOutputInfo #define SDL_RenderIsClipEnabled IGNORE_THIS_VERSION_OF_SDL_RenderIsClipEnabled #define SDL_WinRTRunApp IGNORE_THIS_VERSION_OF_SDL_WinRTRunApp #define SDL_WarpMouseGlobal IGNORE_THIS_VERSION_OF_SDL_WarpMouseGlobal #define SDL_WinRTGetFSPathUNICODE IGNORE_THIS_VERSION_OF_SDL_WinRTGetFSPathUNICODE #define SDL_WinRTGetFSPathUTF8 IGNORE_THIS_VERSION_OF_SDL_WinRTGetFSPathUTF8 #define SDL_sqrtf IGNORE_THIS_VERSION_OF_SDL_sqrtf #define SDL_tan IGNORE_THIS_VERSION_OF_SDL_tan #define SDL_tanf IGNORE_THIS_VERSION_OF_SDL_tanf #define SDL_CaptureMouse IGNORE_THIS_VERSION_OF_SDL_CaptureMouse #define SDL_SetWindowHitTest IGNORE_THIS_VERSION_OF_SDL_SetWindowHitTest #define SDL_GetGlobalMouseState IGNORE_THIS_VERSION_OF_SDL_GetGlobalMouseState #define SDL_HasAVX2 IGNORE_THIS_VERSION_OF_SDL_HasAVX2 #define SDL_QueueAudio IGNORE_THIS_VERSION_OF_SDL_QueueAudio #define SDL_GetQueuedAudioSize IGNORE_THIS_VERSION_OF_SDL_GetQueuedAudioSize #define SDL_ClearQueuedAudio IGNORE_THIS_VERSION_OF_SDL_ClearQueuedAudio #define SDL_GetGrabbedWindow IGNORE_THIS_VERSION_OF_SDL_GetGrabbedWindow #define SDL_SetWindowsMessageHook IGNORE_THIS_VERSION_OF_SDL_SetWindowsMessageHook #define SDL_JoystickCurrentPowerLevel IGNORE_THIS_VERSION_OF_SDL_JoystickCurrentPowerLevel #define SDL_GameControllerFromInstanceID IGNORE_THIS_VERSION_OF_SDL_GameControllerFromInstanceID #define SDL_JoystickFromInstanceID IGNORE_THIS_VERSION_OF_SDL_JoystickFromInstanceID #define SDL_GetDisplayUsableBounds IGNORE_THIS_VERSION_OF_SDL_GetDisplayUsableBounds #define SDL_GetWindowBordersSize IGNORE_THIS_VERSION_OF_SDL_GetWindowBordersSize #define SDL_SetWindowOpacity IGNORE_THIS_VERSION_OF_SDL_SetWindowOpacity #define SDL_GetWindowOpacity IGNORE_THIS_VERSION_OF_SDL_GetWindowOpacity #define SDL_SetWindowInputFocus IGNORE_THIS_VERSION_OF_SDL_SetWindowInputFocus #define SDL_SetWindowModalFor IGNORE_THIS_VERSION_OF_SDL_SetWindowModalFor #define SDL_RenderSetIntegerScale IGNORE_THIS_VERSION_OF_SDL_RenderSetIntegerScale #define SDL_RenderGetIntegerScale IGNORE_THIS_VERSION_OF_SDL_RenderGetIntegerScale #define SDL_DequeueAudio IGNORE_THIS_VERSION_OF_SDL_DequeueAudio #define SDL_SetWindowResizable IGNORE_THIS_VERSION_OF_SDL_SetWindowResizable #define SDL_CreateRGBSurfaceWithFormat IGNORE_THIS_VERSION_OF_SDL_CreateRGBSurfaceWithFormat #define SDL_CreateRGBSurfaceWithFormatFrom IGNORE_THIS_VERSION_OF_SDL_CreateRGBSurfaceWithFormatFrom #define SDL_GetHintBoolean IGNORE_THIS_VERSION_OF_SDL_GetHintBoolean #define SDL_JoystickGetDeviceVendor IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceVendor #define SDL_JoystickGetDeviceProduct IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceProduct #define SDL_JoystickGetDeviceProductVersion IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceProductVersion #define SDL_JoystickGetVendor IGNORE_THIS_VERSION_OF_SDL_JoystickGetVendor #define SDL_JoystickGetProduct IGNORE_THIS_VERSION_OF_SDL_JoystickGetProduct #define SDL_JoystickGetProductVersion IGNORE_THIS_VERSION_OF_SDL_JoystickGetProductVersion #define SDL_GameControllerGetVendor IGNORE_THIS_VERSION_OF_SDL_GameControllerGetVendor #define SDL_GameControllerGetProduct IGNORE_THIS_VERSION_OF_SDL_GameControllerGetProduct #define SDL_GameControllerGetProductVersion IGNORE_THIS_VERSION_OF_SDL_GameControllerGetProductVersion #define SDL_HasNEON IGNORE_THIS_VERSION_OF_SDL_HasNEON #define SDL_GameControllerNumMappings IGNORE_THIS_VERSION_OF_SDL_GameControllerNumMappings #define SDL_GameControllerMappingForIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerMappingForIndex #define SDL_JoystickGetAxisInitialState IGNORE_THIS_VERSION_OF_SDL_JoystickGetAxisInitialState #define SDL_JoystickGetDeviceType IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceType #define SDL_JoystickGetType IGNORE_THIS_VERSION_OF_SDL_JoystickGetType #define SDL_MemoryBarrierReleaseFunction IGNORE_THIS_VERSION_OF_SDL_MemoryBarrierReleaseFunction #define SDL_MemoryBarrierAcquireFunction IGNORE_THIS_VERSION_OF_SDL_MemoryBarrierAcquireFunction #define SDL_JoystickGetDeviceInstanceID IGNORE_THIS_VERSION_OF_SDL_JoystickGetDeviceInstanceID #define SDL_utf8strlen IGNORE_THIS_VERSION_OF_SDL_utf8strlen #define SDL_LoadFile_RW IGNORE_THIS_VERSION_OF_SDL_LoadFile_RW #define SDL_wcscmp IGNORE_THIS_VERSION_OF_SDL_wcscmp #define SDL_ComposeCustomBlendMode IGNORE_THIS_VERSION_OF_SDL_ComposeCustomBlendMode #define SDL_DuplicateSurface IGNORE_THIS_VERSION_OF_SDL_DuplicateSurface #define SDL_Vulkan_LoadLibrary IGNORE_THIS_VERSION_OF_SDL_Vulkan_LoadLibrary #define SDL_Vulkan_GetVkGetInstanceProcAddr IGNORE_THIS_VERSION_OF_SDL_Vulkan_GetVkGetInstanceProcAddr #define SDL_Vulkan_UnloadLibrary IGNORE_THIS_VERSION_OF_SDL_Vulkan_UnloadLibrary #define SDL_Vulkan_GetInstanceExtensions IGNORE_THIS_VERSION_OF_SDL_Vulkan_GetInstanceExtensions #define SDL_Vulkan_CreateSurface IGNORE_THIS_VERSION_OF_SDL_Vulkan_CreateSurface #define SDL_Vulkan_GetDrawableSize IGNORE_THIS_VERSION_OF_SDL_Vulkan_GetDrawableSize #define SDL_LockJoysticks IGNORE_THIS_VERSION_OF_SDL_LockJoysticks #define SDL_UnlockJoysticks IGNORE_THIS_VERSION_OF_SDL_UnlockJoysticks #define SDL_GetMemoryFunctions IGNORE_THIS_VERSION_OF_SDL_GetMemoryFunctions #define SDL_SetMemoryFunctions IGNORE_THIS_VERSION_OF_SDL_SetMemoryFunctions #define SDL_GetNumAllocations IGNORE_THIS_VERSION_OF_SDL_GetNumAllocations #define SDL_NewAudioStream IGNORE_THIS_VERSION_OF_SDL_NewAudioStream #define SDL_AudioStreamPut IGNORE_THIS_VERSION_OF_SDL_AudioStreamPut #define SDL_AudioStreamGet IGNORE_THIS_VERSION_OF_SDL_AudioStreamGet #define SDL_AudioStreamClear IGNORE_THIS_VERSION_OF_SDL_AudioStreamClear #define SDL_AudioStreamAvailable IGNORE_THIS_VERSION_OF_SDL_AudioStreamAvailable #define SDL_FreeAudioStream IGNORE_THIS_VERSION_OF_SDL_FreeAudioStream #define SDL_AudioStreamFlush IGNORE_THIS_VERSION_OF_SDL_AudioStreamFlush #define SDL_acosf IGNORE_THIS_VERSION_OF_SDL_acosf #define SDL_asinf IGNORE_THIS_VERSION_OF_SDL_asinf #define SDL_atanf IGNORE_THIS_VERSION_OF_SDL_atanf #define SDL_atan2f IGNORE_THIS_VERSION_OF_SDL_atan2f #define SDL_ceilf IGNORE_THIS_VERSION_OF_SDL_ceilf #define SDL_copysignf IGNORE_THIS_VERSION_OF_SDL_copysignf #define SDL_fabsf IGNORE_THIS_VERSION_OF_SDL_fabsf #define SDL_floorf IGNORE_THIS_VERSION_OF_SDL_floorf #define SDL_logf IGNORE_THIS_VERSION_OF_SDL_logf #define SDL_powf IGNORE_THIS_VERSION_OF_SDL_powf #define SDL_scalbnf IGNORE_THIS_VERSION_OF_SDL_scalbnf #define SDL_fmod IGNORE_THIS_VERSION_OF_SDL_fmod #define SDL_fmodf IGNORE_THIS_VERSION_OF_SDL_fmodf #define SDL_SetYUVConversionMode IGNORE_THIS_VERSION_OF_SDL_SetYUVConversionMode #define SDL_GetYUVConversionMode IGNORE_THIS_VERSION_OF_SDL_GetYUVConversionMode #define SDL_GetYUVConversionModeForResolution IGNORE_THIS_VERSION_OF_SDL_GetYUVConversionModeForResolution #define SDL_RenderGetMetalLayer IGNORE_THIS_VERSION_OF_SDL_RenderGetMetalLayer #define SDL_RenderGetMetalCommandEncoder IGNORE_THIS_VERSION_OF_SDL_RenderGetMetalCommandEncoder #define SDL_IsAndroidTV IGNORE_THIS_VERSION_OF_SDL_IsAndroidTV #define SDL_WinRTGetDeviceFamily IGNORE_THIS_VERSION_OF_SDL_WinRTGetDeviceFamily #define SDL_log10 IGNORE_THIS_VERSION_OF_SDL_log10 #define SDL_log10f IGNORE_THIS_VERSION_OF_SDL_log10f #define SDL_GameControllerMappingForDeviceIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerMappingForDeviceIndex #define SDL_LinuxSetThreadPriority IGNORE_THIS_VERSION_OF_SDL_LinuxSetThreadPriority #define SDL_HasAVX512F IGNORE_THIS_VERSION_OF_SDL_HasAVX512F #define SDL_IsChromebook IGNORE_THIS_VERSION_OF_SDL_IsChromebook #define SDL_IsDeXMode IGNORE_THIS_VERSION_OF_SDL_IsDeXMode #define SDL_AndroidBackButton IGNORE_THIS_VERSION_OF_SDL_AndroidBackButton #define SDL_exp IGNORE_THIS_VERSION_OF_SDL_exp #define SDL_expf IGNORE_THIS_VERSION_OF_SDL_expf #define SDL_wcsdup IGNORE_THIS_VERSION_OF_SDL_wcsdup #define SDL_GameControllerRumble IGNORE_THIS_VERSION_OF_SDL_GameControllerRumble #define SDL_JoystickRumble IGNORE_THIS_VERSION_OF_SDL_JoystickRumble #define SDL_NumSensors IGNORE_THIS_VERSION_OF_SDL_NumSensors #define SDL_SensorGetDeviceName IGNORE_THIS_VERSION_OF_SDL_SensorGetDeviceName #define SDL_SensorGetDeviceType IGNORE_THIS_VERSION_OF_SDL_SensorGetDeviceType #define SDL_SensorGetDeviceNonPortableType IGNORE_THIS_VERSION_OF_SDL_SensorGetDeviceNonPortableType #define SDL_SensorGetDeviceInstanceID IGNORE_THIS_VERSION_OF_SDL_SensorGetDeviceInstanceID #define SDL_SensorOpen IGNORE_THIS_VERSION_OF_SDL_SensorOpen #define SDL_SensorFromInstanceID IGNORE_THIS_VERSION_OF_SDL_SensorFromInstanceID #define SDL_SensorGetName IGNORE_THIS_VERSION_OF_SDL_SensorGetName #define SDL_SensorGetType IGNORE_THIS_VERSION_OF_SDL_SensorGetType #define SDL_SensorGetNonPortableType IGNORE_THIS_VERSION_OF_SDL_SensorGetNonPortableType #define SDL_SensorGetInstanceID IGNORE_THIS_VERSION_OF_SDL_SensorGetInstanceID #define SDL_SensorGetData IGNORE_THIS_VERSION_OF_SDL_SensorGetData #define SDL_SensorClose IGNORE_THIS_VERSION_OF_SDL_SensorClose #define SDL_SensorUpdate IGNORE_THIS_VERSION_OF_SDL_SensorUpdate #define SDL_IsTablet IGNORE_THIS_VERSION_OF_SDL_IsTablet #define SDL_GetDisplayOrientation IGNORE_THIS_VERSION_OF_SDL_GetDisplayOrientation #define SDL_HasColorKey IGNORE_THIS_VERSION_OF_SDL_HasColorKey #define SDL_CreateThreadWithStackSize IGNORE_THIS_VERSION_OF_SDL_CreateThreadWithStackSize #define SDL_JoystickGetDevicePlayerIndex IGNORE_THIS_VERSION_OF_SDL_JoystickGetDevicePlayerIndex #define SDL_JoystickGetPlayerIndex IGNORE_THIS_VERSION_OF_SDL_JoystickGetPlayerIndex #define SDL_GameControllerGetPlayerIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerGetPlayerIndex #define SDL_RenderFlush IGNORE_THIS_VERSION_OF_SDL_RenderFlush #define SDL_RenderDrawPointF IGNORE_THIS_VERSION_OF_SDL_RenderDrawPointF #define SDL_RenderDrawPointsF IGNORE_THIS_VERSION_OF_SDL_RenderDrawPointsF #define SDL_RenderDrawLineF IGNORE_THIS_VERSION_OF_SDL_RenderDrawLineF #define SDL_RenderDrawLinesF IGNORE_THIS_VERSION_OF_SDL_RenderDrawLinesF #define SDL_RenderDrawRectF IGNORE_THIS_VERSION_OF_SDL_RenderDrawRectF #define SDL_RenderDrawRectsF IGNORE_THIS_VERSION_OF_SDL_RenderDrawRectsF #define SDL_RenderFillRectF IGNORE_THIS_VERSION_OF_SDL_RenderFillRectF #define SDL_RenderFillRectsF IGNORE_THIS_VERSION_OF_SDL_RenderFillRectsF #define SDL_RenderCopyF IGNORE_THIS_VERSION_OF_SDL_RenderCopyF #define SDL_RenderCopyExF IGNORE_THIS_VERSION_OF_SDL_RenderCopyExF #define SDL_GetTouchDeviceType IGNORE_THIS_VERSION_OF_SDL_GetTouchDeviceType #define SDL_UIKitRunApp IGNORE_THIS_VERSION_OF_SDL_UIKitRunApp #define SDL_SIMDGetAlignment IGNORE_THIS_VERSION_OF_SDL_SIMDGetAlignment #define SDL_SIMDAlloc IGNORE_THIS_VERSION_OF_SDL_SIMDAlloc #define SDL_SIMDFree IGNORE_THIS_VERSION_OF_SDL_SIMDFree #define SDL_RWsize IGNORE_THIS_VERSION_OF_SDL_RWsize #define SDL_RWseek IGNORE_THIS_VERSION_OF_SDL_RWseek #define SDL_RWtell IGNORE_THIS_VERSION_OF_SDL_RWtell #define SDL_RWread IGNORE_THIS_VERSION_OF_SDL_RWread #define SDL_RWwrite IGNORE_THIS_VERSION_OF_SDL_RWwrite #define SDL_RWclose IGNORE_THIS_VERSION_OF_SDL_RWclose #define SDL_LoadFile IGNORE_THIS_VERSION_OF_SDL_LoadFile #define SDL_Metal_CreateView IGNORE_THIS_VERSION_OF_SDL_Metal_CreateView #define SDL_Metal_DestroyView IGNORE_THIS_VERSION_OF_SDL_Metal_DestroyView #define SDL_LockTextureToSurface IGNORE_THIS_VERSION_OF_SDL_LockTextureToSurface #define SDL_HasARMSIMD IGNORE_THIS_VERSION_OF_SDL_HasARMSIMD #define SDL_strtokr IGNORE_THIS_VERSION_OF_SDL_strtokr #define SDL_wcsstr IGNORE_THIS_VERSION_OF_SDL_wcsstr #define SDL_wcsncmp IGNORE_THIS_VERSION_OF_SDL_wcsncmp #define SDL_GameControllerTypeForIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerTypeForIndex #define SDL_GameControllerGetType IGNORE_THIS_VERSION_OF_SDL_GameControllerGetType #define SDL_GameControllerFromPlayerIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerFromPlayerIndex #define SDL_GameControllerSetPlayerIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerSetPlayerIndex #define SDL_JoystickFromPlayerIndex IGNORE_THIS_VERSION_OF_SDL_JoystickFromPlayerIndex #define SDL_JoystickSetPlayerIndex IGNORE_THIS_VERSION_OF_SDL_JoystickSetPlayerIndex #define SDL_SetTextureScaleMode IGNORE_THIS_VERSION_OF_SDL_SetTextureScaleMode #define SDL_GetTextureScaleMode IGNORE_THIS_VERSION_OF_SDL_GetTextureScaleMode #define SDL_OnApplicationWillTerminate IGNORE_THIS_VERSION_OF_SDL_OnApplicationWillTerminate #define SDL_OnApplicationDidReceiveMemoryWarning IGNORE_THIS_VERSION_OF_SDL_OnApplicationDidReceiveMemoryWarning #define SDL_OnApplicationWillResignActive IGNORE_THIS_VERSION_OF_SDL_OnApplicationWillResignActive #define SDL_OnApplicationDidEnterBackground IGNORE_THIS_VERSION_OF_SDL_OnApplicationDidEnterBackground #define SDL_OnApplicationWillEnterForeground IGNORE_THIS_VERSION_OF_SDL_OnApplicationWillEnterForeground #define SDL_OnApplicationDidBecomeActive IGNORE_THIS_VERSION_OF_SDL_OnApplicationDidBecomeActive #define SDL_OnApplicationDidChangeStatusBarOrientation IGNORE_THIS_VERSION_OF_SDL_OnApplicationDidChangeStatusBarOrientation #define SDL_GetAndroidSDKVersion IGNORE_THIS_VERSION_OF_SDL_GetAndroidSDKVersion #define SDL_isupper IGNORE_THIS_VERSION_OF_SDL_isupper #define SDL_islower IGNORE_THIS_VERSION_OF_SDL_islower #define SDL_JoystickAttachVirtual IGNORE_THIS_VERSION_OF_SDL_JoystickAttachVirtual #define SDL_JoystickDetachVirtual IGNORE_THIS_VERSION_OF_SDL_JoystickDetachVirtual #define SDL_JoystickIsVirtual IGNORE_THIS_VERSION_OF_SDL_JoystickIsVirtual #define SDL_JoystickSetVirtualAxis IGNORE_THIS_VERSION_OF_SDL_JoystickSetVirtualAxis #define SDL_JoystickSetVirtualButton IGNORE_THIS_VERSION_OF_SDL_JoystickSetVirtualButton #define SDL_JoystickSetVirtualHat IGNORE_THIS_VERSION_OF_SDL_JoystickSetVirtualHat #define SDL_GetErrorMsg IGNORE_THIS_VERSION_OF_SDL_GetErrorMsg #define SDL_LockSensors IGNORE_THIS_VERSION_OF_SDL_LockSensors #define SDL_UnlockSensors IGNORE_THIS_VERSION_OF_SDL_UnlockSensors #define SDL_Metal_GetLayer IGNORE_THIS_VERSION_OF_SDL_Metal_GetLayer #define SDL_Metal_GetDrawableSize IGNORE_THIS_VERSION_OF_SDL_Metal_GetDrawableSize #define SDL_trunc IGNORE_THIS_VERSION_OF_SDL_trunc #define SDL_truncf IGNORE_THIS_VERSION_OF_SDL_truncf #define SDL_GetPreferredLocales IGNORE_THIS_VERSION_OF_SDL_GetPreferredLocales #define SDL_SIMDRealloc IGNORE_THIS_VERSION_OF_SDL_SIMDRealloc #define SDL_AndroidRequestPermission IGNORE_THIS_VERSION_OF_SDL_AndroidRequestPermission #define SDL_OpenURL IGNORE_THIS_VERSION_OF_SDL_OpenURL #define SDL_HasSurfaceRLE IGNORE_THIS_VERSION_OF_SDL_HasSurfaceRLE #define SDL_GameControllerHasLED IGNORE_THIS_VERSION_OF_SDL_GameControllerHasLED #define SDL_GameControllerSetLED IGNORE_THIS_VERSION_OF_SDL_GameControllerSetLED #define SDL_JoystickHasLED IGNORE_THIS_VERSION_OF_SDL_JoystickHasLED #define SDL_JoystickSetLED IGNORE_THIS_VERSION_OF_SDL_JoystickSetLED #define SDL_GameControllerRumbleTriggers IGNORE_THIS_VERSION_OF_SDL_GameControllerRumbleTriggers #define SDL_JoystickRumbleTriggers IGNORE_THIS_VERSION_OF_SDL_JoystickRumbleTriggers #define SDL_GameControllerHasAxis IGNORE_THIS_VERSION_OF_SDL_GameControllerHasAxis #define SDL_GameControllerHasButton IGNORE_THIS_VERSION_OF_SDL_GameControllerHasButton #define SDL_GameControllerGetNumTouchpads IGNORE_THIS_VERSION_OF_SDL_GameControllerGetNumTouchpads #define SDL_GameControllerGetNumTouchpadFingers IGNORE_THIS_VERSION_OF_SDL_GameControllerGetNumTouchpadFingers #define SDL_GameControllerGetTouchpadFinger IGNORE_THIS_VERSION_OF_SDL_GameControllerGetTouchpadFinger #define SDL_crc32 IGNORE_THIS_VERSION_OF_SDL_crc32 #define SDL_GameControllerGetSerial IGNORE_THIS_VERSION_OF_SDL_GameControllerGetSerial #define SDL_JoystickGetSerial IGNORE_THIS_VERSION_OF_SDL_JoystickGetSerial #define SDL_GameControllerHasSensor IGNORE_THIS_VERSION_OF_SDL_GameControllerHasSensor #define SDL_GameControllerSetSensorEnabled IGNORE_THIS_VERSION_OF_SDL_GameControllerSetSensorEnabled #define SDL_GameControllerIsSensorEnabled IGNORE_THIS_VERSION_OF_SDL_GameControllerIsSensorEnabled #define SDL_GameControllerGetSensorData IGNORE_THIS_VERSION_OF_SDL_GameControllerGetSensorData #define SDL_wcscasecmp IGNORE_THIS_VERSION_OF_SDL_wcscasecmp #define SDL_wcsncasecmp IGNORE_THIS_VERSION_OF_SDL_wcsncasecmp #define SDL_round IGNORE_THIS_VERSION_OF_SDL_round #define SDL_roundf IGNORE_THIS_VERSION_OF_SDL_roundf #define SDL_lround IGNORE_THIS_VERSION_OF_SDL_lround #define SDL_lroundf IGNORE_THIS_VERSION_OF_SDL_lroundf #define SDL_SoftStretchLinear IGNORE_THIS_VERSION_OF_SDL_SoftStretchLinear #define SDL_RenderGetD3D11Device IGNORE_THIS_VERSION_OF_SDL_RenderGetD3D11Device #define SDL_UpdateNVTexture IGNORE_THIS_VERSION_OF_SDL_UpdateNVTexture #define SDL_SetWindowKeyboardGrab IGNORE_THIS_VERSION_OF_SDL_SetWindowKeyboardGrab #define SDL_SetWindowMouseGrab IGNORE_THIS_VERSION_OF_SDL_SetWindowMouseGrab #define SDL_GetWindowKeyboardGrab IGNORE_THIS_VERSION_OF_SDL_GetWindowKeyboardGrab #define SDL_GetWindowMouseGrab IGNORE_THIS_VERSION_OF_SDL_GetWindowMouseGrab #define SDL_isalpha IGNORE_THIS_VERSION_OF_SDL_isalpha #define SDL_isalnum IGNORE_THIS_VERSION_OF_SDL_isalnum #define SDL_isblank IGNORE_THIS_VERSION_OF_SDL_isblank #define SDL_iscntrl IGNORE_THIS_VERSION_OF_SDL_iscntrl #define SDL_isxdigit IGNORE_THIS_VERSION_OF_SDL_isxdigit #define SDL_ispunct IGNORE_THIS_VERSION_OF_SDL_ispunct #define SDL_isprint IGNORE_THIS_VERSION_OF_SDL_isprint #define SDL_isgraph IGNORE_THIS_VERSION_OF_SDL_isgraph #define SDL_AndroidShowToast IGNORE_THIS_VERSION_OF_SDL_AndroidShowToast #define SDL_GetAudioDeviceSpec IGNORE_THIS_VERSION_OF_SDL_GetAudioDeviceSpec #define SDL_TLSCleanup IGNORE_THIS_VERSION_OF_SDL_TLSCleanup #define SDL_SetWindowAlwaysOnTop IGNORE_THIS_VERSION_OF_SDL_SetWindowAlwaysOnTop #define SDL_FlashWindow IGNORE_THIS_VERSION_OF_SDL_FlashWindow #define SDL_GameControllerSendEffect IGNORE_THIS_VERSION_OF_SDL_GameControllerSendEffect #define SDL_JoystickSendEffect IGNORE_THIS_VERSION_OF_SDL_JoystickSendEffect #define SDL_GameControllerGetSensorDataRate IGNORE_THIS_VERSION_OF_SDL_GameControllerGetSensorDataRate #define SDL_SetTextureUserData IGNORE_THIS_VERSION_OF_SDL_SetTextureUserData #define SDL_GetTextureUserData IGNORE_THIS_VERSION_OF_SDL_GetTextureUserData #define SDL_RenderGeometry IGNORE_THIS_VERSION_OF_SDL_RenderGeometry #define SDL_RenderGeometryRaw IGNORE_THIS_VERSION_OF_SDL_RenderGeometryRaw #define SDL_RenderSetVSync IGNORE_THIS_VERSION_OF_SDL_RenderSetVSync #define SDL_asprintf IGNORE_THIS_VERSION_OF_SDL_asprintf #define SDL_vasprintf IGNORE_THIS_VERSION_OF_SDL_vasprintf #define SDL_GetWindowICCProfile IGNORE_THIS_VERSION_OF_SDL_GetWindowICCProfile #define SDL_GetTicks64 IGNORE_THIS_VERSION_OF_SDL_GetTicks64 #define SDL_LinuxSetThreadPriorityAndPolicy IGNORE_THIS_VERSION_OF_SDL_LinuxSetThreadPriorityAndPolicy #define SDL_GameControllerGetAppleSFSymbolsNameForButton IGNORE_THIS_VERSION_OF_SDL_GameControllerGetAppleSFSymbolsNameForButton #define SDL_GameControllerGetAppleSFSymbolsNameForAxis IGNORE_THIS_VERSION_OF_SDL_GameControllerGetAppleSFSymbolsNameForAxis #define SDL_hid_init IGNORE_THIS_VERSION_OF_SDL_hid_init #define SDL_hid_exit IGNORE_THIS_VERSION_OF_SDL_hid_exit #define SDL_hid_device_change_count IGNORE_THIS_VERSION_OF_SDL_hid_device_change_count #define SDL_hid_enumerate IGNORE_THIS_VERSION_OF_SDL_hid_enumerate #define SDL_hid_free_enumeration IGNORE_THIS_VERSION_OF_SDL_hid_free_enumeration #define SDL_hid_open IGNORE_THIS_VERSION_OF_SDL_hid_open #define SDL_hid_open_path IGNORE_THIS_VERSION_OF_SDL_hid_open_path #define SDL_hid_write IGNORE_THIS_VERSION_OF_SDL_hid_write #define SDL_hid_read_timeout IGNORE_THIS_VERSION_OF_SDL_hid_read_timeout #define SDL_hid_read IGNORE_THIS_VERSION_OF_SDL_hid_read #define SDL_hid_set_nonblocking IGNORE_THIS_VERSION_OF_SDL_hid_set_nonblocking #define SDL_hid_send_feature_report IGNORE_THIS_VERSION_OF_SDL_hid_send_feature_report #define SDL_hid_get_feature_report IGNORE_THIS_VERSION_OF_SDL_hid_get_feature_report #define SDL_hid_close IGNORE_THIS_VERSION_OF_SDL_hid_close #define SDL_hid_get_manufacturer_string IGNORE_THIS_VERSION_OF_SDL_hid_get_manufacturer_string #define SDL_hid_get_product_string IGNORE_THIS_VERSION_OF_SDL_hid_get_product_string #define SDL_hid_get_serial_number_string IGNORE_THIS_VERSION_OF_SDL_hid_get_serial_number_string #define SDL_hid_get_indexed_string IGNORE_THIS_VERSION_OF_SDL_hid_get_indexed_string #define SDL_SetWindowMouseRect IGNORE_THIS_VERSION_OF_SDL_SetWindowMouseRect #define SDL_GetWindowMouseRect IGNORE_THIS_VERSION_OF_SDL_GetWindowMouseRect #define SDL_RenderWindowToLogical IGNORE_THIS_VERSION_OF_SDL_RenderWindowToLogical #define SDL_RenderLogicalToWindow IGNORE_THIS_VERSION_OF_SDL_RenderLogicalToWindow #define SDL_JoystickHasRumble IGNORE_THIS_VERSION_OF_SDL_JoystickHasRumble #define SDL_JoystickHasRumbleTriggers IGNORE_THIS_VERSION_OF_SDL_JoystickHasRumbleTriggers #define SDL_GameControllerHasRumble IGNORE_THIS_VERSION_OF_SDL_GameControllerHasRumble #define SDL_GameControllerHasRumbleTriggers IGNORE_THIS_VERSION_OF_SDL_GameControllerHasRumbleTriggers #define SDL_hid_ble_scan IGNORE_THIS_VERSION_OF_SDL_hid_ble_scan #define SDL_PremultiplyAlpha IGNORE_THIS_VERSION_OF_SDL_PremultiplyAlpha #define SDL_AndroidSendMessage IGNORE_THIS_VERSION_OF_SDL_AndroidSendMessage #define SDL_GetTouchName IGNORE_THIS_VERSION_OF_SDL_GetTouchName #define SDL_ClearComposition IGNORE_THIS_VERSION_OF_SDL_ClearComposition #define SDL_IsTextInputShown IGNORE_THIS_VERSION_OF_SDL_IsTextInputShown #define SDL_HasIntersectionF IGNORE_THIS_VERSION_OF_SDL_HasIntersectionF #define SDL_IntersectFRect IGNORE_THIS_VERSION_OF_SDL_IntersectFRect #define SDL_UnionFRect IGNORE_THIS_VERSION_OF_SDL_UnionFRect #define SDL_EncloseFPoints IGNORE_THIS_VERSION_OF_SDL_EncloseFPoints #define SDL_IntersectFRectAndLine IGNORE_THIS_VERSION_OF_SDL_IntersectFRectAndLine #define SDL_RenderGetWindow IGNORE_THIS_VERSION_OF_SDL_RenderGetWindow #define SDL_bsearch IGNORE_THIS_VERSION_OF_SDL_bsearch #define SDL_GameControllerPathForIndex IGNORE_THIS_VERSION_OF_SDL_GameControllerPathForIndex #define SDL_GameControllerPath IGNORE_THIS_VERSION_OF_SDL_GameControllerPath #define SDL_JoystickPathForIndex IGNORE_THIS_VERSION_OF_SDL_JoystickPathForIndex #define SDL_JoystickPath IGNORE_THIS_VERSION_OF_SDL_JoystickPath #define SDL_JoystickAttachVirtualEx IGNORE_THIS_VERSION_OF_SDL_JoystickAttachVirtualEx #define SDL_GameControllerGetFirmwareVersion IGNORE_THIS_VERSION_OF_SDL_GameControllerGetFirmwareVersion #define SDL_JoystickGetFirmwareVersion IGNORE_THIS_VERSION_OF_SDL_JoystickGetFirmwareVersion #define SDL_GUIDToString IGNORE_THIS_VERSION_OF_SDL_GUIDToString #define SDL_GUIDFromString IGNORE_THIS_VERSION_OF_SDL_GUIDFromString #define SDL_HasLSX IGNORE_THIS_VERSION_OF_SDL_HasLSX #define SDL_HasLASX IGNORE_THIS_VERSION_OF_SDL_HasLASX #define SDL_RenderGetD3D12Device IGNORE_THIS_VERSION_OF_SDL_RenderGetD3D12Device #define SDL_utf8strnlen IGNORE_THIS_VERSION_OF_SDL_utf8strnlen #define SDL_GDKGetTaskQueue IGNORE_THIS_VERSION_OF_SDL_GDKGetTaskQueue #define SDL_GDKRunApp IGNORE_THIS_VERSION_OF_SDL_GDKRunApp #define SDL_GetOriginalMemoryFunctions IGNORE_THIS_VERSION_OF_SDL_GetOriginalMemoryFunctions #define SDL_ResetKeyboard IGNORE_THIS_VERSION_OF_SDL_ResetKeyboard #define SDL_GetDefaultAudioInfo IGNORE_THIS_VERSION_OF_SDL_GetDefaultAudioInfo #define SDL_GetPointDisplayIndex IGNORE_THIS_VERSION_OF_SDL_GetPointDisplayIndex #define SDL_GetRectDisplayIndex IGNORE_THIS_VERSION_OF_SDL_GetRectDisplayIndex #define SDL_ResetHint IGNORE_THIS_VERSION_OF_SDL_ResetHint #define SDL_crc16 IGNORE_THIS_VERSION_OF_SDL_crc16 #define SDL_GetWindowSizeInPixels IGNORE_THIS_VERSION_OF_SDL_GetWindowSizeInPixels #define SDL_GetJoystickGUIDInfo IGNORE_THIS_VERSION_OF_SDL_GetJoystickGUIDInfo #define SDL_SetPrimarySelectionText IGNORE_THIS_VERSION_OF_SDL_SetPrimarySelectionText #define SDL_GetPrimarySelectionText IGNORE_THIS_VERSION_OF_SDL_GetPrimarySelectionText #define SDL_HasPrimarySelectionText IGNORE_THIS_VERSION_OF_SDL_HasPrimarySelectionText #define SDL_GameControllerGetSensorDataWithTimestamp IGNORE_THIS_VERSION_OF_SDL_GameControllerGetSensorDataWithTimestamp #define SDL_SensorGetDataWithTimestamp IGNORE_THIS_VERSION_OF_SDL_SensorGetDataWithTimestamp #define SDL_ResetHints IGNORE_THIS_VERSION_OF_SDL_ResetHints #define SDL_strcasestr IGNORE_THIS_VERSION_OF_SDL_strcasestr #define SDL_GDKSuspendComplete IGNORE_THIS_VERSION_OF_SDL_GDKSuspendComplete #define SDL_HasWindowSurface IGNORE_THIS_VERSION_OF_SDL_HasWindowSurface #define SDL_DestroyWindowSurface IGNORE_THIS_VERSION_OF_SDL_DestroyWindowSurface #define SDL_GDKGetDefaultUser IGNORE_THIS_VERSION_OF_SDL_GDKGetDefaultUser #define SDL_GameControllerGetSteamHandle IGNORE_THIS_VERSION_OF_SDL_GameControllerGetSteamHandle #if defined(_WIN32) || defined(__OS2__) /* *** HACK HACK HACK: * *** Avoid including SDL_thread.h: it defines SDL_CreateThread() as a macro */ #define _SDL_thread_h #define SDL_thread_h_ #define SDL_PASSED_BEGINTHREAD_ENDTHREAD #endif #ifdef __OS2__ #define INCL_DOSMODULEMGR /* for Dos_LoadModule() & co. */ #define INCL_DOSPROCESS #endif #define __BUILDING_SDL12_COMPAT__ 1 #include "SDL.h" #include "SDL_syswm.h" /* includes windows.h or os2.h */ /* Headers from SDL2 >= 2.0.7 needed for SDL_AudioStream. */ #if !SDL_VERSION_ATLEAST(2,0,7) #error You need to compile against SDL >= 2.0.7 headers. #endif #if !SDL_VERSION_ATLEAST(2,0,10) // SDL_PixelFormatEnum was an anonymous enum before SDL 2.0.10. // Force it to Uint32 if compiling on older headers. typedef Uint32 SDL_PixelFormatEnum; #endif /* Missing SDL_thread.h stuff (see above) */ #if defined(_WIN32) || defined(__OS2__) typedef struct SDL_Thread SDL_Thread; typedef int (SDLCALL *SDL_ThreadFunction) (void*); #endif #ifdef __OS2__ typedef int (*pfnSDL_CurrentBeginThread) (void (*func)(void*), void*, unsigned, void*); typedef void (*pfnSDL_CurrentEndThread) (void); #endif #ifdef _WIN32 typedef UINT_PTR (__cdecl *pfnSDL_CurrentBeginThread) (void*, unsigned, unsigned (__stdcall *func)(void*), void*, unsigned, unsigned*); typedef void (__cdecl *pfnSDL_CurrentEndThread) (unsigned); /* the following macros from Win32 SDK headers are harmful here. */ #undef CreateWindow #undef CreateThread #undef CreateSemaphore #undef CreateMutex #endif /* _WIN32 */ #ifdef SDL_SetError #undef SDL_SetError #endif #ifdef SDL_Log #undef SDL_Log #endif #ifdef SDL_LogVerbose #undef SDL_LogVerbose #endif #ifdef SDL_LogDebug #undef SDL_LogDebug #endif #ifdef SDL_LogInfo #undef SDL_LogInfo #endif #ifdef SDL_LogWarn #undef SDL_LogWarn #endif #ifdef SDL_LogError #undef SDL_LogError #endif #ifdef SDL_LogCritical #undef SDL_LogCritical #endif #ifdef SDL_LogMessage #undef SDL_LogMessage #endif #ifdef SDL_sscanf #undef SDL_sscanf #endif #ifdef SDL_snprintf #undef SDL_snprintf #endif #ifdef SDL_CreateThread #undef SDL_CreateThread #endif #ifdef SDL_RWFromFP #undef SDL_RWFromFP #endif #ifdef SDL_RegisterApp #undef SDL_RegisterApp #endif #ifdef SDL_UnregisterApp #undef SDL_UnregisterApp #endif #ifdef SDL_Direct3D9GetAdapterIndex #undef SDL_Direct3D9GetAdapterIndex #endif #ifdef SDL_RenderGetD3D9Device #undef SDL_RenderGetD3D9Device #endif #ifdef SDL_iPhoneSetAnimationCallback #undef SDL_iPhoneSetAnimationCallback #endif #ifdef SDL_iPhoneSetEventPump #undef SDL_iPhoneSetEventPump #endif #ifdef SDL_AndroidGetJNIEnv #undef SDL_AndroidGetJNIEnv #endif #ifdef SDL_AndroidGetActivity #undef SDL_AndroidGetActivity #endif #ifdef SDL_AndroidGetInternalStoragePath #undef SDL_AndroidGetInternalStoragePath #endif #ifdef SDL_AndroidGetExternalStorageState #undef SDL_AndroidGetExternalStorageState #endif #ifdef SDL_AndroidGetExternalStoragePath #undef SDL_AndroidGetExternalStoragePath #endif #ifdef SDL_Init #undef SDL_Init #endif #ifdef SDL_InitSubSystem #undef SDL_InitSubSystem #endif #ifdef SDL_QuitSubSystem #undef SDL_QuitSubSystem #endif #ifdef SDL_WasInit #undef SDL_WasInit #endif #ifdef SDL_Quit #undef SDL_Quit #endif #ifdef SDL_ReportAssertion #undef SDL_ReportAssertion #endif #ifdef SDL_SetAssertionHandler #undef SDL_SetAssertionHandler #endif #ifdef SDL_GetAssertionReport #undef SDL_GetAssertionReport #endif #ifdef SDL_ResetAssertionReport #undef SDL_ResetAssertionReport #endif #ifdef SDL_AtomicTryLock #undef SDL_AtomicTryLock #endif #ifdef SDL_AtomicLock #undef SDL_AtomicLock #endif #ifdef SDL_AtomicUnlock #undef SDL_AtomicUnlock #endif #ifdef SDL_AtomicCAS #undef SDL_AtomicCAS #endif #ifdef SDL_AtomicSet #undef SDL_AtomicSet #endif #ifdef SDL_AtomicGet #undef SDL_AtomicGet #endif #ifdef SDL_AtomicAdd #undef SDL_AtomicAdd #endif #ifdef SDL_AtomicCASPtr #undef SDL_AtomicCASPtr #endif #ifdef SDL_AtomicSetPtr #undef SDL_AtomicSetPtr #endif #ifdef SDL_AtomicGetPtr #undef SDL_AtomicGetPtr #endif #ifdef SDL_GetNumAudioDrivers #undef SDL_GetNumAudioDrivers #endif #ifdef SDL_GetAudioDriver #undef SDL_GetAudioDriver #endif #ifdef SDL_AudioInit #undef SDL_AudioInit #endif #ifdef SDL_AudioQuit #undef SDL_AudioQuit #endif #ifdef SDL_GetCurrentAudioDriver #undef SDL_GetCurrentAudioDriver #endif #ifdef SDL_OpenAudio #undef SDL_OpenAudio #endif #ifdef SDL_GetNumAudioDevices #undef SDL_GetNumAudioDevices #endif #ifdef SDL_GetAudioDeviceName #undef SDL_GetAudioDeviceName #endif #ifdef SDL_OpenAudioDevice #undef SDL_OpenAudioDevice #endif #ifdef SDL_GetAudioStatus #undef SDL_GetAudioStatus #endif #ifdef SDL_GetAudioDeviceStatus #undef SDL_GetAudioDeviceStatus #endif #ifdef SDL_PauseAudio #undef SDL_PauseAudio #endif #ifdef SDL_PauseAudioDevice #undef SDL_PauseAudioDevice #endif #ifdef SDL_LoadWAV_RW #undef SDL_LoadWAV_RW #endif #ifdef SDL_FreeWAV #undef SDL_FreeWAV #endif #ifdef SDL_BuildAudioCVT #undef SDL_BuildAudioCVT #endif #ifdef SDL_ConvertAudio #undef SDL_ConvertAudio #endif #ifdef SDL_MixAudio #undef SDL_MixAudio #endif #ifdef SDL_MixAudioFormat #undef SDL_MixAudioFormat #endif #ifdef SDL_LockAudio #undef SDL_LockAudio #endif #ifdef SDL_LockAudioDevice #undef SDL_LockAudioDevice #endif #ifdef SDL_UnlockAudio #undef SDL_UnlockAudio #endif #ifdef SDL_UnlockAudioDevice #undef SDL_UnlockAudioDevice #endif #ifdef SDL_CloseAudio #undef SDL_CloseAudio #endif #ifdef SDL_CloseAudioDevice #undef SDL_CloseAudioDevice #endif #ifdef SDL_SetClipboardText #undef SDL_SetClipboardText #endif #ifdef SDL_GetClipboardText #undef SDL_GetClipboardText #endif #ifdef SDL_HasClipboardText #undef SDL_HasClipboardText #endif #ifdef SDL_GetCPUCount #undef SDL_GetCPUCount #endif #ifdef SDL_GetCPUCacheLineSize #undef SDL_GetCPUCacheLineSize #endif #ifdef SDL_HasRDTSC #undef SDL_HasRDTSC #endif #ifdef SDL_HasAltiVec #undef SDL_HasAltiVec #endif #ifdef SDL_HasMMX #undef SDL_HasMMX #endif #ifdef SDL_Has3DNow #undef SDL_Has3DNow #endif #ifdef SDL_HasSSE #undef SDL_HasSSE #endif #ifdef SDL_HasSSE2 #undef SDL_HasSSE2 #endif #ifdef SDL_HasSSE3 #undef SDL_HasSSE3 #endif #ifdef SDL_HasSSE41 #undef SDL_HasSSE41 #endif #ifdef SDL_HasSSE42 #undef SDL_HasSSE42 #endif #ifdef SDL_GetSystemRAM #undef SDL_GetSystemRAM #endif #ifdef SDL_GetError #undef SDL_GetError #endif #ifdef SDL_ClearError #undef SDL_ClearError #endif #ifdef SDL_Error #undef SDL_Error #endif #ifdef SDL_PumpEvents #undef SDL_PumpEvents #endif #ifdef SDL_PeepEvents #undef SDL_PeepEvents #endif #ifdef SDL_HasEvent #undef SDL_HasEvent #endif #ifdef SDL_HasEvents #undef SDL_HasEvents #endif #ifdef SDL_FlushEvent #undef SDL_FlushEvent #endif #ifdef SDL_FlushEvents #undef SDL_FlushEvents #endif #ifdef SDL_PollEvent #undef SDL_PollEvent #endif #ifdef SDL_WaitEvent #undef SDL_WaitEvent #endif #ifdef SDL_WaitEventTimeout #undef SDL_WaitEventTimeout #endif #ifdef SDL_PushEvent #undef SDL_PushEvent #endif #ifdef SDL_SetEventFilter #undef SDL_SetEventFilter #endif #ifdef SDL_GetEventFilter #undef SDL_GetEventFilter #endif #ifdef SDL_AddEventWatch #undef SDL_AddEventWatch #endif #ifdef SDL_DelEventWatch #undef SDL_DelEventWatch #endif #ifdef SDL_FilterEvents #undef SDL_FilterEvents #endif #ifdef SDL_EventState #undef SDL_EventState #endif #ifdef SDL_RegisterEvents #undef SDL_RegisterEvents #endif #ifdef SDL_GetBasePath #undef SDL_GetBasePath #endif #ifdef SDL_GetPrefPath #undef SDL_GetPrefPath #endif #ifdef SDL_GameControllerAddMapping #undef SDL_GameControllerAddMapping #endif #ifdef SDL_GameControllerMappingForGUID #undef SDL_GameControllerMappingForGUID #endif #ifdef SDL_GameControllerMapping #undef SDL_GameControllerMapping #endif #ifdef SDL_IsGameController #undef SDL_IsGameController #endif #ifdef SDL_GameControllerNameForIndex #undef SDL_GameControllerNameForIndex #endif #ifdef SDL_GameControllerOpen #undef SDL_GameControllerOpen #endif #ifdef SDL_GameControllerName #undef SDL_GameControllerName #endif #ifdef SDL_GameControllerGetAttached #undef SDL_GameControllerGetAttached #endif #ifdef SDL_GameControllerGetJoystick #undef SDL_GameControllerGetJoystick #endif #ifdef SDL_GameControllerEventState #undef SDL_GameControllerEventState #endif #ifdef SDL_GameControllerUpdate #undef SDL_GameControllerUpdate #endif #ifdef SDL_GameControllerGetAxisFromString #undef SDL_GameControllerGetAxisFromString #endif #ifdef SDL_GameControllerGetStringForAxis #undef SDL_GameControllerGetStringForAxis #endif #ifdef SDL_GameControllerGetBindForAxis #undef SDL_GameControllerGetBindForAxis #endif #ifdef SDL_GameControllerGetAxis #undef SDL_GameControllerGetAxis #endif #ifdef SDL_GameControllerGetButtonFromString #undef SDL_GameControllerGetButtonFromString #endif #ifdef SDL_GameControllerGetStringForButton #undef SDL_GameControllerGetStringForButton #endif #ifdef SDL_GameControllerGetBindForButton #undef SDL_GameControllerGetBindForButton #endif #ifdef SDL_GameControllerGetButton #undef SDL_GameControllerGetButton #endif #ifdef SDL_GameControllerClose #undef SDL_GameControllerClose #endif #ifdef SDL_RecordGesture #undef SDL_RecordGesture #endif #ifdef SDL_SaveAllDollarTemplates #undef SDL_SaveAllDollarTemplates #endif #ifdef SDL_SaveDollarTemplate #undef SDL_SaveDollarTemplate #endif #ifdef SDL_LoadDollarTemplates #undef SDL_LoadDollarTemplates #endif #ifdef SDL_NumHaptics #undef SDL_NumHaptics #endif #ifdef SDL_HapticName #undef SDL_HapticName #endif #ifdef SDL_HapticOpen #undef SDL_HapticOpen #endif #ifdef SDL_HapticOpened #undef SDL_HapticOpened #endif #ifdef SDL_HapticIndex #undef SDL_HapticIndex #endif #ifdef SDL_MouseIsHaptic #undef SDL_MouseIsHaptic #endif #ifdef SDL_HapticOpenFromMouse #undef SDL_HapticOpenFromMouse #endif #ifdef SDL_JoystickIsHaptic #undef SDL_JoystickIsHaptic #endif #ifdef SDL_HapticOpenFromJoystick #undef SDL_HapticOpenFromJoystick #endif #ifdef SDL_HapticClose #undef SDL_HapticClose #endif #ifdef SDL_HapticNumEffects #undef SDL_HapticNumEffects #endif #ifdef SDL_HapticNumEffectsPlaying #undef SDL_HapticNumEffectsPlaying #endif #ifdef SDL_HapticQuery #undef SDL_HapticQuery #endif #ifdef SDL_HapticNumAxes #undef SDL_HapticNumAxes #endif #ifdef SDL_HapticEffectSupported #undef SDL_HapticEffectSupported #endif #ifdef SDL_HapticNewEffect #undef SDL_HapticNewEffect #endif #ifdef SDL_HapticUpdateEffect #undef SDL_HapticUpdateEffect #endif #ifdef SDL_HapticRunEffect #undef SDL_HapticRunEffect #endif #ifdef SDL_HapticStopEffect #undef SDL_HapticStopEffect #endif #ifdef SDL_HapticDestroyEffect #undef SDL_HapticDestroyEffect #endif #ifdef SDL_HapticGetEffectStatus #undef SDL_HapticGetEffectStatus #endif #ifdef SDL_HapticSetGain #undef SDL_HapticSetGain #endif #ifdef SDL_HapticSetAutocenter #undef SDL_HapticSetAutocenter #endif #ifdef SDL_HapticPause #undef SDL_HapticPause #endif #ifdef SDL_HapticUnpause #undef SDL_HapticUnpause #endif #ifdef SDL_HapticStopAll #undef SDL_HapticStopAll #endif #ifdef SDL_HapticRumbleSupported #undef SDL_HapticRumbleSupported #endif #ifdef SDL_HapticRumbleInit #undef SDL_HapticRumbleInit #endif #ifdef SDL_HapticRumblePlay #undef SDL_HapticRumblePlay #endif #ifdef SDL_HapticRumbleStop #undef SDL_HapticRumbleStop #endif #ifdef SDL_SetHintWithPriority #undef SDL_SetHintWithPriority #endif #ifdef SDL_SetHint #undef SDL_SetHint #endif #ifdef SDL_GetHint #undef SDL_GetHint #endif #ifdef SDL_AddHintCallback #undef SDL_AddHintCallback #endif #ifdef SDL_DelHintCallback #undef SDL_DelHintCallback #endif #ifdef SDL_ClearHints #undef SDL_ClearHints #endif #ifdef SDL_NumJoysticks #undef SDL_NumJoysticks #endif #ifdef SDL_JoystickNameForIndex #undef SDL_JoystickNameForIndex #endif #ifdef SDL_JoystickOpen #undef SDL_JoystickOpen #endif #ifdef SDL_JoystickName #undef SDL_JoystickName #endif #ifdef SDL_JoystickGetDeviceGUID #undef SDL_JoystickGetDeviceGUID #endif #ifdef SDL_JoystickGetGUID #undef SDL_JoystickGetGUID #endif #ifdef SDL_JoystickGetGUIDString #undef SDL_JoystickGetGUIDString #endif #ifdef SDL_JoystickGetGUIDFromString #undef SDL_JoystickGetGUIDFromString #endif #ifdef SDL_JoystickGetAttached #undef SDL_JoystickGetAttached #endif #ifdef SDL_JoystickInstanceID #undef SDL_JoystickInstanceID #endif #ifdef SDL_JoystickNumAxes #undef SDL_JoystickNumAxes #endif #ifdef SDL_JoystickNumBalls #undef SDL_JoystickNumBalls #endif #ifdef SDL_JoystickNumHats #undef SDL_JoystickNumHats #endif #ifdef SDL_JoystickNumButtons #undef SDL_JoystickNumButtons #endif #ifdef SDL_JoystickUpdate #undef SDL_JoystickUpdate #endif #ifdef SDL_JoystickEventState #undef SDL_JoystickEventState #endif #ifdef SDL_JoystickGetAxis #undef SDL_JoystickGetAxis #endif #ifdef SDL_JoystickGetHat #undef SDL_JoystickGetHat #endif #ifdef SDL_JoystickGetBall #undef SDL_JoystickGetBall #endif #ifdef SDL_JoystickGetButton #undef SDL_JoystickGetButton #endif #ifdef SDL_JoystickClose #undef SDL_JoystickClose #endif #ifdef SDL_GetKeyboardFocus #undef SDL_GetKeyboardFocus #endif #ifdef SDL_GetKeyboardState #undef SDL_GetKeyboardState #endif #ifdef SDL_GetModState #undef SDL_GetModState #endif #ifdef SDL_SetModState #undef SDL_SetModState #endif #ifdef SDL_GetKeyFromScancode #undef SDL_GetKeyFromScancode #endif #ifdef SDL_GetScancodeFromKey #undef SDL_GetScancodeFromKey #endif #ifdef SDL_GetScancodeName #undef SDL_GetScancodeName #endif #ifdef SDL_GetScancodeFromName #undef SDL_GetScancodeFromName #endif #ifdef SDL_GetKeyName #undef SDL_GetKeyName #endif #ifdef SDL_GetKeyFromName #undef SDL_GetKeyFromName #endif #ifdef SDL_StartTextInput #undef SDL_StartTextInput #endif #ifdef SDL_IsTextInputActive #undef SDL_IsTextInputActive #endif #ifdef SDL_StopTextInput #undef SDL_StopTextInput #endif #ifdef SDL_SetTextInputRect #undef SDL_SetTextInputRect #endif #ifdef SDL_HasScreenKeyboardSupport #undef SDL_HasScreenKeyboardSupport #endif #ifdef SDL_IsScreenKeyboardShown #undef SDL_IsScreenKeyboardShown #endif #ifdef SDL_LoadObject #undef SDL_LoadObject #endif #ifdef SDL_LoadFunction #undef SDL_LoadFunction #endif #ifdef SDL_UnloadObject #undef SDL_UnloadObject #endif #ifdef SDL_LogSetAllPriority #undef SDL_LogSetAllPriority #endif #ifdef SDL_LogSetPriority #undef SDL_LogSetPriority #endif #ifdef SDL_LogGetPriority #undef SDL_LogGetPriority #endif #ifdef SDL_LogResetPriorities #undef SDL_LogResetPriorities #endif #ifdef SDL_LogMessageV #undef SDL_LogMessageV #endif #ifdef SDL_LogGetOutputFunction #undef SDL_LogGetOutputFunction #endif #ifdef SDL_LogSetOutputFunction #undef SDL_LogSetOutputFunction #endif #ifdef SDL_SetMainReady #undef SDL_SetMainReady #endif #ifdef SDL_ShowMessageBox #undef SDL_ShowMessageBox #endif #ifdef SDL_ShowSimpleMessageBox #undef SDL_ShowSimpleMessageBox #endif #ifdef SDL_GetMouseFocus #undef SDL_GetMouseFocus #endif #ifdef SDL_GetMouseState #undef SDL_GetMouseState #endif #ifdef SDL_GetRelativeMouseState #undef SDL_GetRelativeMouseState #endif #ifdef SDL_WarpMouseInWindow #undef SDL_WarpMouseInWindow #endif #ifdef SDL_SetRelativeMouseMode #undef SDL_SetRelativeMouseMode #endif #ifdef SDL_GetRelativeMouseMode #undef SDL_GetRelativeMouseMode #endif #ifdef SDL_CreateCursor #undef SDL_CreateCursor #endif #ifdef SDL_CreateColorCursor #undef SDL_CreateColorCursor #endif #ifdef SDL_CreateSystemCursor #undef SDL_CreateSystemCursor #endif #ifdef SDL_SetCursor #undef SDL_SetCursor #endif #ifdef SDL_GetCursor #undef SDL_GetCursor #endif #ifdef SDL_GetDefaultCursor #undef SDL_GetDefaultCursor #endif #ifdef SDL_FreeCursor #undef SDL_FreeCursor #endif #ifdef SDL_ShowCursor #undef SDL_ShowCursor #endif #ifdef SDL_CreateMutex #undef SDL_CreateMutex #endif #ifdef SDL_LockMutex #undef SDL_LockMutex #endif #ifdef SDL_TryLockMutex #undef SDL_TryLockMutex #endif #ifdef SDL_UnlockMutex #undef SDL_UnlockMutex #endif #ifdef SDL_DestroyMutex #undef SDL_DestroyMutex #endif #ifdef SDL_CreateSemaphore #undef SDL_CreateSemaphore #endif #ifdef SDL_DestroySemaphore #undef SDL_DestroySemaphore #endif #ifdef SDL_SemWait #undef SDL_SemWait #endif #ifdef SDL_SemTryWait #undef SDL_SemTryWait #endif #ifdef SDL_SemWaitTimeout #undef SDL_SemWaitTimeout #endif #ifdef SDL_SemPost #undef SDL_SemPost #endif #ifdef SDL_SemValue #undef SDL_SemValue #endif #ifdef SDL_CreateCond #undef SDL_CreateCond #endif #ifdef SDL_DestroyCond #undef SDL_DestroyCond #endif #ifdef SDL_CondSignal #undef SDL_CondSignal #endif #ifdef SDL_CondBroadcast #undef SDL_CondBroadcast #endif #ifdef SDL_CondWait #undef SDL_CondWait #endif #ifdef SDL_CondWaitTimeout #undef SDL_CondWaitTimeout #endif #ifdef SDL_GetPixelFormatName #undef SDL_GetPixelFormatName #endif #ifdef SDL_PixelFormatEnumToMasks #undef SDL_PixelFormatEnumToMasks #endif #ifdef SDL_MasksToPixelFormatEnum #undef SDL_MasksToPixelFormatEnum #endif #ifdef SDL_AllocFormat #undef SDL_AllocFormat #endif #ifdef SDL_FreeFormat #undef SDL_FreeFormat #endif #ifdef SDL_AllocPalette #undef SDL_AllocPalette #endif #ifdef SDL_SetPixelFormatPalette #undef SDL_SetPixelFormatPalette #endif #ifdef SDL_SetPaletteColors #undef SDL_SetPaletteColors #endif #ifdef SDL_FreePalette #undef SDL_FreePalette #endif #ifdef SDL_MapRGB #undef SDL_MapRGB #endif #ifdef SDL_MapRGBA #undef SDL_MapRGBA #endif #ifdef SDL_GetRGB #undef SDL_GetRGB #endif #ifdef SDL_GetRGBA #undef SDL_GetRGBA #endif #ifdef SDL_CalculateGammaRamp #undef SDL_CalculateGammaRamp #endif #ifdef SDL_GetPlatform #undef SDL_GetPlatform #endif #ifdef SDL_GetPowerInfo #undef SDL_GetPowerInfo #endif #ifdef SDL_HasIntersection #undef SDL_HasIntersection #endif #ifdef SDL_IntersectRect #undef SDL_IntersectRect #endif #ifdef SDL_UnionRect #undef SDL_UnionRect #endif #ifdef SDL_EnclosePoints #undef SDL_EnclosePoints #endif #ifdef SDL_IntersectRectAndLine #undef SDL_IntersectRectAndLine #endif #ifdef SDL_GetNumRenderDrivers #undef SDL_GetNumRenderDrivers #endif #ifdef SDL_GetRenderDriverInfo #undef SDL_GetRenderDriverInfo #endif #ifdef SDL_CreateWindowAndRenderer #undef SDL_CreateWindowAndRenderer #endif #ifdef SDL_CreateRenderer #undef SDL_CreateRenderer #endif #ifdef SDL_CreateSoftwareRenderer #undef SDL_CreateSoftwareRenderer #endif #ifdef SDL_GetRenderer #undef SDL_GetRenderer #endif #ifdef SDL_GetRendererInfo #undef SDL_GetRendererInfo #endif #ifdef SDL_GetRendererOutputSize #undef SDL_GetRendererOutputSize #endif #ifdef SDL_CreateTexture #undef SDL_CreateTexture #endif #ifdef SDL_CreateTextureFromSurface #undef SDL_CreateTextureFromSurface #endif #ifdef SDL_QueryTexture #undef SDL_QueryTexture #endif #ifdef SDL_SetTextureColorMod #undef SDL_SetTextureColorMod #endif #ifdef SDL_GetTextureColorMod #undef SDL_GetTextureColorMod #endif #ifdef SDL_SetTextureAlphaMod #undef SDL_SetTextureAlphaMod #endif #ifdef SDL_GetTextureAlphaMod #undef SDL_GetTextureAlphaMod #endif #ifdef SDL_SetTextureBlendMode #undef SDL_SetTextureBlendMode #endif #ifdef SDL_GetTextureBlendMode #undef SDL_GetTextureBlendMode #endif #ifdef SDL_UpdateTexture #undef SDL_UpdateTexture #endif #ifdef SDL_UpdateYUVTexture #undef SDL_UpdateYUVTexture #endif #ifdef SDL_LockTexture #undef SDL_LockTexture #endif #ifdef SDL_UnlockTexture #undef SDL_UnlockTexture #endif #ifdef SDL_RenderTargetSupported #undef SDL_RenderTargetSupported #endif #ifdef SDL_SetRenderTarget #undef SDL_SetRenderTarget #endif #ifdef SDL_GetRenderTarget #undef SDL_GetRenderTarget #endif #ifdef SDL_RenderSetLogicalSize #undef SDL_RenderSetLogicalSize #endif #ifdef SDL_RenderGetLogicalSize #undef SDL_RenderGetLogicalSize #endif #ifdef SDL_RenderSetViewport #undef SDL_RenderSetViewport #endif #ifdef SDL_RenderGetViewport #undef SDL_RenderGetViewport #endif #ifdef SDL_RenderSetClipRect #undef SDL_RenderSetClipRect #endif #ifdef SDL_RenderGetClipRect #undef SDL_RenderGetClipRect #endif #ifdef SDL_RenderSetScale #undef SDL_RenderSetScale #endif #ifdef SDL_RenderGetScale #undef SDL_RenderGetScale #endif #ifdef SDL_SetRenderDrawColor #undef SDL_SetRenderDrawColor #endif #ifdef SDL_GetRenderDrawColor #undef SDL_GetRenderDrawColor #endif #ifdef SDL_SetRenderDrawBlendMode #undef SDL_SetRenderDrawBlendMode #endif #ifdef SDL_GetRenderDrawBlendMode #undef SDL_GetRenderDrawBlendMode #endif #ifdef SDL_RenderClear #undef SDL_RenderClear #endif #ifdef SDL_RenderDrawPoint #undef SDL_RenderDrawPoint #endif #ifdef SDL_RenderDrawPoints #undef SDL_RenderDrawPoints #endif #ifdef SDL_RenderDrawLine #undef SDL_RenderDrawLine #endif #ifdef SDL_RenderDrawLines #undef SDL_RenderDrawLines #endif #ifdef SDL_RenderDrawRect #undef SDL_RenderDrawRect #endif #ifdef SDL_RenderDrawRects #undef SDL_RenderDrawRects #endif #ifdef SDL_RenderFillRect #undef SDL_RenderFillRect #endif #ifdef SDL_RenderFillRects #undef SDL_RenderFillRects #endif #ifdef SDL_RenderCopy #undef SDL_RenderCopy #endif #ifdef SDL_RenderCopyEx #undef SDL_RenderCopyEx #endif #ifdef SDL_RenderReadPixels #undef SDL_RenderReadPixels #endif #ifdef SDL_RenderPresent #undef SDL_RenderPresent #endif #ifdef SDL_DestroyTexture #undef SDL_DestroyTexture #endif #ifdef SDL_DestroyRenderer #undef SDL_DestroyRenderer #endif #ifdef SDL_GL_BindTexture #undef SDL_GL_BindTexture #endif #ifdef SDL_GL_UnbindTexture #undef SDL_GL_UnbindTexture #endif #ifdef SDL_RWFromFile #undef SDL_RWFromFile #endif #ifdef SDL_RWFromMem #undef SDL_RWFromMem #endif #ifdef SDL_RWFromConstMem #undef SDL_RWFromConstMem #endif #ifdef SDL_AllocRW #undef SDL_AllocRW #endif #ifdef SDL_FreeRW #undef SDL_FreeRW #endif #ifdef SDL_ReadU8 #undef SDL_ReadU8 #endif #ifdef SDL_ReadLE16 #undef SDL_ReadLE16 #endif #ifdef SDL_ReadBE16 #undef SDL_ReadBE16 #endif #ifdef SDL_ReadLE32 #undef SDL_ReadLE32 #endif #ifdef SDL_ReadBE32 #undef SDL_ReadBE32 #endif #ifdef SDL_ReadLE64 #undef SDL_ReadLE64 #endif #ifdef SDL_ReadBE64 #undef SDL_ReadBE64 #endif #ifdef SDL_WriteU8 #undef SDL_WriteU8 #endif #ifdef SDL_WriteLE16 #undef SDL_WriteLE16 #endif #ifdef SDL_WriteBE16 #undef SDL_WriteBE16 #endif #ifdef SDL_WriteLE32 #undef SDL_WriteLE32 #endif #ifdef SDL_WriteBE32 #undef SDL_WriteBE32 #endif #ifdef SDL_WriteLE64 #undef SDL_WriteLE64 #endif #ifdef SDL_WriteBE64 #undef SDL_WriteBE64 #endif #ifdef SDL_CreateShapedWindow #undef SDL_CreateShapedWindow #endif #ifdef SDL_IsShapedWindow #undef SDL_IsShapedWindow #endif #ifdef SDL_SetWindowShape #undef SDL_SetWindowShape #endif #ifdef SDL_GetShapedWindowMode #undef SDL_GetShapedWindowMode #endif #ifdef SDL_malloc #undef SDL_malloc #endif #ifdef SDL_calloc #undef SDL_calloc #endif #ifdef SDL_realloc #undef SDL_realloc #endif #ifdef SDL_free #undef SDL_free #endif #ifdef SDL_getenv #undef SDL_getenv #endif #ifdef SDL_setenv #undef SDL_setenv #endif #ifdef SDL_qsort #undef SDL_qsort #endif #ifdef SDL_abs #undef SDL_abs #endif #ifdef SDL_isdigit #undef SDL_isdigit #endif #ifdef SDL_isspace #undef SDL_isspace #endif #ifdef SDL_toupper #undef SDL_toupper #endif #ifdef SDL_tolower #undef SDL_tolower #endif #ifdef SDL_memset #undef SDL_memset #endif #ifdef SDL_memcpy #undef SDL_memcpy #endif #ifdef SDL_memmove #undef SDL_memmove #endif #ifdef SDL_memcmp #undef SDL_memcmp #endif #ifdef SDL_wcslen #undef SDL_wcslen #endif #ifdef SDL_wcslcpy #undef SDL_wcslcpy #endif #ifdef SDL_wcslcat #undef SDL_wcslcat #endif #ifdef SDL_strlen #undef SDL_strlen #endif #ifdef SDL_strlcpy #undef SDL_strlcpy #endif #ifdef SDL_utf8strlcpy #undef SDL_utf8strlcpy #endif #ifdef SDL_strlcat #undef SDL_strlcat #endif #ifdef SDL_strdup #undef SDL_strdup #endif #ifdef SDL_strrev #undef SDL_strrev #endif #ifdef SDL_strupr #undef SDL_strupr #endif #ifdef SDL_strlwr #undef SDL_strlwr #endif #ifdef SDL_strchr #undef SDL_strchr #endif #ifdef SDL_strrchr #undef SDL_strrchr #endif #ifdef SDL_strstr #undef SDL_strstr #endif #ifdef SDL_itoa #undef SDL_itoa #endif #ifdef SDL_uitoa #undef SDL_uitoa #endif #ifdef SDL_ltoa #undef SDL_ltoa #endif #ifdef SDL_ultoa #undef SDL_ultoa #endif #ifdef SDL_lltoa #undef SDL_lltoa #endif #ifdef SDL_ulltoa #undef SDL_ulltoa #endif #ifdef SDL_atoi #undef SDL_atoi #endif #ifdef SDL_atof #undef SDL_atof #endif #ifdef SDL_strtol #undef SDL_strtol #endif #ifdef SDL_strtoul #undef SDL_strtoul #endif #ifdef SDL_strtoll #undef SDL_strtoll #endif #ifdef SDL_strtoull #undef SDL_strtoull #endif #ifdef SDL_strtod #undef SDL_strtod #endif #ifdef SDL_strcmp #undef SDL_strcmp #endif #ifdef SDL_strncmp #undef SDL_strncmp #endif #ifdef SDL_strcasecmp #undef SDL_strcasecmp #endif #ifdef SDL_strncasecmp #undef SDL_strncasecmp #endif #ifdef SDL_vsnprintf #undef SDL_vsnprintf #endif #ifdef SDL_acos #undef SDL_acos #endif #ifdef SDL_asin #undef SDL_asin #endif #ifdef SDL_atan #undef SDL_atan #endif #ifdef SDL_atan2 #undef SDL_atan2 #endif #ifdef SDL_ceil #undef SDL_ceil #endif #ifdef SDL_copysign #undef SDL_copysign #endif #ifdef SDL_cos #undef SDL_cos #endif #ifdef SDL_cosf #undef SDL_cosf #endif #ifdef SDL_fabs #undef SDL_fabs #endif #ifdef SDL_floor #undef SDL_floor #endif #ifdef SDL_log #undef SDL_log #endif #ifdef SDL_pow #undef SDL_pow #endif #ifdef SDL_scalbn #undef SDL_scalbn #endif #ifdef SDL_sin #undef SDL_sin #endif #ifdef SDL_sinf #undef SDL_sinf #endif #ifdef SDL_sqrt #undef SDL_sqrt #endif #ifdef SDL_iconv_open #undef SDL_iconv_open #endif #ifdef SDL_iconv_close #undef SDL_iconv_close #endif #ifdef SDL_iconv #undef SDL_iconv #endif #ifdef SDL_iconv_string #undef SDL_iconv_string #endif #ifdef SDL_CreateRGBSurface #undef SDL_CreateRGBSurface #endif #ifdef SDL_CreateRGBSurfaceFrom #undef SDL_CreateRGBSurfaceFrom #endif #ifdef SDL_FreeSurface #undef SDL_FreeSurface #endif #ifdef SDL_SetSurfacePalette #undef SDL_SetSurfacePalette #endif #ifdef SDL_LockSurface #undef SDL_LockSurface #endif #ifdef SDL_UnlockSurface #undef SDL_UnlockSurface #endif #ifdef SDL_LoadBMP_RW #undef SDL_LoadBMP_RW #endif #ifdef SDL_SaveBMP_RW #undef SDL_SaveBMP_RW #endif #ifdef SDL_SetSurfaceRLE #undef SDL_SetSurfaceRLE #endif #ifdef SDL_SetColorKey #undef SDL_SetColorKey #endif #ifdef SDL_GetColorKey #undef SDL_GetColorKey #endif #ifdef SDL_SetSurfaceColorMod #undef SDL_SetSurfaceColorMod #endif #ifdef SDL_GetSurfaceColorMod #undef SDL_GetSurfaceColorMod #endif #ifdef SDL_SetSurfaceAlphaMod #undef SDL_SetSurfaceAlphaMod #endif #ifdef SDL_GetSurfaceAlphaMod #undef SDL_GetSurfaceAlphaMod #endif #ifdef SDL_SetSurfaceBlendMode #undef SDL_SetSurfaceBlendMode #endif #ifdef SDL_GetSurfaceBlendMode #undef SDL_GetSurfaceBlendMode #endif #ifdef SDL_SetClipRect #undef SDL_SetClipRect #endif #ifdef SDL_GetClipRect #undef SDL_GetClipRect #endif #ifdef SDL_ConvertSurface #undef SDL_ConvertSurface #endif #ifdef SDL_ConvertSurfaceFormat #undef SDL_ConvertSurfaceFormat #endif #ifdef SDL_ConvertPixels #undef SDL_ConvertPixels #endif #ifdef SDL_FillRect #undef SDL_FillRect #endif #ifdef SDL_FillRects #undef SDL_FillRects #endif #ifdef SDL_UpperBlit #undef SDL_UpperBlit #endif #ifdef SDL_LowerBlit #undef SDL_LowerBlit #endif #ifdef SDL_SoftStretch #undef SDL_SoftStretch #endif #ifdef SDL_UpperBlitScaled #undef SDL_UpperBlitScaled #endif #ifdef SDL_LowerBlitScaled #undef SDL_LowerBlitScaled #endif #ifdef SDL_GetWindowWMInfo #undef SDL_GetWindowWMInfo #endif #ifdef SDL_GetThreadName #undef SDL_GetThreadName #endif #ifdef SDL_ThreadID #undef SDL_ThreadID #endif #ifdef SDL_GetThreadID #undef SDL_GetThreadID #endif #ifdef SDL_SetThreadPriority #undef SDL_SetThreadPriority #endif #ifdef SDL_WaitThread #undef SDL_WaitThread #endif #ifdef SDL_DetachThread #undef SDL_DetachThread #endif #ifdef SDL_TLSCreate #undef SDL_TLSCreate #endif #ifdef SDL_TLSGet #undef SDL_TLSGet #endif #ifdef SDL_TLSSet #undef SDL_TLSSet #endif #ifdef SDL_GetTicks #undef SDL_GetTicks #endif #ifdef SDL_GetPerformanceCounter #undef SDL_GetPerformanceCounter #endif #ifdef SDL_GetPerformanceFrequency #undef SDL_GetPerformanceFrequency #endif #ifdef SDL_Delay #undef SDL_Delay #endif #ifdef SDL_AddTimer #undef SDL_AddTimer #endif #ifdef SDL_RemoveTimer #undef SDL_RemoveTimer #endif #ifdef SDL_GetNumTouchDevices #undef SDL_GetNumTouchDevices #endif #ifdef SDL_GetTouchDevice #undef SDL_GetTouchDevice #endif #ifdef SDL_GetNumTouchFingers #undef SDL_GetNumTouchFingers #endif #ifdef SDL_GetTouchFinger #undef SDL_GetTouchFinger #endif #ifdef SDL_GetVersion #undef SDL_GetVersion #endif #ifdef SDL_GetRevision #undef SDL_GetRevision #endif #ifdef SDL_GetRevisionNumber #undef SDL_GetRevisionNumber #endif #ifdef SDL_GetNumVideoDrivers #undef SDL_GetNumVideoDrivers #endif #ifdef SDL_GetVideoDriver #undef SDL_GetVideoDriver #endif #ifdef SDL_VideoInit #undef SDL_VideoInit #endif #ifdef SDL_VideoQuit #undef SDL_VideoQuit #endif #ifdef SDL_GetCurrentVideoDriver #undef SDL_GetCurrentVideoDriver #endif #ifdef SDL_GetNumVideoDisplays #undef SDL_GetNumVideoDisplays #endif #ifdef SDL_GetDisplayName #undef SDL_GetDisplayName #endif #ifdef SDL_GetDisplayBounds #undef SDL_GetDisplayBounds #endif #ifdef SDL_GetDisplayDPI #undef SDL_GetDisplayDPI #endif #ifdef SDL_GetNumDisplayModes #undef SDL_GetNumDisplayModes #endif #ifdef SDL_GetDisplayMode #undef SDL_GetDisplayMode #endif #ifdef SDL_GetDesktopDisplayMode #undef SDL_GetDesktopDisplayMode #endif #ifdef SDL_GetCurrentDisplayMode #undef SDL_GetCurrentDisplayMode #endif #ifdef SDL_GetClosestDisplayMode #undef SDL_GetClosestDisplayMode #endif #ifdef SDL_GetWindowDisplayIndex #undef SDL_GetWindowDisplayIndex #endif #ifdef SDL_SetWindowDisplayMode #undef SDL_SetWindowDisplayMode #endif #ifdef SDL_GetWindowDisplayMode #undef SDL_GetWindowDisplayMode #endif #ifdef SDL_GetWindowPixelFormat #undef SDL_GetWindowPixelFormat #endif #ifdef SDL_CreateWindow #undef SDL_CreateWindow #endif #ifdef SDL_CreateWindowFrom #undef SDL_CreateWindowFrom #endif #ifdef SDL_GetWindowID #undef SDL_GetWindowID #endif #ifdef SDL_GetWindowFromID #undef SDL_GetWindowFromID #endif #ifdef SDL_GetWindowFlags #undef SDL_GetWindowFlags #endif #ifdef SDL_SetWindowTitle #undef SDL_SetWindowTitle #endif #ifdef SDL_GetWindowTitle #undef SDL_GetWindowTitle #endif #ifdef SDL_SetWindowIcon #undef SDL_SetWindowIcon #endif #ifdef SDL_SetWindowData #undef SDL_SetWindowData #endif #ifdef SDL_GetWindowData #undef SDL_GetWindowData #endif #ifdef SDL_SetWindowPosition #undef SDL_SetWindowPosition #endif #ifdef SDL_GetWindowPosition #undef SDL_GetWindowPosition #endif #ifdef SDL_SetWindowSize #undef SDL_SetWindowSize #endif #ifdef SDL_GetWindowSize #undef SDL_GetWindowSize #endif #ifdef SDL_SetWindowMinimumSize #undef SDL_SetWindowMinimumSize #endif #ifdef SDL_GetWindowMinimumSize #undef SDL_GetWindowMinimumSize #endif #ifdef SDL_SetWindowMaximumSize #undef SDL_SetWindowMaximumSize #endif #ifdef SDL_GetWindowMaximumSize #undef SDL_GetWindowMaximumSize #endif #ifdef SDL_SetWindowBordered #undef SDL_SetWindowBordered #endif #ifdef SDL_ShowWindow #undef SDL_ShowWindow #endif #ifdef SDL_HideWindow #undef SDL_HideWindow #endif #ifdef SDL_RaiseWindow #undef SDL_RaiseWindow #endif #ifdef SDL_MaximizeWindow #undef SDL_MaximizeWindow #endif #ifdef SDL_MinimizeWindow #undef SDL_MinimizeWindow #endif #ifdef SDL_RestoreWindow #undef SDL_RestoreWindow #endif #ifdef SDL_SetWindowFullscreen #undef SDL_SetWindowFullscreen #endif #ifdef SDL_GetWindowSurface #undef SDL_GetWindowSurface #endif #ifdef SDL_UpdateWindowSurface #undef SDL_UpdateWindowSurface #endif #ifdef SDL_UpdateWindowSurfaceRects #undef SDL_UpdateWindowSurfaceRects #endif #ifdef SDL_SetWindowGrab #undef SDL_SetWindowGrab #endif #ifdef SDL_GetWindowGrab #undef SDL_GetWindowGrab #endif #ifdef SDL_SetWindowBrightness #undef SDL_SetWindowBrightness #endif #ifdef SDL_GetWindowBrightness #undef SDL_GetWindowBrightness #endif #ifdef SDL_SetWindowGammaRamp #undef SDL_SetWindowGammaRamp #endif #ifdef SDL_GetWindowGammaRamp #undef SDL_GetWindowGammaRamp #endif #ifdef SDL_DestroyWindow #undef SDL_DestroyWindow #endif #ifdef SDL_IsScreenSaverEnabled #undef SDL_IsScreenSaverEnabled #endif #ifdef SDL_EnableScreenSaver #undef SDL_EnableScreenSaver #endif #ifdef SDL_DisableScreenSaver #undef SDL_DisableScreenSaver #endif #ifdef SDL_GL_LoadLibrary #undef SDL_GL_LoadLibrary #endif #ifdef SDL_GL_GetProcAddress #undef SDL_GL_GetProcAddress #endif #ifdef SDL_GL_UnloadLibrary #undef SDL_GL_UnloadLibrary #endif #ifdef SDL_GL_ExtensionSupported #undef SDL_GL_ExtensionSupported #endif #ifdef SDL_GL_SetAttribute #undef SDL_GL_SetAttribute #endif #ifdef SDL_GL_GetAttribute #undef SDL_GL_GetAttribute #endif #ifdef SDL_GL_CreateContext #undef SDL_GL_CreateContext #endif #ifdef SDL_GL_MakeCurrent #undef SDL_GL_MakeCurrent #endif #ifdef SDL_GL_GetCurrentWindow #undef SDL_GL_GetCurrentWindow #endif #ifdef SDL_GL_GetCurrentContext #undef SDL_GL_GetCurrentContext #endif #ifdef SDL_GL_GetDrawableSize #undef SDL_GL_GetDrawableSize #endif #ifdef SDL_GL_SetSwapInterval #undef SDL_GL_SetSwapInterval #endif #ifdef SDL_GL_GetSwapInterval #undef SDL_GL_GetSwapInterval #endif #ifdef SDL_GL_SwapWindow #undef SDL_GL_SwapWindow #endif #ifdef SDL_GL_DeleteContext #undef SDL_GL_DeleteContext #endif #ifdef SDL_vsscanf #undef SDL_vsscanf #endif #ifdef SDL_GameControllerAddMappingsFromRW #undef SDL_GameControllerAddMappingsFromRW #endif #ifdef SDL_GL_ResetAttributes #undef SDL_GL_ResetAttributes #endif #ifdef SDL_HasAVX #undef SDL_HasAVX #endif #ifdef SDL_GetDefaultAssertionHandler #undef SDL_GetDefaultAssertionHandler #endif #ifdef SDL_GetAssertionHandler #undef SDL_GetAssertionHandler #endif #ifdef SDL_DXGIGetOutputInfo #undef SDL_DXGIGetOutputInfo #endif #ifdef SDL_RenderIsClipEnabled #undef SDL_RenderIsClipEnabled #endif #ifdef SDL_WinRTRunApp #undef SDL_WinRTRunApp #endif #ifdef SDL_WarpMouseGlobal #undef SDL_WarpMouseGlobal #endif #ifdef SDL_WinRTGetFSPathUNICODE #undef SDL_WinRTGetFSPathUNICODE #endif #ifdef SDL_WinRTGetFSPathUTF8 #undef SDL_WinRTGetFSPathUTF8 #endif #ifdef SDL_sqrtf #undef SDL_sqrtf #endif #ifdef SDL_tan #undef SDL_tan #endif #ifdef SDL_tanf #undef SDL_tanf #endif #ifdef SDL_CaptureMouse #undef SDL_CaptureMouse #endif #ifdef SDL_SetWindowHitTest #undef SDL_SetWindowHitTest #endif #ifdef SDL_GetGlobalMouseState #undef SDL_GetGlobalMouseState #endif #ifdef SDL_HasAVX2 #undef SDL_HasAVX2 #endif #ifdef SDL_QueueAudio #undef SDL_QueueAudio #endif #ifdef SDL_GetQueuedAudioSize #undef SDL_GetQueuedAudioSize #endif #ifdef SDL_ClearQueuedAudio #undef SDL_ClearQueuedAudio #endif #ifdef SDL_GetGrabbedWindow #undef SDL_GetGrabbedWindow #endif #ifdef SDL_SetWindowsMessageHook #undef SDL_SetWindowsMessageHook #endif #ifdef SDL_JoystickCurrentPowerLevel #undef SDL_JoystickCurrentPowerLevel #endif #ifdef SDL_GameControllerFromInstanceID #undef SDL_GameControllerFromInstanceID #endif #ifdef SDL_JoystickFromInstanceID #undef SDL_JoystickFromInstanceID #endif #ifdef SDL_GetDisplayUsableBounds #undef SDL_GetDisplayUsableBounds #endif #ifdef SDL_GetWindowBordersSize #undef SDL_GetWindowBordersSize #endif #ifdef SDL_SetWindowOpacity #undef SDL_SetWindowOpacity #endif #ifdef SDL_GetWindowOpacity #undef SDL_GetWindowOpacity #endif #ifdef SDL_SetWindowInputFocus #undef SDL_SetWindowInputFocus #endif #ifdef SDL_SetWindowModalFor #undef SDL_SetWindowModalFor #endif #ifdef SDL_RenderSetIntegerScale #undef SDL_RenderSetIntegerScale #endif #ifdef SDL_RenderGetIntegerScale #undef SDL_RenderGetIntegerScale #endif #ifdef SDL_DequeueAudio #undef SDL_DequeueAudio #endif #ifdef SDL_SetWindowResizable #undef SDL_SetWindowResizable #endif #ifdef SDL_CreateRGBSurfaceWithFormat #undef SDL_CreateRGBSurfaceWithFormat #endif #ifdef SDL_CreateRGBSurfaceWithFormatFrom #undef SDL_CreateRGBSurfaceWithFormatFrom #endif #ifdef SDL_GetHintBoolean #undef SDL_GetHintBoolean #endif #ifdef SDL_JoystickGetDeviceVendor #undef SDL_JoystickGetDeviceVendor #endif #ifdef SDL_JoystickGetDeviceProduct #undef SDL_JoystickGetDeviceProduct #endif #ifdef SDL_JoystickGetDeviceProductVersion #undef SDL_JoystickGetDeviceProductVersion #endif #ifdef SDL_JoystickGetVendor #undef SDL_JoystickGetVendor #endif #ifdef SDL_JoystickGetProduct #undef SDL_JoystickGetProduct #endif #ifdef SDL_JoystickGetProductVersion #undef SDL_JoystickGetProductVersion #endif #ifdef SDL_GameControllerGetVendor #undef SDL_GameControllerGetVendor #endif #ifdef SDL_GameControllerGetProduct #undef SDL_GameControllerGetProduct #endif #ifdef SDL_GameControllerGetProductVersion #undef SDL_GameControllerGetProductVersion #endif #ifdef SDL_HasNEON #undef SDL_HasNEON #endif #ifdef SDL_GameControllerNumMappings #undef SDL_GameControllerNumMappings #endif #ifdef SDL_GameControllerMappingForIndex #undef SDL_GameControllerMappingForIndex #endif #ifdef SDL_JoystickGetAxisInitialState #undef SDL_JoystickGetAxisInitialState #endif #ifdef SDL_JoystickGetDeviceType #undef SDL_JoystickGetDeviceType #endif #ifdef SDL_JoystickGetType #undef SDL_JoystickGetType #endif #ifdef SDL_MemoryBarrierReleaseFunction #undef SDL_MemoryBarrierReleaseFunction #endif #ifdef SDL_MemoryBarrierAcquireFunction #undef SDL_MemoryBarrierAcquireFunction #endif #ifdef SDL_JoystickGetDeviceInstanceID #undef SDL_JoystickGetDeviceInstanceID #endif #ifdef SDL_utf8strlen #undef SDL_utf8strlen #endif #ifdef SDL_LoadFile_RW #undef SDL_LoadFile_RW #endif #ifdef SDL_wcscmp #undef SDL_wcscmp #endif #ifdef SDL_ComposeCustomBlendMode #undef SDL_ComposeCustomBlendMode #endif #ifdef SDL_DuplicateSurface #undef SDL_DuplicateSurface #endif #ifdef SDL_Vulkan_LoadLibrary #undef SDL_Vulkan_LoadLibrary #endif #ifdef SDL_Vulkan_GetVkGetInstanceProcAddr #undef SDL_Vulkan_GetVkGetInstanceProcAddr #endif #ifdef SDL_Vulkan_UnloadLibrary #undef SDL_Vulkan_UnloadLibrary #endif #ifdef SDL_Vulkan_GetInstanceExtensions #undef SDL_Vulkan_GetInstanceExtensions #endif #ifdef SDL_Vulkan_CreateSurface #undef SDL_Vulkan_CreateSurface #endif #ifdef SDL_Vulkan_GetDrawableSize #undef SDL_Vulkan_GetDrawableSize #endif #ifdef SDL_LockJoysticks #undef SDL_LockJoysticks #endif #ifdef SDL_UnlockJoysticks #undef SDL_UnlockJoysticks #endif #ifdef SDL_GetMemoryFunctions #undef SDL_GetMemoryFunctions #endif #ifdef SDL_SetMemoryFunctions #undef SDL_SetMemoryFunctions #endif #ifdef SDL_GetNumAllocations #undef SDL_GetNumAllocations #endif #ifdef SDL_NewAudioStream #undef SDL_NewAudioStream #endif #ifdef SDL_AudioStreamPut #undef SDL_AudioStreamPut #endif #ifdef SDL_AudioStreamGet #undef SDL_AudioStreamGet #endif #ifdef SDL_AudioStreamClear #undef SDL_AudioStreamClear #endif #ifdef SDL_AudioStreamAvailable #undef SDL_AudioStreamAvailable #endif #ifdef SDL_FreeAudioStream #undef SDL_FreeAudioStream #endif #ifdef SDL_AudioStreamFlush #undef SDL_AudioStreamFlush #endif #ifdef SDL_acosf #undef SDL_acosf #endif #ifdef SDL_asinf #undef SDL_asinf #endif #ifdef SDL_atanf #undef SDL_atanf #endif #ifdef SDL_atan2f #undef SDL_atan2f #endif #ifdef SDL_ceilf #undef SDL_ceilf #endif #ifdef SDL_copysignf #undef SDL_copysignf #endif #ifdef SDL_fabsf #undef SDL_fabsf #endif #ifdef SDL_floorf #undef SDL_floorf #endif #ifdef SDL_logf #undef SDL_logf #endif #ifdef SDL_powf #undef SDL_powf #endif #ifdef SDL_scalbnf #undef SDL_scalbnf #endif #ifdef SDL_fmod #undef SDL_fmod #endif #ifdef SDL_fmodf #undef SDL_fmodf #endif #ifdef SDL_SetYUVConversionMode #undef SDL_SetYUVConversionMode #endif #ifdef SDL_GetYUVConversionMode #undef SDL_GetYUVConversionMode #endif #ifdef SDL_GetYUVConversionModeForResolution #undef SDL_GetYUVConversionModeForResolution #endif #ifdef SDL_RenderGetMetalLayer #undef SDL_RenderGetMetalLayer #endif #ifdef SDL_RenderGetMetalCommandEncoder #undef SDL_RenderGetMetalCommandEncoder #endif #ifdef SDL_IsAndroidTV #undef SDL_IsAndroidTV #endif #ifdef SDL_WinRTGetDeviceFamily #undef SDL_WinRTGetDeviceFamily #endif #ifdef SDL_log10 #undef SDL_log10 #endif #ifdef SDL_log10f #undef SDL_log10f #endif #ifdef SDL_GameControllerMappingForDeviceIndex #undef SDL_GameControllerMappingForDeviceIndex #endif #ifdef SDL_LinuxSetThreadPriority #undef SDL_LinuxSetThreadPriority #endif #ifdef SDL_HasAVX512F #undef SDL_HasAVX512F #endif #ifdef SDL_IsChromebook #undef SDL_IsChromebook #endif #ifdef SDL_IsDeXMode #undef SDL_IsDeXMode #endif #ifdef SDL_AndroidBackButton #undef SDL_AndroidBackButton #endif #ifdef SDL_exp #undef SDL_exp #endif #ifdef SDL_expf #undef SDL_expf #endif #ifdef SDL_wcsdup #undef SDL_wcsdup #endif #ifdef SDL_GameControllerRumble #undef SDL_GameControllerRumble #endif #ifdef SDL_JoystickRumble #undef SDL_JoystickRumble #endif #ifdef SDL_NumSensors #undef SDL_NumSensors #endif #ifdef SDL_SensorGetDeviceName #undef SDL_SensorGetDeviceName #endif #ifdef SDL_SensorGetDeviceType #undef SDL_SensorGetDeviceType #endif #ifdef SDL_SensorGetDeviceNonPortableType #undef SDL_SensorGetDeviceNonPortableType #endif #ifdef SDL_SensorGetDeviceInstanceID #undef SDL_SensorGetDeviceInstanceID #endif #ifdef SDL_SensorOpen #undef SDL_SensorOpen #endif #ifdef SDL_SensorFromInstanceID #undef SDL_SensorFromInstanceID #endif #ifdef SDL_SensorGetName #undef SDL_SensorGetName #endif #ifdef SDL_SensorGetType #undef SDL_SensorGetType #endif #ifdef SDL_SensorGetNonPortableType #undef SDL_SensorGetNonPortableType #endif #ifdef SDL_SensorGetInstanceID #undef SDL_SensorGetInstanceID #endif #ifdef SDL_SensorGetData #undef SDL_SensorGetData #endif #ifdef SDL_SensorClose #undef SDL_SensorClose #endif #ifdef SDL_SensorUpdate #undef SDL_SensorUpdate #endif #ifdef SDL_IsTablet #undef SDL_IsTablet #endif #ifdef SDL_GetDisplayOrientation #undef SDL_GetDisplayOrientation #endif #ifdef SDL_HasColorKey #undef SDL_HasColorKey #endif #ifdef SDL_CreateThreadWithStackSize #undef SDL_CreateThreadWithStackSize #endif #ifdef SDL_JoystickGetDevicePlayerIndex #undef SDL_JoystickGetDevicePlayerIndex #endif #ifdef SDL_JoystickGetPlayerIndex #undef SDL_JoystickGetPlayerIndex #endif #ifdef SDL_GameControllerGetPlayerIndex #undef SDL_GameControllerGetPlayerIndex #endif #ifdef SDL_RenderFlush #undef SDL_RenderFlush #endif #ifdef SDL_RenderDrawPointF #undef SDL_RenderDrawPointF #endif #ifdef SDL_RenderDrawPointsF #undef SDL_RenderDrawPointsF #endif #ifdef SDL_RenderDrawLineF #undef SDL_RenderDrawLineF #endif #ifdef SDL_RenderDrawLinesF #undef SDL_RenderDrawLinesF #endif #ifdef SDL_RenderDrawRectF #undef SDL_RenderDrawRectF #endif #ifdef SDL_RenderDrawRectsF #undef SDL_RenderDrawRectsF #endif #ifdef SDL_RenderFillRectF #undef SDL_RenderFillRectF #endif #ifdef SDL_RenderFillRectsF #undef SDL_RenderFillRectsF #endif #ifdef SDL_RenderCopyF #undef SDL_RenderCopyF #endif #ifdef SDL_RenderCopyExF #undef SDL_RenderCopyExF #endif #ifdef SDL_GetTouchDeviceType #undef SDL_GetTouchDeviceType #endif #ifdef SDL_UIKitRunApp #undef SDL_UIKitRunApp #endif #ifdef SDL_SIMDGetAlignment #undef SDL_SIMDGetAlignment #endif #ifdef SDL_SIMDAlloc #undef SDL_SIMDAlloc #endif #ifdef SDL_SIMDFree #undef SDL_SIMDFree #endif #ifdef SDL_RWsize #undef SDL_RWsize #endif #ifdef SDL_RWseek #undef SDL_RWseek #endif #ifdef SDL_RWtell #undef SDL_RWtell #endif #ifdef SDL_RWread #undef SDL_RWread #endif #ifdef SDL_RWwrite #undef SDL_RWwrite #endif #ifdef SDL_RWclose #undef SDL_RWclose #endif #ifdef SDL_LoadFile #undef SDL_LoadFile #endif #ifdef SDL_Metal_CreateView #undef SDL_Metal_CreateView #endif #ifdef SDL_Metal_DestroyView #undef SDL_Metal_DestroyView #endif #ifdef SDL_LockTextureToSurface #undef SDL_LockTextureToSurface #endif #ifdef SDL_HasARMSIMD #undef SDL_HasARMSIMD #endif #ifdef SDL_strtokr #undef SDL_strtokr #endif #ifdef SDL_wcsstr #undef SDL_wcsstr #endif #ifdef SDL_wcsncmp #undef SDL_wcsncmp #endif #ifdef SDL_GameControllerTypeForIndex #undef SDL_GameControllerTypeForIndex #endif #ifdef SDL_GameControllerGetType #undef SDL_GameControllerGetType #endif #ifdef SDL_GameControllerFromPlayerIndex #undef SDL_GameControllerFromPlayerIndex #endif #ifdef SDL_GameControllerSetPlayerIndex #undef SDL_GameControllerSetPlayerIndex #endif #ifdef SDL_JoystickFromPlayerIndex #undef SDL_JoystickFromPlayerIndex #endif #ifdef SDL_JoystickSetPlayerIndex #undef SDL_JoystickSetPlayerIndex #endif #ifdef SDL_SetTextureScaleMode #undef SDL_SetTextureScaleMode #endif #ifdef SDL_GetTextureScaleMode #undef SDL_GetTextureScaleMode #endif #ifdef SDL_OnApplicationWillTerminate #undef SDL_OnApplicationWillTerminate #endif #ifdef SDL_OnApplicationDidReceiveMemoryWarning #undef SDL_OnApplicationDidReceiveMemoryWarning #endif #ifdef SDL_OnApplicationWillResignActive #undef SDL_OnApplicationWillResignActive #endif #ifdef SDL_OnApplicationDidEnterBackground #undef SDL_OnApplicationDidEnterBackground #endif #ifdef SDL_OnApplicationWillEnterForeground #undef SDL_OnApplicationWillEnterForeground #endif #ifdef SDL_OnApplicationDidBecomeActive #undef SDL_OnApplicationDidBecomeActive #endif #ifdef SDL_OnApplicationDidChangeStatusBarOrientation #undef SDL_OnApplicationDidChangeStatusBarOrientation #endif #ifdef SDL_GetAndroidSDKVersion #undef SDL_GetAndroidSDKVersion #endif #ifdef SDL_isupper #undef SDL_isupper #endif #ifdef SDL_islower #undef SDL_islower #endif #ifdef SDL_JoystickAttachVirtual #undef SDL_JoystickAttachVirtual #endif #ifdef SDL_JoystickDetachVirtual #undef SDL_JoystickDetachVirtual #endif #ifdef SDL_JoystickIsVirtual #undef SDL_JoystickIsVirtual #endif #ifdef SDL_JoystickSetVirtualAxis #undef SDL_JoystickSetVirtualAxis #endif #ifdef SDL_JoystickSetVirtualButton #undef SDL_JoystickSetVirtualButton #endif #ifdef SDL_JoystickSetVirtualHat #undef SDL_JoystickSetVirtualHat #endif #ifdef SDL_GetErrorMsg #undef SDL_GetErrorMsg #endif #ifdef SDL_LockSensors #undef SDL_LockSensors #endif #ifdef SDL_UnlockSensors #undef SDL_UnlockSensors #endif #ifdef SDL_Metal_GetLayer #undef SDL_Metal_GetLayer #endif #ifdef SDL_Metal_GetDrawableSize #undef SDL_Metal_GetDrawableSize #endif #ifdef SDL_trunc #undef SDL_trunc #endif #ifdef SDL_truncf #undef SDL_truncf #endif #ifdef SDL_GetPreferredLocales #undef SDL_GetPreferredLocales #endif #ifdef SDL_SIMDRealloc #undef SDL_SIMDRealloc #endif #ifdef SDL_AndroidRequestPermission #undef SDL_AndroidRequestPermission #endif #ifdef SDL_OpenURL #undef SDL_OpenURL #endif #ifdef SDL_HasSurfaceRLE #undef SDL_HasSurfaceRLE #endif #ifdef SDL_GameControllerHasLED #undef SDL_GameControllerHasLED #endif #ifdef SDL_GameControllerSetLED #undef SDL_GameControllerSetLED #endif #ifdef SDL_JoystickHasLED #undef SDL_JoystickHasLED #endif #ifdef SDL_JoystickSetLED #undef SDL_JoystickSetLED #endif #ifdef SDL_GameControllerRumbleTriggers #undef SDL_GameControllerRumbleTriggers #endif #ifdef SDL_JoystickRumbleTriggers #undef SDL_JoystickRumbleTriggers #endif #ifdef SDL_GameControllerHasAxis #undef SDL_GameControllerHasAxis #endif #ifdef SDL_GameControllerHasButton #undef SDL_GameControllerHasButton #endif #ifdef SDL_GameControllerGetNumTouchpads #undef SDL_GameControllerGetNumTouchpads #endif #ifdef SDL_GameControllerGetNumTouchpadFingers #undef SDL_GameControllerGetNumTouchpadFingers #endif #ifdef SDL_GameControllerGetTouchpadFinger #undef SDL_GameControllerGetTouchpadFinger #endif #ifdef SDL_crc32 #undef SDL_crc32 #endif #ifdef SDL_GameControllerGetSerial #undef SDL_GameControllerGetSerial #endif #ifdef SDL_JoystickGetSerial #undef SDL_JoystickGetSerial #endif #ifdef SDL_GameControllerHasSensor #undef SDL_GameControllerHasSensor #endif #ifdef SDL_GameControllerSetSensorEnabled #undef SDL_GameControllerSetSensorEnabled #endif #ifdef SDL_GameControllerIsSensorEnabled #undef SDL_GameControllerIsSensorEnabled #endif #ifdef SDL_GameControllerGetSensorData #undef SDL_GameControllerGetSensorData #endif #ifdef SDL_wcscasecmp #undef SDL_wcscasecmp #endif #ifdef SDL_wcsncasecmp #undef SDL_wcsncasecmp #endif #ifdef SDL_round #undef SDL_round #endif #ifdef SDL_roundf #undef SDL_roundf #endif #ifdef SDL_lround #undef SDL_lround #endif #ifdef SDL_lroundf #undef SDL_lroundf #endif #ifdef SDL_SoftStretchLinear #undef SDL_SoftStretchLinear #endif #ifdef SDL_RenderGetD3D11Device #undef SDL_RenderGetD3D11Device #endif #ifdef SDL_UpdateNVTexture #undef SDL_UpdateNVTexture #endif #ifdef SDL_SetWindowKeyboardGrab #undef SDL_SetWindowKeyboardGrab #endif #ifdef SDL_SetWindowMouseGrab #undef SDL_SetWindowMouseGrab #endif #ifdef SDL_GetWindowKeyboardGrab #undef SDL_GetWindowKeyboardGrab #endif #ifdef SDL_GetWindowMouseGrab #undef SDL_GetWindowMouseGrab #endif #ifdef SDL_isalpha #undef SDL_isalpha #endif #ifdef SDL_isalnum #undef SDL_isalnum #endif #ifdef SDL_isblank #undef SDL_isblank #endif #ifdef SDL_iscntrl #undef SDL_iscntrl #endif #ifdef SDL_isxdigit #undef SDL_isxdigit #endif #ifdef SDL_ispunct #undef SDL_ispunct #endif #ifdef SDL_isprint #undef SDL_isprint #endif #ifdef SDL_isgraph #undef SDL_isgraph #endif #ifdef SDL_AndroidShowToast #undef SDL_AndroidShowToast #endif #ifdef SDL_GetAudioDeviceSpec #undef SDL_GetAudioDeviceSpec #endif #ifdef SDL_TLSCleanup #undef SDL_TLSCleanup #endif #ifdef SDL_SetWindowAlwaysOnTop #undef SDL_SetWindowAlwaysOnTop #endif #ifdef SDL_FlashWindow #undef SDL_FlashWindow #endif #ifdef SDL_GameControllerSendEffect #undef SDL_GameControllerSendEffect #endif #ifdef SDL_JoystickSendEffect #undef SDL_JoystickSendEffect #endif #ifdef SDL_GameControllerGetSensorDataRate #undef SDL_GameControllerGetSensorDataRate #endif #ifdef SDL_SetTextureUserData #undef SDL_SetTextureUserData #endif #ifdef SDL_GetTextureUserData #undef SDL_GetTextureUserData #endif #ifdef SDL_RenderGeometry #undef SDL_RenderGeometry #endif #ifdef SDL_RenderGeometryRaw #undef SDL_RenderGeometryRaw #endif #ifdef SDL_RenderSetVSync #undef SDL_RenderSetVSync #endif #ifdef SDL_asprintf #undef SDL_asprintf #endif #ifdef SDL_vasprintf #undef SDL_vasprintf #endif #ifdef SDL_GetWindowICCProfile #undef SDL_GetWindowICCProfile #endif #ifdef SDL_GetTicks64 #undef SDL_GetTicks64 #endif #ifdef SDL_LinuxSetThreadPriorityAndPolicy #undef SDL_LinuxSetThreadPriorityAndPolicy #endif #ifdef SDL_GameControllerGetAppleSFSymbolsNameForButton #undef SDL_GameControllerGetAppleSFSymbolsNameForButton #endif #ifdef SDL_GameControllerGetAppleSFSymbolsNameForAxis #undef SDL_GameControllerGetAppleSFSymbolsNameForAxis #endif #ifdef SDL_hid_init #undef SDL_hid_init #endif #ifdef SDL_hid_exit #undef SDL_hid_exit #endif #ifdef SDL_hid_device_change_count #undef SDL_hid_device_change_count #endif #ifdef SDL_hid_enumerate #undef SDL_hid_enumerate #endif #ifdef SDL_hid_free_enumeration #undef SDL_hid_free_enumeration #endif #ifdef SDL_hid_open #undef SDL_hid_open #endif #ifdef SDL_hid_open_path #undef SDL_hid_open_path #endif #ifdef SDL_hid_write #undef SDL_hid_write #endif #ifdef SDL_hid_read_timeout #undef SDL_hid_read_timeout #endif #ifdef SDL_hid_read #undef SDL_hid_read #endif #ifdef SDL_hid_set_nonblocking #undef SDL_hid_set_nonblocking #endif #ifdef SDL_hid_send_feature_report #undef SDL_hid_send_feature_report #endif #ifdef SDL_hid_get_feature_report #undef SDL_hid_get_feature_report #endif #ifdef SDL_hid_close #undef SDL_hid_close #endif #ifdef SDL_hid_get_manufacturer_string #undef SDL_hid_get_manufacturer_string #endif #ifdef SDL_hid_get_product_string #undef SDL_hid_get_product_string #endif #ifdef SDL_hid_get_serial_number_string #undef SDL_hid_get_serial_number_string #endif #ifdef SDL_hid_get_indexed_string #undef SDL_hid_get_indexed_string #endif #ifdef SDL_SetWindowMouseRect #undef SDL_SetWindowMouseRect #endif #ifdef SDL_GetWindowMouseRect #undef SDL_GetWindowMouseRect #endif #ifdef SDL_RenderWindowToLogical #undef SDL_RenderWindowToLogical #endif #ifdef SDL_RenderLogicalToWindow #undef SDL_RenderLogicalToWindow #endif #ifdef SDL_JoystickHasRumble #undef SDL_JoystickHasRumble #endif #ifdef SDL_JoystickHasRumbleTriggers #undef SDL_JoystickHasRumbleTriggers #endif #ifdef SDL_GameControllerHasRumble #undef SDL_GameControllerHasRumble #endif #ifdef SDL_GameControllerHasRumbleTriggers #undef SDL_GameControllerHasRumbleTriggers #endif #ifdef SDL_hid_ble_scan #undef SDL_hid_ble_scan #endif #ifdef SDL_PremultiplyAlpha #undef SDL_PremultiplyAlpha #endif #ifdef SDL_AndroidSendMessage #undef SDL_AndroidSendMessage #endif #ifdef SDL_GetTouchName #undef SDL_GetTouchName #endif #ifdef SDL_ClearComposition #undef SDL_ClearComposition #endif #ifdef SDL_IsTextInputShown #undef SDL_IsTextInputShown #endif #ifdef SDL_HasIntersectionF #undef SDL_HasIntersectionF #endif #ifdef SDL_IntersectFRect #undef SDL_IntersectFRect #endif #ifdef SDL_UnionFRect #undef SDL_UnionFRect #endif #ifdef SDL_EncloseFPoints #undef SDL_EncloseFPoints #endif #ifdef SDL_IntersectFRectAndLine #undef SDL_IntersectFRectAndLine #endif #ifdef SDL_RenderGetWindow #undef SDL_RenderGetWindow #endif #ifdef SDL_bsearch #undef SDL_bsearch #endif #ifdef SDL_GameControllerPathForIndex #undef SDL_GameControllerPathForIndex #endif #ifdef SDL_GameControllerPath #undef SDL_GameControllerPath #endif #ifdef SDL_JoystickPathForIndex #undef SDL_JoystickPathForIndex #endif #ifdef SDL_JoystickPath #undef SDL_JoystickPath #endif #ifdef SDL_JoystickAttachVirtualEx #undef SDL_JoystickAttachVirtualEx #endif #ifdef SDL_GameControllerGetFirmwareVersion #undef SDL_GameControllerGetFirmwareVersion #endif #ifdef SDL_JoystickGetFirmwareVersion #undef SDL_JoystickGetFirmwareVersion #endif #ifdef SDL_GUIDToString #undef SDL_GUIDToString #endif #ifdef SDL_GUIDFromString #undef SDL_GUIDFromString #endif #ifdef SDL_HasLSX #undef SDL_HasLSX #endif #ifdef SDL_HasLASX #undef SDL_HasLASX #endif #ifdef SDL_RenderGetD3D12Device #undef SDL_RenderGetD3D12Device #endif #ifdef SDL_utf8strnlen #undef SDL_utf8strnlen #endif #ifdef SDL_GDKGetTaskQueue #undef SDL_GDKGetTaskQueue #endif #ifdef SDL_GDKRunApp #undef SDL_GDKRunApp #endif #ifdef SDL_GetOriginalMemoryFunctions #undef SDL_GetOriginalMemoryFunctions #endif #ifdef SDL_ResetKeyboard #undef SDL_ResetKeyboard #endif #ifdef SDL_GetDefaultAudioInfo #undef SDL_GetDefaultAudioInfo #endif #ifdef SDL_GetPointDisplayIndex #undef SDL_GetPointDisplayIndex #endif #ifdef SDL_GetRectDisplayIndex #undef SDL_GetRectDisplayIndex #endif #ifdef SDL_ResetHint #undef SDL_ResetHint #endif #ifdef SDL_crc16 #undef SDL_crc16 #endif #ifdef SDL_GetWindowSizeInPixels #undef SDL_GetWindowSizeInPixels #endif #ifdef SDL_GetJoystickGUIDInfo #undef SDL_GetJoystickGUIDInfo #endif #ifdef SDL_SetPrimarySelectionText #undef SDL_SetPrimarySelectionText #endif #ifdef SDL_GetPrimarySelectionText #undef SDL_GetPrimarySelectionText #endif #ifdef SDL_HasPrimarySelectionText #undef SDL_HasPrimarySelectionText #endif #ifdef SDL_GameControllerGetSensorDataWithTimestamp #undef SDL_GameControllerGetSensorDataWithTimestamp #endif #ifdef SDL_SensorGetDataWithTimestamp #undef SDL_SensorGetDataWithTimestamp #endif #ifdef SDL_ResetHints #undef SDL_ResetHints #endif #ifdef SDL_strcasestr #undef SDL_strcasestr #endif #ifdef SDL_GDKSuspendComplete #undef SDL_GDKSuspendComplete #endif #ifdef SDL_HasWindowSurface #undef SDL_HasWindowSurface #endif #ifdef SDL_DestroyWindowSurface #undef SDL_DestroyWindowSurface #endif #ifdef SDL_GDKGetDefaultUser #undef SDL_GDKGetDefaultUser #endif #ifdef SDL_GameControllerGetSteamHandle #undef SDL_GameControllerGetSteamHandle #endif /* undefine these macros, too: redefine as SDL2_xxx, if needed. */ #ifdef SDL_BlitSurface #undef SDL_BlitSurface #endif #ifdef SDL_mutexP #undef SDL_mutexP #endif #ifdef SDL_mutexV #undef SDL_mutexV #endif #ifdef SDL_enabled_assert #undef SDL_enabled_assert #endif #ifdef SDL_OutOfMemory #undef SDL_OutOfMemory #endif #ifdef SDL_Unsupported #undef SDL_Unsupported #endif #ifdef SDL_InvalidParamError #undef SDL_InvalidParamError #endif #ifdef AtomicIncRef #undef AtomicIncRef #endif #ifdef SDL_AtomicDecRef #undef SDL_AtomicDecRef #endif #ifdef SDL_copyp #undef SDL_copyp #endif #ifdef SDL_zero #undef SDL_zero #endif #ifdef SDL_zeroa #undef SDL_zeroa #endif #ifdef SDL_zerop #undef SDL_zerop #endif #ifdef SDL_stack_alloc #undef SDL_stack_alloc #endif #ifdef SDL_stack_free #undef SDL_stack_free #endif #ifdef SDL_iconv_utf8_locale #undef SDL_iconv_utf8_locale #endif #ifdef SDL_iconv_utf8_ucs2 #undef SDL_iconv_utf8_ucs2 #endif #ifdef SDL_iconv_utf8_ucs4 #undef SDL_iconv_utf8_ucs4 #endif #ifdef SDL_iconv_wchar_utf8 #undef SDL_iconv_wchar_utf8 #endif #ifdef SDL_LoadWAV #undef SDL_LoadWAV #endif #ifdef SDL_LoadBMP #undef SDL_LoadBMP #endif #ifdef SDL_SaveBMP #undef SDL_SaveBMP #endif #ifdef SDL_GameControllerAddMappingsFromFile #undef SDL_GameControllerAddMappingsFromFile #endif #ifdef SDL_iOSSetAnimationCallback #undef SDL_iOSSetAnimationCallback #endif #ifdef SDL_iOSSetEventPump #undef SDL_iOSSetEventPump #endif #endif /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/src/SDL20_syms.h0000664000000000000000000006252515127765601013566 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* don't #pragma once this file, it gets #included multiple times! */ #ifndef SDL20_SYM #define SDL20_SYM(rc,fn,params,args,ret) #endif #ifndef SDL20_SYM_PASSTHROUGH #define SDL20_SYM_PASSTHROUGH(rc,fn,params,args,ret) SDL20_SYM(rc,fn,params,args,ret) #endif #ifndef SDL20_SYM_VARARGS #define SDL20_SYM_VARARGS(rc,fn,params) SDL20_SYM(rc,fn,params,unused,unused) #endif #ifndef OPENGL_SYM #define OPENGL_SYM(ext,rc,fn,params,args,ret) #endif #ifndef OPENGL_EXT #define OPENGL_EXT(name) #endif SDL20_SYM(void,GetVersion,(SDL_version *a),(a),) SDL20_SYM_VARARGS(void,Log,(const char *fmt, ...)) SDL20_SYM(int,Init,(Uint32 a),(a),return) SDL20_SYM(int,InitSubSystem,(Uint32 a),(a),return) SDL20_SYM(Uint32,WasInit,(Uint32 a),(a),return) SDL20_SYM(const char*,GetError,(void),(),return) SDL20_SYM_VARARGS(int,SetError,(const char *fmt, ...)) SDL20_SYM(const char *,GetHint,(const char *a),(a),return) SDL20_SYM(SDL_bool,SetHint,(const char *a, const char *b),(a, b),return) SDL20_SYM(int,Error,(SDL_errorcode a),(a),return) SDL20_SYM_PASSTHROUGH(void,ClearError,(void),(),) SDL20_SYM(void,Quit,(void),(),) SDL20_SYM(void,QuitSubSystem,(Uint32 a),(a),) SDL20_SYM(int,VideoInit,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(void,VideoQuit,(void),(),) SDL20_SYM_PASSTHROUGH(int,AudioInit,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(void,AudioQuit,(void),(),) SDL20_SYM(const char *,GetCurrentAudioDriver,(void),(),return) SDL20_SYM(const char *,GetCurrentVideoDriver,(void),(),return) SDL20_SYM(SDL_assert_state,ReportAssertion,(SDL_assert_data *a,const char *b,const char *c, int d),(a,b,c,d),return) SDL20_SYM(int,PollEvent,(SDL_Event *a),(a),return) SDL20_SYM(void,PumpEvents,(void),(),) SDL20_SYM(void,SetEventFilter,(SDL_EventFilter a, void *b),(a,b),) SDL20_SYM(void,AddEventWatch,(SDL_EventFilter a, void *b),(a,b),) SDL20_SYM(void,DelEventWatch,(SDL_EventFilter a, void *b),(a,b),) SDL20_SYM(Uint8,EventState,(Uint32 a, int b),(a,b),return) SDL20_SYM(SDL_bool,GetWindowWMInfo,(SDL_Window *a, SDL_SysWMinfo *b),(a,b),) SDL20_SYM(int,GetNumVideoDisplays,(void),(),return) SDL20_SYM(int,GetNumDisplayModes,(int a),(a),return) SDL20_SYM(int,GetDisplayMode,(int a, int b, SDL_DisplayMode *c),(a,b,c),return) SDL20_SYM(int,GetDesktopDisplayMode,(int a, SDL_DisplayMode *b),(a,b),return) SDL20_SYM(int,GetCurrentDisplayMode,(int a, SDL_DisplayMode *b),(a,b),return) SDL20_SYM(int,GetWindowDisplayMode,(SDL_Window *a, SDL_DisplayMode *b),(a,b),return) SDL20_SYM(SDL_DisplayMode *,GetClosestDisplayMode,(int a, const SDL_DisplayMode *b, SDL_DisplayMode *c),(a,b,c),return) SDL20_SYM(int,GetWindowDisplayIndex,(SDL_Window *a),(a),return) SDL20_SYM(int,SetWindowDisplayMode,(SDL_Window *a, const SDL_DisplayMode *b),(a,b),return) SDL20_SYM(SDL_Window *,CreateWindow,(const char *a, int b, int c, int d, int e, Uint32 f),(a,b,c,d,e,f),return) SDL20_SYM(SDL_Window *,CreateWindowFrom,(const void *a),(a),return) SDL20_SYM(void,DestroyWindow,(SDL_Window *a),(a),) SDL20_SYM(void,SetWindowIcon,(SDL_Window *a,SDL_Surface *b),(a,b),) SDL20_SYM(int,UpdateWindowSurface,(SDL_Window *a),(a),return) SDL20_SYM(SDL_Surface *,GetWindowSurface,(SDL_Window *a),(a),return) SDL20_SYM(void,GetWindowPosition,(SDL_Window *a,int *b, int *c),(a,b,c),) SDL20_SYM(void,SetWindowSize,(SDL_Window *a, int b, int c),(a,b,c),) SDL20_SYM(void,GetWindowSize,(SDL_Window *a, int *b, int *c),(a,b,c),) SDL20_SYM(void,MinimizeWindow,(SDL_Window *a),(a),) SDL20_SYM(void,RaiseWindow,(SDL_Window *a),(a),) SDL20_SYM(int,SetWindowGammaRamp,(SDL_Window *a,const Uint16 *b,const Uint16 *c,const Uint16 *d),(a,b,c,d),return) SDL20_SYM(int,GetWindowGammaRamp,(SDL_Window *a,Uint16 *b,Uint16 *c,Uint16 *d),(a,b,c,d),return) SDL20_SYM(Uint32,GetWindowFlags,(SDL_Window *a),(a),return) SDL20_SYM(void,SetWindowGrab,(SDL_Window *a,SDL_bool b),(a,b),) SDL20_SYM(SDL_bool,GetWindowGrab,(SDL_Window *a),(a),return) SDL20_SYM(void,SetWindowTitle,(SDL_Window *a,const char *b),(a,b),) SDL20_SYM(int,SetWindowFullscreen,(SDL_Window *a, Uint32 b),(a,b),return) SDL20_SYM(void,SetWindowBordered,(SDL_Window *a, SDL_bool b),(a,b),return) SDL20_SYM(void,SetWindowResizable,(SDL_Window *a, SDL_bool b),(a,b),return) SDL20_SYM(SDL_PixelFormat *,AllocFormat,(Uint32 a),(a),return) SDL20_SYM(void,FreeFormat,(SDL_PixelFormat *a),(a),) SDL20_SYM(SDL_Surface *,CreateRGBSurface,(Uint32 a, int b, int c, int d, Uint32 e, Uint32 f, Uint32 g, Uint32 h),(a,b,c,d,e,f,g,h),return) SDL20_SYM(SDL_Surface *,CreateRGBSurfaceFrom,(void *a, int b, int c, int d, int e, Uint32 f, Uint32 g, Uint32 h, Uint32 i),(a,b,c,d,e,f,g,h,i),return) SDL20_SYM(SDL_Surface *,CreateRGBSurfaceWithFormat,(Uint32 a, int b, int c, int d, Uint32 e),(a,b,c,d,e),return) SDL20_SYM(SDL_Surface *,ConvertSurface,(SDL_Surface *a, const SDL_PixelFormat *b, Uint32 c),(a,b,c),return) SDL20_SYM(int,LockSurface,(SDL_Surface *a),(a),return) SDL20_SYM(void,UnlockSurface,(SDL_Surface *a),(a),) SDL20_SYM(int,UpperBlit,(SDL_Surface *a,const SDL_Rect *b,SDL_Surface *c, SDL_Rect *d),(a,b,c,d),return) SDL20_SYM(int,LowerBlit,(SDL_Surface *a,SDL_Rect *b,SDL_Surface *c, SDL_Rect *d),(a,b,c,d),return) SDL20_SYM(int,SoftStretch,(SDL_Surface *a,const SDL_Rect *b,SDL_Surface *c,const SDL_Rect *d),(a,b,c,d),return) SDL20_SYM(int,SetColorKey,(SDL_Surface *a, int b, Uint32 c),(a,b,c),return) SDL20_SYM(int,GetColorKey,(SDL_Surface *a, Uint32 *b),(a,b),return) SDL20_SYM(void,FreeSurface,(SDL_Surface *a),(a),) SDL20_SYM(int,SetSurfaceAlphaMod,(SDL_Surface *a, Uint8 b),(a,b),return) SDL20_SYM(int,GetSurfaceAlphaMod,(SDL_Surface *a, Uint8 *b),(a,b),return) SDL20_SYM(int,SetSurfaceBlendMode,(SDL_Surface *a, SDL_BlendMode b),(a,b),return) SDL20_SYM(int,GetSurfaceBlendMode,(SDL_Surface *a, SDL_BlendMode *b),(a,b),return) SDL20_SYM(SDL_Surface*,LoadBMP_RW,(SDL_RWops *a, int b),(a,b),return) SDL20_SYM(int,SaveBMP_RW,(SDL_Surface *a, SDL_RWops *b, int c),(a,b,c),return) SDL20_SYM(SDL_Palette*,AllocPalette,(int a),(a),return) SDL20_SYM(void,FreePalette,(SDL_Palette *a),(a),) SDL20_SYM(int,SetPaletteColors,(SDL_Palette *a, const SDL_Color *b, int c, int d),(a,b,c,d),return) SDL20_SYM(SDL_bool,GL_ExtensionSupported,(const char *a),(a),return) SDL20_SYM(int,GL_LoadLibrary,(const char *a),(a),return) SDL20_SYM(void *,GL_GetProcAddress,(const char *a),(a),return) SDL20_SYM(int,GL_SetAttribute,(SDL_GLattr a, int b),(a,b),return) SDL20_SYM(int,GL_GetAttribute,(SDL_GLattr a, int *b),(a,b),return) SDL20_SYM(int,GL_SetSwapInterval,(int a),(a),return) SDL20_SYM(int,GL_GetSwapInterval,(void),(),return) SDL20_SYM(SDL_GLContext,GL_CreateContext,(SDL_Window *a),(a),return) SDL20_SYM(SDL_GLContext,GL_GetCurrentContext,(void),(),return) SDL20_SYM(int,GL_MakeCurrent,(SDL_Window *a, SDL_GLContext b),(a,b),return) SDL20_SYM(void,GL_SwapWindow,(SDL_Window *a),(a),) SDL20_SYM(void,GL_DeleteContext,(SDL_GLContext a),(a),) SDL20_SYM(void,GL_GetDrawableSize,(SDL_Window *a, int *b, int *c),(a,b,c),) SDL20_SYM(void,GetClipRect,(SDL_Surface *a, SDL_Rect *b),(a,b),) SDL20_SYM(SDL_bool,SetClipRect,(SDL_Surface *a, const SDL_Rect *b),(a,b),return) SDL20_SYM(int,FillRect,(SDL_Surface *a,const SDL_Rect *b,Uint32 c),(a,b,c),return) SDL20_SYM(SDL_bool,IntersectRect,(const SDL_Rect *a,const SDL_Rect *b,SDL_Rect *c),(a,b,c),return) SDL20_SYM(void,GetRGB,(Uint32 a,const SDL_PixelFormat *b,Uint8 *c,Uint8 *d,Uint8 *e),(a,b,c,d,e),) SDL20_SYM(void,GetRGBA,(Uint32 a,const SDL_PixelFormat *b,Uint8 *c,Uint8 *d,Uint8 *e,Uint8 *f),(a,b,c,d,e,f),) SDL20_SYM(Uint32,MapRGB,(const SDL_PixelFormat *a,Uint8 b,Uint8 c,Uint8 d),(a,b,c,d),return) SDL20_SYM(Uint32,MapRGBA,(const SDL_PixelFormat *a,Uint8 b,Uint8 c,Uint8 d,Uint8 e),(a,b,c,d,e),return) SDL20_SYM(void,CalculateGammaRamp,(float a, Uint16 *b),(a,b),) SDL20_SYM(Uint32,MasksToPixelFormatEnum,(int a,Uint32 b,Uint32 c,Uint32 d,Uint32 e),(a,b,c,d,e),return) SDL20_SYM(SDL_bool,PixelFormatEnumToMasks,(Uint32 a,int *b,Uint32 *c,Uint32 *d,Uint32 *e,Uint32 *f),(a,b,c,d,e,f),return) SDL20_SYM_PASSTHROUGH(void,SetModState,(SDL_Keymod a),(a),) SDL20_SYM_PASSTHROUGH(SDL_Keymod,GetModState,(void),(),return) SDL20_SYM(void,StartTextInput,(void),(),) SDL20_SYM(void,StopTextInput,(void),(),) SDL20_SYM(Uint32,GetMouseState,(int *a, int *b),(a,b),return) SDL20_SYM(Uint32,GetRelativeMouseState,(int *a, int *b),(a,b),return) SDL20_SYM(void,WarpMouseInWindow,(SDL_Window *a, int b, int c),(a,b,c),) SDL20_SYM(int,SetRelativeMouseMode,(SDL_bool a),(a),return) SDL20_SYM(int,ShowCursor,(int a),(a),return) SDL20_SYM(SDL_Cursor *,CreateCursor,(const Uint8 *a,const Uint8 *b,int c,int d,int e,int f),(a,b,c,d,e,f),return) SDL20_SYM(void,SetCursor,(SDL_Cursor *a),(a),) SDL20_SYM(SDL_Cursor *,GetCursor,(void),(),return) SDL20_SYM(void,FreeCursor,(SDL_Cursor *a),(a),) #ifdef SDL_PASSED_BEGINTHREAD_ENDTHREAD SDL20_SYM(SDL_Thread *,CreateThread,(SDL_ThreadFunction a, const char *b, void *c, pfnSDL_CurrentBeginThread d, pfnSDL_CurrentEndThread e),(a,b,c,d,e),return) #else SDL20_SYM(SDL_Thread *,CreateThread,(SDL_ThreadFunction a, const char *b, void *c),(a,b,c),return) #endif SDL20_SYM(unsigned long,GetThreadID,(SDL_Thread *a),(a),return) SDL20_SYM(unsigned long,ThreadID,(void),(),return) SDL20_SYM_PASSTHROUGH(void,WaitThread,(SDL_Thread *a, int *b),(a,b),) SDL20_SYM_PASSTHROUGH(SDL_mutex*,CreateMutex,(void),(),return) SDL20_SYM(int,LockMutex,(SDL_mutex *a),(a),return) SDL20_SYM(int,UnlockMutex,(SDL_mutex *a),(a),return) SDL20_SYM_PASSTHROUGH(void,DestroyMutex,(SDL_mutex *a),(a),) SDL20_SYM_PASSTHROUGH(SDL_sem*,CreateSemaphore,(Uint32 a),(a),return) SDL20_SYM_PASSTHROUGH(void,DestroySemaphore,(SDL_sem *a),(a),) SDL20_SYM_PASSTHROUGH(int,SemWait,(SDL_sem *a),(a),return) SDL20_SYM_PASSTHROUGH(int,SemTryWait,(SDL_sem *a),(a),return) SDL20_SYM_PASSTHROUGH(int,SemWaitTimeout,(SDL_sem *a, Uint32 b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,SemPost,(SDL_sem *a),(a),return) SDL20_SYM_PASSTHROUGH(Uint32,SemValue,(SDL_sem *a),(a),return) SDL20_SYM_PASSTHROUGH(SDL_cond*,CreateCond,(void),(),return) SDL20_SYM_PASSTHROUGH(void,DestroyCond,(SDL_cond *a),(a),) SDL20_SYM_PASSTHROUGH(int,CondSignal,(SDL_cond *a),(a),return) SDL20_SYM_PASSTHROUGH(int,CondBroadcast,(SDL_cond *a),(a),return) SDL20_SYM_PASSTHROUGH(int,CondWait,(SDL_cond *a, SDL_mutex *b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,CondWaitTimeout,(SDL_cond *a, SDL_mutex *b, Uint32 c),(a,b,c),return) SDL20_SYM(int,AtomicGet,(SDL_atomic_t *a),(a),return) SDL20_SYM(int,AtomicSet,(SDL_atomic_t *a, int b),(a,b),return) SDL20_SYM(int,AtomicAdd,(SDL_atomic_t *a, int b),(a,b),return) SDL20_SYM(SDL_AudioSpec *,LoadWAV_RW,(SDL_RWops *a, int b, SDL_AudioSpec *c, Uint8 **d, Uint32 *e),(a,b,c,d,e),return) SDL20_SYM(int,OpenAudio,(SDL_AudioSpec *a, SDL_AudioSpec *b),(a,b),return) SDL20_SYM(void,CloseAudio,(void),(),) SDL20_SYM(SDL_AudioStatus,GetAudioStatus,(void),(),return) SDL20_SYM(void,PauseAudio,(int a),(a),) SDL20_SYM_PASSTHROUGH(void,FreeWAV,(Uint8 *a),(a),) SDL20_SYM(int,BuildAudioCVT,(SDL_AudioCVT *a, Uint16 b, Uint8 c, int d, Uint16 e, Uint8 f, int g),(a,b,c,d,e,f,g),return) SDL20_SYM(int,ConvertAudio,(SDL_AudioCVT *a),(a),return) SDL20_SYM(void,MixAudioFormat,(Uint8 *a, const Uint8 *b, SDL_AudioFormat c, Uint32 d, int e),(a,b,c,d,e),) SDL20_SYM_PASSTHROUGH(void,LockAudio,(void),(),) SDL20_SYM_PASSTHROUGH(void,UnlockAudio,(void),(),) SDL20_SYM(SDL_AudioStream *,NewAudioStream,(const SDL_AudioFormat a, const Uint8 b, const int c, const SDL_AudioFormat d, const Uint8 e, const int f),(a,b,c,d,e,f),return) SDL20_SYM(int,AudioStreamPut,(SDL_AudioStream *a, const void *b, int c),(a,b,c),return) SDL20_SYM(int,AudioStreamGet,(SDL_AudioStream *a, void *b, int c),(a,b,c),return) SDL20_SYM(int,AudioStreamAvailable,(SDL_AudioStream *a),(a),return) SDL20_SYM(int,AudioStreamFlush,(SDL_AudioStream *a),(a),return) SDL20_SYM(void,AudioStreamClear,(SDL_AudioStream *a),(a),) SDL20_SYM(void,FreeAudioStream,(SDL_AudioStream *a),(a),) SDL20_SYM_PASSTHROUGH(void*,LoadObject,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(void*,LoadFunction,(void *a, const char *b),(a,b),return) SDL20_SYM_PASSTHROUGH(void,UnloadObject,(void *a),(a),) SDL20_SYM_PASSTHROUGH(SDL_bool,HasRDTSC,(void),(),return) SDL20_SYM_PASSTHROUGH(SDL_bool,HasMMX,(void),(),return) SDL20_SYM_PASSTHROUGH(SDL_bool,Has3DNow,(void),(),return) SDL20_SYM_PASSTHROUGH(SDL_bool,HasSSE,(void),(),return) SDL20_SYM_PASSTHROUGH(SDL_bool,HasSSE2,(void),(),return) SDL20_SYM_PASSTHROUGH(SDL_bool,HasAltiVec,(void),(),return) SDL20_SYM(SDL_TimerID,AddTimer,(Uint32 a, SDL_TimerCallback b, void *c),(a,b,c),return) SDL20_SYM(SDL_bool,RemoveTimer,(SDL_TimerID a),(a),return) SDL20_SYM_PASSTHROUGH(Uint32,GetTicks,(void),(),return) SDL20_SYM(void,Delay,(Uint32 a),(a),) SDL20_SYM(SDL_bool,IsGameController,(int a),(a),return) SDL20_SYM(const char *,GameControllerNameForIndex,(int a),(a),return) SDL20_SYM(SDL_GameController *,GameControllerOpen,(int a),(a),return) SDL20_SYM(void,GameControllerClose,(SDL_GameController *a),(a),) SDL20_SYM(int,GameControllerEventState,(int a),(a),return) SDL20_SYM(void,GameControllerUpdate,(void),(),) SDL20_SYM(Sint16,GameControllerGetAxis,(SDL_GameController *a, int b),(a,b),return) /* SDL_GameControllerAxis b */ SDL20_SYM(Uint8,GameControllerGetButton,(SDL_GameController *a, int b),(a,b),return) /* SDL_GameControllerButton b */ SDL20_SYM(int,NumJoysticks,(void),(),return) SDL20_SYM(const char *,JoystickNameForIndex,(int a),(a),return) SDL20_SYM(SDL_JoystickID,JoystickGetDeviceInstanceID,(int a),(a),return) SDL20_SYM(SDL_Joystick *,JoystickOpen,(int a),(a),return) SDL20_SYM(int,JoystickNumAxes,(SDL_Joystick *a),(a),return) SDL20_SYM(int,JoystickNumBalls,(SDL_Joystick *a),(a),return) SDL20_SYM(int,JoystickNumHats,(SDL_Joystick *a),(a),return) SDL20_SYM(int,JoystickNumButtons,(SDL_Joystick *a),(a),return) SDL20_SYM(void,JoystickUpdate,(void),(),) SDL20_SYM(int,JoystickEventState,(int a),(a),return) SDL20_SYM(Sint16,JoystickGetAxis,(SDL_Joystick *a, int b),(a,b),return) SDL20_SYM(Uint8,JoystickGetHat,(SDL_Joystick *a, int b),(a,b),return) SDL20_SYM(int,JoystickGetBall,(SDL_Joystick *a, int b, int *c, int *d),(a,b,c,d),return) SDL20_SYM(Uint8,JoystickGetButton,(SDL_Joystick *a, int b),(a,b),return) SDL20_SYM(void,JoystickClose,(SDL_Joystick *a),(a),return) SDL20_SYM(void,LockJoysticks,(void),(),) SDL20_SYM(void,UnlockJoysticks,(void),(),) SDL20_SYM(SDL_RWops *,RWFromFile,(const char *a, const char *b),(a,b),return) SDL20_SYM(SDL_RWops *,RWFromFP,(void *a, SDL_bool b),(a,b),return) /* FILE* */ SDL20_SYM(SDL_RWops *,RWFromMem,(void *a, int b),(a,b),return) SDL20_SYM(SDL_RWops *,RWFromConstMem,(const void *a, int b),(a,b),return) SDL20_SYM(SDL_RWops *,AllocRW,(void),(),return) SDL20_SYM(void,FreeRW,(SDL_RWops *a),(a),) SDL20_SYM(void *,LoadFile_RW,(SDL_RWops *a, size_t *b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(void *,malloc,(size_t a),(a),return) SDL20_SYM_PASSTHROUGH(void *,calloc,(size_t a, size_t b),(a,b),return) SDL20_SYM_PASSTHROUGH(void *,realloc,(void *a, size_t b),(a,b),return) SDL20_SYM_PASSTHROUGH(void,free,(void *a),(a),) SDL20_SYM_PASSTHROUGH(void,qsort,(void *a, size_t b, size_t c, int (SDLCALL *d)(const void *, const void *)),(a,b,c,d),) SDL20_SYM_PASSTHROUGH(void *,memset,(void *a, int b, size_t c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(void *,memcpy,(void *a, const void *b, size_t c),(a,b,c),return) SDL20_SYM(void *,memmove,(void *a, const void *b, size_t c),(a,b,c),return) SDL20_SYM(double,atof,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(int,memcmp,(const void *a, const void *b, size_t c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(size_t,strlen,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(size_t,strlcpy,(char *a, const char *b, size_t c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(size_t,strlcat,(char *a, const char *b, size_t c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(char *,strdup,(const char *a),(a),return) SDL20_SYM_PASSTHROUGH(char *,strrev,(char *a),(a),return) SDL20_SYM_PASSTHROUGH(char *,strupr,(char *a),(a),return) SDL20_SYM_PASSTHROUGH(char *,strlwr,(char *a),(a),return) SDL20_SYM_PASSTHROUGH(char *,strchr,(const char *a, int b),(a,b),return) SDL20_SYM_PASSTHROUGH(char *,strrchr,(const char *a, int b),(a,b),return) SDL20_SYM_PASSTHROUGH(char *,strstr,(const char *a, const char *b),(a,b),return) SDL20_SYM_PASSTHROUGH(char *,ltoa,(long a, char *b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(char *,ultoa,(unsigned long a, char *b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(long,strtol,(const char *a, char **b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(unsigned long,strtoul,(const char *a, char **b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(char*,lltoa,(Sint64 a, char *b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(char*,ulltoa,(Uint64 a, char *b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(Sint64,strtoll,(const char *a, char **b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(Uint64,strtoull,(const char *a, char **b, int c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(double,strtod,(const char *a, char **b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,strcmp,(const char *a, const char *b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,strncmp,(const char *a, const char *b, size_t c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(int,strcasecmp,(const char *a, const char *b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,strncasecmp,(const char *a, const char *b, size_t c),(a,b,c),return) SDL20_SYM_VARARGS(int,sscanf,(const char *text, const char *fmt, ...)) SDL20_SYM_VARARGS(int,snprintf,(char *text, size_t maxlen, const char *fmt, ...)) SDL20_SYM(int,vsscanf,(const char *a,const char *b,va_list c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(int,vsnprintf,(char *a, size_t b, const char *c, va_list d),(a,b,c,d),return) SDL20_SYM_PASSTHROUGH(SDL_iconv_t,iconv_open,(const char *a, const char *b),(a,b),return) SDL20_SYM_PASSTHROUGH(int,iconv_close,(SDL_iconv_t a),(a),return) SDL20_SYM_PASSTHROUGH(size_t,iconv,(SDL_iconv_t a, const char **b, size_t *c, char **d, size_t *e),(a,b,c,d,e),return) SDL20_SYM_PASSTHROUGH(char *,iconv_string,(const char *a, const char *b, const char *c, size_t d),(a,b,c,d),return) SDL20_SYM(int,setenv,(const char *a, const char *b, int c),(a,b,c),return) SDL20_SYM(long,lroundf,(float a),(a),return) SDL20_SYM(double,fabs,(double a),(a),return) SDL20_SYM(double,ceil,(double a),(a),return) SDL20_SYM(double,floor,(double a),(a),return) SDL20_SYM(int,GetRenderDriverInfo,(int a, SDL_RendererInfo *b),(a,b),return) SDL20_SYM(SDL_Renderer *,CreateRenderer,(SDL_Window *a, int b, Uint32 c),(a,b,c),return) SDL20_SYM(int,GetRendererInfo,(SDL_Renderer *a, SDL_RendererInfo *b),(a,b),return) SDL20_SYM(void,RenderGetScale,(SDL_Renderer *a, float *b, float *c),(a,b,c),return) SDL20_SYM(void,RenderGetViewport,(SDL_Renderer *a, SDL_Rect *b),(a,b),return) SDL20_SYM(SDL_Texture *,CreateTexture,(SDL_Renderer *a, Uint32 b, int c, int d, int e),(a,b,c,d,e),return) SDL20_SYM(int,LockTexture,(SDL_Texture *a, const SDL_Rect *b, void **c, int *d),(a,b,c,d),return) SDL20_SYM(int,LockTextureToSurface,(SDL_Texture *a, const SDL_Rect *b, SDL_Surface **c),(a,b,c),return) SDL20_SYM(void,UnlockTexture,(SDL_Texture *a),(a),) SDL20_SYM(int,UpdateTexture,(SDL_Texture *a, const SDL_Rect *b, const void *c, int d),(a,b,c,d),return) SDL20_SYM(int,UpdateYUVTexture,(SDL_Texture *a, const SDL_Rect *b, const Uint8 *c, int d, const Uint8 *e, int f, const Uint8 *g, int h),(a,b,c,d,e,f,g,h),return) SDL20_SYM(int,RenderSetLogicalSize,(SDL_Renderer *a, int b, int c),(a,b,c),return) SDL20_SYM(int,SetRenderDrawColor,(SDL_Renderer *a, Uint8 b, Uint8 c, Uint8 d, Uint8 e),(a,b,c,d,e),return) SDL20_SYM(int,RenderClear,(SDL_Renderer *a),(a),return) SDL20_SYM(int,RenderCopy,(SDL_Renderer *a, SDL_Texture *b, const SDL_Rect *c, const SDL_Rect *d),(a,b,c,d),return) SDL20_SYM(void,DestroyTexture,(SDL_Texture *a),(a),) SDL20_SYM(void,DestroyRenderer,(SDL_Renderer *a),(a),) SDL20_SYM(void,RenderPresent,(SDL_Renderer *a),(a),) SDL20_SYM(SDL_bool,SetHintWithPriority,(const char *a, const char *b, SDL_HintPriority c),(a,b,c),return) #ifdef _WIN32 SDL20_SYM_PASSTHROUGH(int,RegisterApp,(const char *a, Uint32 b, void *c),(a,b,c),return) SDL20_SYM_PASSTHROUGH(void,UnregisterApp,(void),(),) #endif /* These are optional OpenGL entry points for sdl12-compat's internal use. */ OPENGL_SYM(Core,const GLubyte *,glGetString,(GLenum a),(a),return) OPENGL_SYM(Core,GLenum,glGetError,(),(),return) OPENGL_SYM(Core,void,glClear,(GLbitfield a),(a),) OPENGL_SYM(Core,GLboolean,glIsEnabled,(GLenum a),(a),return) OPENGL_SYM(Core,void,glEnable,(GLenum a),(a),) OPENGL_SYM(Core,void,glDisable,(GLenum a),(a),) OPENGL_SYM(Core,void,glGetFloatv,(GLenum a, GLfloat *b),(a,b),) OPENGL_SYM(Core,void,glGetIntegerv,(GLenum a, GLint *b),(a,b),) OPENGL_SYM(Core,void,glClearColor,(GLfloat a,GLfloat b,GLfloat c,GLfloat d),(a,b,c,d),) OPENGL_SYM(Core,void,glViewport,(GLint a, GLint b, GLsizei c, GLsizei d),(a,b,c,d),) OPENGL_SYM(Core,void,glScissor,(GLint a, GLint b, GLsizei c, GLsizei d),(a,b,c,d),) OPENGL_SYM(Core,void,glReadPixels,(GLint a, GLint b, GLsizei c, GLsizei d, GLenum e, GLenum f, void *g),(a,b,c,d,e,f,g,h,i),) OPENGL_SYM(Core,void,glCopyPixels,(GLint a, GLint b, GLsizei c, GLsizei d, GLenum e),(a,b,c,d,e),) OPENGL_SYM(Core,void,glCopyTexImage1D,(GLenum a, GLint b, GLenum c, GLint d, GLint e, GLsizei f, GLint g),(a,b,c,d,e,f,g),) OPENGL_SYM(Core,void,glCopyTexSubImage1D,(GLenum a, GLint b, GLint c, GLint d, GLint e, GLsizei f),(a,b,c,d,e,f),) OPENGL_SYM(Core,void,glCopyTexImage2D,(GLenum a, GLint b, GLenum c, GLint d, GLint e, GLsizei f, GLsizei g, GLint h),(a,b,c,d,e,f,g,h),) OPENGL_SYM(Core,void,glCopyTexSubImage2D,(GLenum a, GLint b, GLint c, GLint d, GLint e, GLint f, GLsizei g, GLsizei h),(a,b,c,d,e,f,g,h),) OPENGL_SYM(Core,void,glCopyTexSubImage3D,(GLenum a, GLint b, GLint c, GLint d, GLint e, GLint f, GLsizei g, GLsizei h, GLint i),(a,b,c,d,e,f,g,h,i),) OPENGL_SYM(Core,void,glDeleteTextures,(GLsizei a, const GLuint *b),(a,b),) OPENGL_SYM(Core,void,glGenTextures,(GLsizei a, GLuint *b),(a,b),) OPENGL_SYM(Core,void,glPopAttrib,(),(),) OPENGL_SYM(Core,void,glPopClientAttrib,(),(),) OPENGL_SYM(Core,void,glPopMatrix,(),(),) OPENGL_SYM(Core,void,glBegin,(GLenum a),(a),) OPENGL_SYM(Core,void,glPushAttrib,(GLbitfield a),(a),) OPENGL_SYM(Core,void,glPushClientAttrib,(GLbitfield a),(a),) OPENGL_SYM(Core,void,glBindTexture,(GLenum a, GLuint b),(a,b),) OPENGL_SYM(Core,void,glEnd,(),(),) OPENGL_SYM(Core,void,glTexEnvf,(GLenum a, GLenum b, GLfloat c),(a,b,c),) OPENGL_SYM(Core,void,glTexParameteri,(GLenum a, GLenum b, GLint c),(a,b,c),) OPENGL_SYM(Core,void,glPixelStorei,(GLenum a, GLint b),(a,b),) OPENGL_SYM(Core,void,glBlendFunc,(GLenum a, GLenum b),(a,b),) OPENGL_SYM(Core,void,glColor4f,(GLfloat a, GLfloat b, GLfloat c, GLfloat d),(a,b,c,d),) OPENGL_SYM(Core,void,glMatrixMode,(GLenum a),(a),) OPENGL_SYM(Core,void,glLoadIdentity,(),(),) OPENGL_SYM(Core,void,glPushMatrix,(),(),) OPENGL_SYM(Core,void,glOrtho,(GLdouble a, GLdouble b, GLdouble c, GLdouble d, GLdouble e, GLdouble f),(a,b,c,d,e,f),) OPENGL_SYM(Core,void,glTexImage2D,(GLenum a, GLint b, GLint c, GLsizei d, GLsizei e, GLint f, GLenum g, GLenum h, const GLvoid *i),(a,b,c,d,e,f,g,h,i),) OPENGL_SYM(Core,void,glTexSubImage2D,(GLenum a, GLint b, GLint c, GLint d, GLsizei e, GLsizei f, GLenum g, GLenum h, const GLvoid *i),(a,b,c,d,e,f,g,h,i),) OPENGL_SYM(Core,void,glVertex2i,(GLint a, GLint b),(a,b),) OPENGL_SYM(Core,void,glTexCoord2f,(GLfloat a, GLfloat b),(a,b),) OPENGL_EXT(GL_ARB_framebuffer_object) OPENGL_SYM(GL_ARB_framebuffer_object,void,glBindRenderbuffer,(GLenum a, GLuint b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glDeleteRenderbuffers,(GLsizei a, const GLuint *b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glGenRenderbuffers,(GLsizei a, GLuint *b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glRenderbufferStorage,(GLenum a, GLenum b, GLsizei c, GLsizei d),(a,b,c,d),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glRenderbufferStorageMultisample,(GLenum a, GLsizei b, GLenum c, GLsizei d, GLsizei e),(a,b,c,d,e),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glGetRenderbufferParameteriv,(GLenum a, GLenum b, GLint* c),(a,b,c),) OPENGL_SYM(GL_ARB_framebuffer_object,GLboolean,glIsFramebuffer,(GLuint a),(a),return) OPENGL_SYM(GL_ARB_framebuffer_object,void,glBindFramebuffer,(GLenum a, GLuint b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glDeleteFramebuffers,(GLsizei a, const GLuint *b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glGenFramebuffers,(GLsizei a, GLuint *b),(a,b),) OPENGL_SYM(GL_ARB_framebuffer_object,GLenum,glCheckFramebufferStatus,(GLenum a),(a),return) OPENGL_SYM(GL_ARB_framebuffer_object,void,glFramebufferRenderbuffer,(GLenum a, GLenum b, GLenum c, GLuint d),(a,b,c,d),) OPENGL_SYM(GL_ARB_framebuffer_object,void,glBlitFramebuffer,(GLint a, GLint b, GLint c, GLint d, GLint e, GLint f, GLint g, GLint h, GLbitfield i, GLenum j),(a,b,c,d,e,f,g,h,i,j),) OPENGL_EXT(GL_ARB_texture_non_power_of_two) #undef SDL20_SYM #undef SDL20_SYM_PASSTHROUGH #undef SDL20_SYM_VARARGS #undef OPENGL_SYM #undef OPENGL_EXT /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/src/SDLmain/dummy/SDL_dummy_main.c0000664000000000000000000000032314064431271017161 0ustar00 /* Include the SDL main definition header */ #include "SDL_main.h" #ifdef main #undef main int main(int argc, char *argv[]) { return(SDL_main(argc, argv)); } #else /* Nothing to do on this platform */ #endif sdl12-compat-1.2.74/src/SDLmain/macosx/SDLMain.h0000664000000000000000000000174714156014351015724 0ustar00/* SDLMain.m - main entry point for our Cocoa-ized SDL app Initial Version: Darrell Walisser Non-NIB-Code & other changes: Max Horn Feel free to customize this file to suit your needs */ #ifndef _SDLMain_h_ #define _SDLMain_h_ #import /* Note that the following defines have not been changed in a long time and it's likely going to need fixes if you try it. */ /* Use this flag to determine whether we use SDLMain.nib or not */ #define SDL_USE_NIB_FILE 0 @interface SDLMain : NSObject - (NSApplicationTerminateReply) applicationShouldTerminate:(NSApplication *)sender; - (void) setupWorkingDirectory:(BOOL)shouldChdir; - (BOOL) application:(NSApplication *)theApplication openFile:(NSString *)filename; - (void) applicationDidFinishLaunching: (NSNotification *) note; #if SDL_USE_NIB_FILE - (void)fixMenu:(NSMenu *)aMenu withAppName:(NSString *)appName; #endif @end #endif /* _SDLMain_h_ */ sdl12-compat-1.2.74/src/SDLmain/macosx/SDLMain.m0000664000000000000000000002606014156014351015724 0ustar00/* SDLMain.m - main entry point for our Cocoa-ized SDL app Initial Version: Darrell Walisser Non-NIB-Code & other changes: Max Horn Feel free to customize this file to suit your needs */ #include "SDL.h" #include "SDLMain.h" #include /* for MAXPATHLEN */ #include /* For some reaon, Apple removed setAppleMenu from the headers in 10.4, but the method still is there and works. To avoid warnings, we declare it ourselves here. */ @interface NSApplication(SDL_Missing_Methods) - (void)setAppleMenu:(NSMenu *)menu; @end /* NSEventModifierFlagOption replaced NSAlternateKeyMask in 10.12, but it's the same value. */ #define EventModifierFlagOption (1 << 19) /* Same deal with the NSCommandKeyMask... */ #define EventModifierFlagCommand (1 << 20) static int gArgc; static char **gArgv; static BOOL gFinderLaunch; static BOOL gCalledAppMainline = FALSE; static NSString *getApplicationName(void) { const NSDictionary *dict; NSString *appName = 0; /* Determine the application name */ dict = (const NSDictionary *)CFBundleGetInfoDictionary(CFBundleGetMainBundle()); if (dict) appName = [dict objectForKey: @"CFBundleName"]; if (![appName length]) appName = [[NSProcessInfo processInfo] processName]; return appName; } #if SDL_USE_NIB_FILE /* A helper category for NSString */ @interface NSString (ReplaceSubString) - (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString; @end #endif /* The main class of the application, the application's delegate */ @implementation SDLMain - (NSApplicationTerminateReply) applicationShouldTerminate:(NSApplication *)sender { /* Post a SDL_QUIT event */ SDL_Event event; event.type = SDL_QUIT; SDL_PushEvent(&event); return NSTerminateCancel; } /* Set the working directory to the .app's parent directory */ - (void) setupWorkingDirectory:(BOOL)shouldChdir { if (shouldChdir) { char parentdir[MAXPATHLEN]; CFURLRef url = CFBundleCopyBundleURL(CFBundleGetMainBundle()); CFURLRef url2 = CFURLCreateCopyDeletingLastPathComponent(0, url); if (CFURLGetFileSystemRepresentation(url2, 1, (UInt8 *)parentdir, MAXPATHLEN)) { chdir(parentdir); /* chdir to the binary app's parent */ } CFRelease(url); CFRelease(url2); } } #if SDL_USE_NIB_FILE /* Fix menu to contain the real app name instead of "SDL App" */ - (void)fixMenu:(NSMenu *)aMenu withAppName:(NSString *)appName { NSRange aRange; NSEnumerator *enumerator; NSMenuItem *menuItem; aRange = [[aMenu title] rangeOfString:@"SDL App"]; if (aRange.length != 0) [aMenu setTitle: [[aMenu title] stringByReplacingRange:aRange with:appName]]; enumerator = [[aMenu itemArray] objectEnumerator]; while ((menuItem = [enumerator nextObject])) { aRange = [[menuItem title] rangeOfString:@"SDL App"]; if (aRange.length != 0) [menuItem setTitle: [[menuItem title] stringByReplacingRange:aRange with:appName]]; if ([menuItem hasSubmenu]) [self fixMenu:[menuItem submenu] withAppName:appName]; } } #else static void setApplicationMenu(void) { /* warning: this code is very odd */ NSMenu *appleMenu; NSMenuItem *menuItem; NSString *title; NSString *appName; appName = getApplicationName(); appleMenu = [[NSMenu alloc] initWithTitle:@""]; /* Add menu items */ title = [@"About " stringByAppendingString:appName]; [appleMenu addItemWithTitle:title action:@selector(orderFrontStandardAboutPanel:) keyEquivalent:@""]; [appleMenu addItem:[NSMenuItem separatorItem]]; title = [@"Hide " stringByAppendingString:appName]; [appleMenu addItemWithTitle:title action:@selector(hide:) keyEquivalent:@"h"]; menuItem = (NSMenuItem *)[appleMenu addItemWithTitle:@"Hide Others" action:@selector(hideOtherApplications:) keyEquivalent:@"h"]; [menuItem setKeyEquivalentModifierMask:(EventModifierFlagOption|EventModifierFlagCommand)]; [appleMenu addItemWithTitle:@"Show All" action:@selector(unhideAllApplications:) keyEquivalent:@""]; [appleMenu addItem:[NSMenuItem separatorItem]]; title = [@"Quit " stringByAppendingString:appName]; [appleMenu addItemWithTitle:title action:@selector(terminate:) keyEquivalent:@"q"]; /* Put menu into the menubar */ menuItem = [[NSMenuItem alloc] initWithTitle:@"" action:nil keyEquivalent:@""]; [menuItem setSubmenu:appleMenu]; [[NSApp mainMenu] addItem:menuItem]; /* Tell the application object that this is now the application menu */ [NSApp setAppleMenu:appleMenu]; /* Finally give up our references to the objects */ [appleMenu release]; [menuItem release]; } /* Create a window menu */ static void setupWindowMenu(void) { NSMenu *windowMenu; NSMenuItem *windowMenuItem; NSMenuItem *menuItem; windowMenu = [[NSMenu alloc] initWithTitle:@"Window"]; /* "Minimize" item */ menuItem = [[NSMenuItem alloc] initWithTitle:@"Minimize" action:@selector(performMiniaturize:) keyEquivalent:@"m"]; [windowMenu addItem:menuItem]; [menuItem release]; /* Put menu into the menubar */ windowMenuItem = [[NSMenuItem alloc] initWithTitle:@"Window" action:nil keyEquivalent:@""]; [windowMenuItem setSubmenu:windowMenu]; [[NSApp mainMenu] addItem:windowMenuItem]; /* Tell the application object that this is now the window menu */ [NSApp setWindowsMenu:windowMenu]; /* Finally give up our references to the objects */ [windowMenu release]; [windowMenuItem release]; } /* Replacement for NSApplicationMain */ static void CustomApplicationMain (int argc, char **argv) { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; SDLMain *sdlMain; /* Ensure the application object is initialised and converted to a GUI app if necessary. */ ProcessSerialNumber psn = { 0, kCurrentProcess}; TransformProcessType(&psn, kProcessTransformToForegroundApplication); /* Ensure the application object is initialised */ [NSApplication sharedApplication]; /* Set up the menubar */ [NSApp setMainMenu:[[NSMenu alloc] init]]; setApplicationMenu(); setupWindowMenu(); /* Create SDLMain and make it the app delegate */ sdlMain = [[SDLMain alloc] init]; [NSApp setDelegate:sdlMain]; /* Start the main event loop */ [NSApp run]; [sdlMain release]; [pool release]; } #endif /* * Catch document open requests...this lets us notice files when the app * was launched by double-clicking a document, or when a document was * dragged/dropped on the app's icon. You need to have a * CFBundleDocumentsType section in your Info.plist to get this message, * apparently. * * Files are added to gArgv, so to the app, they'll look like command line * arguments. Previously, apps launched from the finder had nothing but * an argv[0]. * * This message may be received multiple times to open several docs on launch. * * This message is ignored once the app's mainline has been called. */ - (BOOL)application:(NSApplication *)theApplication openFile:(NSString *)filename { const char *temparg; size_t arglen; char *arg; char **newargv; if (!gFinderLaunch) /* MacOS is passing command line args. */ return FALSE; if (gCalledAppMainline) /* app has started, ignore this document. */ return FALSE; temparg = [filename UTF8String]; arglen = SDL_strlen(temparg) + 1; arg = (char *) SDL_malloc(arglen); if (arg == NULL) return FALSE; newargv = (char **) realloc(gArgv, sizeof (char *) * (gArgc + 2)); if (newargv == NULL) { SDL_free(arg); return FALSE; } gArgv = newargv; SDL_strlcpy(arg, temparg, arglen); gArgv[gArgc++] = arg; gArgv[gArgc] = NULL; return TRUE; } /* Called when the internal event loop has just started running */ - (void) applicationDidFinishLaunching: (NSNotification *) note { int status; /* Set the working directory to the .app's parent directory */ [self setupWorkingDirectory:gFinderLaunch]; #if SDL_USE_NIB_FILE /* Set the main menu to contain the real app name instead of "SDL App" */ [self fixMenu:[NSApp mainMenu] withAppName:getApplicationName()]; #endif /* Hand off to main application code */ gCalledAppMainline = TRUE; status = SDL_main (gArgc, gArgv); /* We're done, thank you for playing */ exit(status); } @end @implementation NSString (ReplaceSubString) - (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString { unsigned int bufferSize; unsigned int selfLen = [self length]; unsigned int aStringLen = [aString length]; unichar *buffer; NSRange localRange; NSString *result; bufferSize = selfLen + aStringLen - aRange.length; buffer = (unichar *)NSAllocateMemoryPages(bufferSize*sizeof(unichar)); /* Get first part into buffer */ localRange.location = 0; localRange.length = aRange.location; [self getCharacters:buffer range:localRange]; /* Get middle part into buffer */ localRange.location = 0; localRange.length = aStringLen; [aString getCharacters:(buffer+aRange.location) range:localRange]; /* Get last part into buffer */ localRange.location = aRange.location + aRange.length; localRange.length = selfLen - localRange.location; [self getCharacters:(buffer+aRange.location+aStringLen) range:localRange]; /* Build output string */ result = [NSString stringWithCharacters:buffer length:bufferSize]; NSDeallocateMemoryPages(buffer, bufferSize); return result; } @end #ifdef main # undef main #endif static int IsRootCwd() { char buf[MAXPATHLEN]; char *cwd = getcwd(buf, sizeof (buf)); return (cwd && (strcmp(cwd, "/") == 0)); } static int IsFinderLaunch(const int argc, char **argv) { /* -psn_XXX is passed if we are launched from Finder, SOMETIMES */ if ( (argc >= 2) && (strncmp(argv[1], "-psn", 4) == 0) ) { return 1; } else if ((argc == 1) && IsRootCwd()) { /* we might still be launched from the Finder; on 10.9+, you might not get the -psn command line anymore. If there's no command line, and if our current working directory is "/", it might as well be a Finder launch. */ return 1; } return 0; /* not a Finder launch. */ } /* Main entry point to executable - should *not* be SDL_main! */ int main (int argc, char **argv) { /* Copy the arguments into a global variable */ if (IsFinderLaunch(argc, argv)) { gArgv = (char **) SDL_malloc(sizeof (char *) * 2); gArgv[0] = argv[0]; gArgv[1] = NULL; gArgc = 1; gFinderLaunch = YES; } else { int i; gArgc = argc; gArgv = (char **) SDL_malloc(sizeof (char *) * (argc+1)); for (i = 0; i <= argc; i++) gArgv[i] = argv[i]; gFinderLaunch = NO; } #if SDL_USE_NIB_FILE NSApplicationMain (argc, argv); #else CustomApplicationMain (argc, argv); #endif return 0; } sdl12-compat-1.2.74/src/SDLmain/win32/SDL_win32_main.c0000664000000000000000000001626714147767006016627 0ustar00/* SDL_main.c, placed in the public domain by Sam Lantinga 4/13/98 The WinMain function -- calls your program's main() function */ #include #include #ifndef WIN32_LEAN_AND_MEAN #define WIN32_LEAN_AND_MEAN #endif #include #define DIR_SEPERATOR "/" /* Include the SDL main definition header */ #include "SDL.h" #include "SDL_main.h" #ifdef main # undef main #endif /* main */ /* The standard output files */ #define STDOUT_FILE "stdout.txt" #define STDERR_FILE "stderr.txt" #undef SDL_isspace #define SDL_isspace(a) ((a) == ' ' || (a) == '\t') /* Set a variable to tell if the stdio redirect has been enabled. */ static int stdioRedirectEnabled = 0; static char stdoutPath[MAX_PATH]; static char stderrPath[MAX_PATH]; static void UnEscapeQuotes( char *arg ) { char *last = NULL; while( *arg ) { if( *arg == '"' && *last == '\\' ) { char *c_curr = arg; char *c_last = last; while( *c_curr ) { *c_last = *c_curr; c_last = c_curr; c_curr++; } *c_last = '\0'; } last = arg; arg++; } } /* Parse a command line buffer into arguments */ static int ParseCommandLine(char *cmdline, char **argv) { char *bufp; char *lastp = NULL; int argc, last_argc; argc = last_argc = 0; for ( bufp = cmdline; *bufp; ) { /* Skip leading whitespace */ while ( SDL_isspace(*bufp) ) { ++bufp; } /* Skip over argument */ if ( *bufp == '"' ) { ++bufp; if ( *bufp ) { if ( argv ) { argv[argc] = bufp; } ++argc; } /* Skip over word */ while ( *bufp && ( *bufp != '"' || (lastp && *lastp == '\\') ) ) { lastp = bufp; ++bufp; } } else { if ( *bufp ) { if ( argv ) { argv[argc] = bufp; } ++argc; } /* Skip over word */ while ( *bufp && ! SDL_isspace(*bufp) ) { ++bufp; } } if ( *bufp ) { if ( argv ) { *bufp = '\0'; } ++bufp; } /* Strip out \ from \" sequences */ if( argv && last_argc != argc ) { UnEscapeQuotes( argv[last_argc] ); } last_argc = argc; } if ( argv ) { argv[argc] = NULL; } return(argc); } /* Show an error message */ static void ShowError(const char *title, const char *message) { /* If USE_MESSAGEBOX is defined, you need to link with user32.lib */ #ifdef USE_MESSAGEBOX MessageBox(NULL, message, title, MB_ICONEXCLAMATION|MB_OK); #else fprintf(stderr, "%s: %s\n", title, message); #endif } /* Pop up an out of memory message, returns to Windows */ static BOOL OutOfMemory(void) { ShowError("Fatal Error", "Out of memory - aborting"); return FALSE; } /* SDL_Quit() shouldn't be used with atexit() directly because calling conventions may differ... */ static void cleanup(void) { SDL_Quit(); } /* Remove the output files if there was no output written */ static void cleanup_output(void) { FILE *file; int empty; /* Flush the output in case anything is queued */ fclose(stdout); fclose(stderr); /* Without redirection we're done */ if (!stdioRedirectEnabled) { return; } /* See if the files have any output in them */ if ( stdoutPath[0] ) { file = fopen(stdoutPath, "rb"); if ( file ) { empty = (fgetc(file) == EOF) ? 1 : 0; fclose(file); if ( empty ) { remove(stdoutPath); } } } if ( stderrPath[0] ) { file = fopen(stderrPath, "rb"); if ( file ) { empty = (fgetc(file) == EOF) ? 1 : 0; fclose(file); if ( empty ) { remove(stderrPath); } } } } /* Redirect the output (stdout and stderr) to a file */ static void redirect_output(void) { DWORD pathlen; char path[MAX_PATH]; FILE *newfp; pathlen = GetModuleFileName(NULL, path, SDL_arraysize(path)); while ( pathlen > 0 && path[pathlen] != '\\' ) { --pathlen; } path[pathlen] = '\0'; SDL_strlcpy( stdoutPath, path, SDL_arraysize(stdoutPath) ); SDL_strlcat( stdoutPath, DIR_SEPERATOR STDOUT_FILE, SDL_arraysize(stdoutPath) ); /* Redirect standard input and standard output */ newfp = freopen(stdoutPath, "w", stdout); if ( newfp == NULL ) { /* This happens on NT */ #if !defined(stdout) stdout = fopen(stdoutPath, "w"); #else newfp = fopen(stdoutPath, "w"); if ( newfp ) { *stdout = *newfp; } #endif } SDL_strlcpy( stderrPath, path, SDL_arraysize(stderrPath) ); SDL_strlcat( stderrPath, DIR_SEPERATOR STDERR_FILE, SDL_arraysize(stderrPath) ); newfp = freopen(stderrPath, "w", stderr); if ( newfp == NULL ) { /* This happens on NT */ #if !defined(stderr) stderr = fopen(stderrPath, "w"); #else newfp = fopen(stderrPath, "w"); if ( newfp ) { *stderr = *newfp; } #endif } setvbuf(stdout, NULL, _IOLBF, BUFSIZ); /* Line buffered */ setbuf(stderr, NULL); /* No buffering */ stdioRedirectEnabled = 1; } #if defined(_MSC_VER) /* The VC++ compiler needs main defined */ #define console_main main #endif /* This is where execution begins [console apps] */ int console_main(int argc, char *argv[]) { size_t n; char *bufp, *appname; int status; /* Get the class name from argv[0] */ appname = argv[0]; if ( (bufp=SDL_strrchr(argv[0], '\\')) != NULL ) { appname = bufp+1; } else if ( (bufp=SDL_strrchr(argv[0], '/')) != NULL ) { appname = bufp+1; } if ( (bufp=SDL_strrchr(appname, '.')) == NULL ) n = SDL_strlen(appname); else n = (bufp-appname); bufp = SDL_stack_alloc(char, n+1); if ( bufp == NULL ) { return OutOfMemory(); } SDL_strlcpy(bufp, appname, n+1); appname = bufp; /* Load SDL dynamic link library */ if ( SDL_Init(SDL_INIT_NOPARACHUTE) < 0 ) { ShowError("WinMain() error", SDL_GetError()); return(FALSE); } atexit(cleanup_output); atexit(cleanup); /* Sam: We still need to pass in the application handle so that DirectInput will initialize properly when SDL_RegisterApp() is called later in the video initialization. */ SDL_SetModuleHandle(GetModuleHandle(NULL)); /* Run the application main() code */ status = SDL_main(argc, argv); /* Exit cleanly, calling atexit() functions */ exit(status); /* Hush little compiler, don't you cry... */ return 0; } /* This is where execution begins [windowed apps] */ int WINAPI WinMain(HINSTANCE hInst, HINSTANCE hPrev, LPSTR szCmdLine, int sw) { HMODULE handle; char **argv; int argc; char *cmdline; char *env_str; char *bufp; size_t nLen; /* Start up DDHELP.EXE before opening any files, so DDHELP doesn't keep them open. This is a hack.. hopefully it will be fixed someday. DDHELP.EXE starts up the first time DDRAW.DLL is loaded. */ handle = LoadLibrary(TEXT("DDRAW.DLL")); if ( handle != NULL ) { FreeLibrary(handle); } /* Check for stdio redirect settings and do the redirection */ if ((env_str = SDL_getenv("SDL_STDIO_REDIRECT"))) { if (SDL_atoi(env_str)) { redirect_output(); } } #ifndef NO_STDIO_REDIRECT else { redirect_output(); } #endif /* Grab the command line */ bufp = GetCommandLine(); nLen = SDL_strlen(bufp)+1; cmdline = SDL_stack_alloc(char, nLen); if ( cmdline == NULL ) { return OutOfMemory(); } SDL_strlcpy(cmdline, bufp, nLen); /* Parse it into argv and argc */ argc = ParseCommandLine(cmdline, NULL); argv = SDL_stack_alloc(char*, argc+1); if ( argv == NULL ) { return OutOfMemory(); } ParseCommandLine(cmdline, argv); /* Run the main program (after a little SDL initialization) */ console_main(argc, argv); /* Hush little compiler, don't you cry... */ return 0; } sdl12-compat-1.2.74/src/default_cursor.h0000664000000000000000000000505215125533266014736 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Default cursor - it happens to be the Mac cursor, but could be anything */ #define DEFAULT_CWIDTH 16 #define DEFAULT_CHEIGHT 16 #define DEFAULT_CHOTX 0 #define DEFAULT_CHOTY 0 /* Added a real MacOS cursor, at the request of Luc-Olivier de Charrire */ #define USE_MACOS_CURSOR #ifdef USE_MACOS_CURSOR static unsigned char default_cdata[] = { 0x00, 0x00, 0x40, 0x00, 0x60, 0x00, 0x70, 0x00, 0x78, 0x00, 0x7C, 0x00, 0x7E, 0x00, 0x7F, 0x00, 0x7F, 0x80, 0x7C, 0x00, 0x6C, 0x00, 0x46, 0x00, 0x06, 0x00, 0x03, 0x00, 0x03, 0x00, 0x00, 0x00 }; static unsigned char default_cmask[] = { 0xC0, 0x00, 0xE0, 0x00, 0xF0, 0x00, 0xF8, 0x00, 0xFC, 0x00, 0xFE, 0x00, 0xFF, 0x00, 0xFF, 0x80, 0xFF, 0xC0, 0xFF, 0xE0, 0xFE, 0x00, 0xEF, 0x00, 0xCF, 0x00, 0x87, 0x80, 0x07, 0x80, 0x03, 0x00 }; #else static unsigned char default_cdata[] = { 0x00, 0x00, 0x40, 0x00, 0x60, 0x00, 0x70, 0x00, 0x78, 0x00, 0x7C, 0x00, 0x7E, 0x00, 0x7F, 0x00, 0x7F, 0x80, 0x7C, 0x00, 0x6C, 0x00, 0x46, 0x00, 0x06, 0x00, 0x03, 0x00, 0x03, 0x00, 0x00, 0x00 }; static unsigned char default_cmask[] = { 0x40, 0x00, 0xE0, 0x00, 0xF0, 0x00, 0xF8, 0x00, 0xFC, 0x00, 0xFE, 0x00, 0xFF, 0x00, 0xFF, 0x80, 0xFF, 0xC0, 0xFF, 0x80, 0xFE, 0x00, 0xEF, 0x00, 0x4F, 0x00, 0x07, 0x80, 0x07, 0x80, 0x03, 0x00 }; #endif /* USE_MACOS_CURSOR */ /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/src/dr_mp3.h0000664000000000000000000062403415132567570013113 0ustar00/* MP3 audio decoder. Choice of public domain or MIT-0. See license statements at the end of this file. dr_mp3 - v0.7.3 - 2026-01-17 David Reid - mackron@gmail.com GitHub: https://github.com/mackron/dr_libs Based on minimp3 (https://github.com/lieff/minimp3) which is where the real work was done. See the bottom of this file for differences between minimp3 and dr_mp3. */ /* Introduction ============= dr_mp3 is a single file library. To use it, do something like the following in one .c file. ```c #define DR_MP3_IMPLEMENTATION #include "dr_mp3.h" ``` You can then #include this file in other parts of the program as you would with any other header file. To decode audio data, do something like the following: ```c drmp3 mp3; if (!drmp3_init_file(&mp3, "MySong.mp3", NULL)) { // Failed to open file } ... drmp3_uint64 framesRead = drmp3_read_pcm_frames_f32(pMP3, framesToRead, pFrames); ``` The drmp3 object is transparent so you can get access to the channel count and sample rate like so: ``` drmp3_uint32 channels = mp3.channels; drmp3_uint32 sampleRate = mp3.sampleRate; ``` The example above initializes a decoder from a file, but you can also initialize it from a block of memory and read and seek callbacks with `drmp3_init_memory()` and `drmp3_init()` respectively. You do not need to do any annoying memory management when reading PCM frames - this is all managed internally. You can request any number of PCM frames in each call to `drmp3_read_pcm_frames_f32()` and it will return as many PCM frames as it can, up to the requested amount. You can also decode an entire file in one go with `drmp3_open_and_read_pcm_frames_f32()`, `drmp3_open_memory_and_read_pcm_frames_f32()` and `drmp3_open_file_and_read_pcm_frames_f32()`. Build Options ============= #define these options before including this file. #define DR_MP3_NO_STDIO Disable drmp3_init_file(), etc. #define DR_MP3_NO_SIMD Disable SIMD optimizations. */ #ifndef dr_mp3_h #define dr_mp3_h #ifdef __cplusplus extern "C" { #endif #ifndef DR_MP3_NO_S16 #ifndef DR_MP3_FLOAT_OUTPUT #define DR_MP3_FLOAT_OUTPUT #endif #endif #define DRMP3_STRINGIFY(x) #x #define DRMP3_XSTRINGIFY(x) DRMP3_STRINGIFY(x) #define DRMP3_VERSION_MAJOR 0 #define DRMP3_VERSION_MINOR 7 #define DRMP3_VERSION_REVISION 3 #define DRMP3_VERSION_STRING DRMP3_XSTRINGIFY(DRMP3_VERSION_MAJOR) "." DRMP3_XSTRINGIFY(DRMP3_VERSION_MINOR) "." DRMP3_XSTRINGIFY(DRMP3_VERSION_REVISION) #include /* For size_t. */ /* Sized Types */ typedef signed char drmp3_int8; typedef unsigned char drmp3_uint8; typedef signed short drmp3_int16; typedef unsigned short drmp3_uint16; typedef signed int drmp3_int32; typedef unsigned int drmp3_uint32; #if defined(_MSC_VER) && !defined(__clang__) typedef signed __int64 drmp3_int64; typedef unsigned __int64 drmp3_uint64; #else #if defined(__clang__) || (defined(__GNUC__) && (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 6))) #pragma GCC diagnostic push #pragma GCC diagnostic ignored "-Wlong-long" #if defined(__clang__) #pragma GCC diagnostic ignored "-Wc++11-long-long" #endif #endif typedef signed long long drmp3_int64; typedef unsigned long long drmp3_uint64; #if defined(__clang__) || (defined(__GNUC__) && (__GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 6))) #pragma GCC diagnostic pop #endif #endif #if defined(__LP64__) || defined(_WIN64) || (defined(__x86_64__) && !defined(__ILP32__)) || defined(_M_X64) || defined(__ia64) || defined (_M_IA64) || defined(__aarch64__) || defined(_M_ARM64) || defined(_M_ARM64EC) || defined(__powerpc64__) typedef drmp3_uint64 drmp3_uintptr; #else typedef drmp3_uint32 drmp3_uintptr; #endif typedef drmp3_uint8 drmp3_bool8; typedef drmp3_uint32 drmp3_bool32; #define DRMP3_TRUE 1 #define DRMP3_FALSE 0 /* Weird shifting syntax is for VC6 compatibility. */ #define DRMP3_UINT64_MAX (((drmp3_uint64)0xFFFFFFFF << 32) | (drmp3_uint64)0xFFFFFFFF) /* End Sized Types */ /* Decorations */ #if !defined(DRMP3_API) #if defined(DRMP3_DLL) #if defined(_WIN32) #define DRMP3_DLL_IMPORT __declspec(dllimport) #define DRMP3_DLL_EXPORT __declspec(dllexport) #define DRMP3_DLL_PRIVATE static #else #if defined(__GNUC__) && __GNUC__ >= 4 #define DRMP3_DLL_IMPORT __attribute__((visibility("default"))) #define DRMP3_DLL_EXPORT __attribute__((visibility("default"))) #define DRMP3_DLL_PRIVATE __attribute__((visibility("hidden"))) #else #define DRMP3_DLL_IMPORT #define DRMP3_DLL_EXPORT #define DRMP3_DLL_PRIVATE static #endif #endif #if defined(DR_MP3_IMPLEMENTATION) #define DRMP3_API DRMP3_DLL_EXPORT #else #define DRMP3_API DRMP3_DLL_IMPORT #endif #define DRMP3_PRIVATE DRMP3_DLL_PRIVATE #else #define DRMP3_API extern #define DRMP3_PRIVATE static #endif #endif /* End Decorations */ /* Result Codes */ typedef drmp3_int32 drmp3_result; #define DRMP3_SUCCESS 0 #define DRMP3_ERROR -1 /* A generic error. */ #define DRMP3_INVALID_ARGS -2 #define DRMP3_INVALID_OPERATION -3 #define DRMP3_OUT_OF_MEMORY -4 #define DRMP3_OUT_OF_RANGE -5 #define DRMP3_ACCESS_DENIED -6 #define DRMP3_DOES_NOT_EXIST -7 #define DRMP3_ALREADY_EXISTS -8 #define DRMP3_TOO_MANY_OPEN_FILES -9 #define DRMP3_INVALID_FILE -10 #define DRMP3_TOO_BIG -11 #define DRMP3_PATH_TOO_LONG -12 #define DRMP3_NAME_TOO_LONG -13 #define DRMP3_NOT_DIRECTORY -14 #define DRMP3_IS_DIRECTORY -15 #define DRMP3_DIRECTORY_NOT_EMPTY -16 #define DRMP3_END_OF_FILE -17 #define DRMP3_NO_SPACE -18 #define DRMP3_BUSY -19 #define DRMP3_IO_ERROR -20 #define DRMP3_INTERRUPT -21 #define DRMP3_UNAVAILABLE -22 #define DRMP3_ALREADY_IN_USE -23 #define DRMP3_BAD_ADDRESS -24 #define DRMP3_BAD_SEEK -25 #define DRMP3_BAD_PIPE -26 #define DRMP3_DEADLOCK -27 #define DRMP3_TOO_MANY_LINKS -28 #define DRMP3_NOT_IMPLEMENTED -29 #define DRMP3_NO_MESSAGE -30 #define DRMP3_BAD_MESSAGE -31 #define DRMP3_NO_DATA_AVAILABLE -32 #define DRMP3_INVALID_DATA -33 #define DRMP3_TIMEOUT -34 #define DRMP3_NO_NETWORK -35 #define DRMP3_NOT_UNIQUE -36 #define DRMP3_NOT_SOCKET -37 #define DRMP3_NO_ADDRESS -38 #define DRMP3_BAD_PROTOCOL -39 #define DRMP3_PROTOCOL_UNAVAILABLE -40 #define DRMP3_PROTOCOL_NOT_SUPPORTED -41 #define DRMP3_PROTOCOL_FAMILY_NOT_SUPPORTED -42 #define DRMP3_ADDRESS_FAMILY_NOT_SUPPORTED -43 #define DRMP3_SOCKET_NOT_SUPPORTED -44 #define DRMP3_CONNECTION_RESET -45 #define DRMP3_ALREADY_CONNECTED -46 #define DRMP3_NOT_CONNECTED -47 #define DRMP3_CONNECTION_REFUSED -48 #define DRMP3_NO_HOST -49 #define DRMP3_IN_PROGRESS -50 #define DRMP3_CANCELLED -51 #define DRMP3_MEMORY_ALREADY_MAPPED -52 #define DRMP3_AT_END -53 /* End Result Codes */ #define DRMP3_MAX_PCM_FRAMES_PER_MP3_FRAME 1152 #define DRMP3_MAX_SAMPLES_PER_FRAME (DRMP3_MAX_PCM_FRAMES_PER_MP3_FRAME*2) /* Inline */ #ifdef _MSC_VER #define DRMP3_INLINE __forceinline #elif defined(__GNUC__) /* I've had a bug report where GCC is emitting warnings about functions possibly not being inlineable. This warning happens when the __attribute__((always_inline)) attribute is defined without an "inline" statement. I think therefore there must be some case where "__inline__" is not always defined, thus the compiler emitting these warnings. When using -std=c89 or -ansi on the command line, we cannot use the "inline" keyword and instead need to use "__inline__". In an attempt to work around this issue I am using "__inline__" only when we're compiling in strict ANSI mode. */ #if defined(__STRICT_ANSI__) #define DRMP3_GNUC_INLINE_HINT __inline__ #else #define DRMP3_GNUC_INLINE_HINT inline #endif #if (__GNUC__ > 3 || (__GNUC__ == 3 && __GNUC_MINOR__ >= 2)) || defined(__clang__) #define DRMP3_INLINE DRMP3_GNUC_INLINE_HINT __attribute__((always_inline)) #else #define DRMP3_INLINE DRMP3_GNUC_INLINE_HINT #endif #elif defined(__WATCOMC__) #define DRMP3_INLINE __inline #else #define DRMP3_INLINE #endif /* End Inline */ DRMP3_API void drmp3_version(drmp3_uint32* pMajor, drmp3_uint32* pMinor, drmp3_uint32* pRevision); DRMP3_API const char* drmp3_version_string(void); /* Allocation Callbacks */ typedef struct { void* pUserData; void* (* onMalloc)(size_t sz, void* pUserData); void* (* onRealloc)(void* p, size_t sz, void* pUserData); void (* onFree)(void* p, void* pUserData); } drmp3_allocation_callbacks; /* End Allocation Callbacks */ /* Low Level Push API ================== */ #define DRMP3_MAX_BITRESERVOIR_BYTES 511 #define DRMP3_MAX_FREE_FORMAT_FRAME_SIZE 2304 /* more than ISO spec's */ #define DRMP3_MAX_L3_FRAME_PAYLOAD_BYTES DRMP3_MAX_FREE_FORMAT_FRAME_SIZE /* MUST be >= 320000/8/32000*1152 = 1440 */ typedef struct { int frame_bytes, channels, sample_rate, layer, bitrate_kbps; } drmp3dec_frame_info; typedef struct { const drmp3_uint8 *buf; int pos, limit; } drmp3_bs; typedef struct { const drmp3_uint8 *sfbtab; drmp3_uint16 part_23_length, big_values, scalefac_compress; drmp3_uint8 global_gain, block_type, mixed_block_flag, n_long_sfb, n_short_sfb; drmp3_uint8 table_select[3], region_count[3], subblock_gain[3]; drmp3_uint8 preflag, scalefac_scale, count1_table, scfsi; } drmp3_L3_gr_info; typedef struct { drmp3_bs bs; drmp3_uint8 maindata[DRMP3_MAX_BITRESERVOIR_BYTES + DRMP3_MAX_L3_FRAME_PAYLOAD_BYTES]; drmp3_L3_gr_info gr_info[4]; float grbuf[2][576], scf[40], syn[18 + 15][2*32]; drmp3_uint8 ist_pos[2][39]; } drmp3dec_scratch; typedef struct { float mdct_overlap[2][9*32], qmf_state[15*2*32]; int reserv, free_format_bytes; drmp3_uint8 header[4], reserv_buf[511]; drmp3dec_scratch scratch; } drmp3dec; /* Initializes a low level decoder. */ DRMP3_API void drmp3dec_init(drmp3dec *dec); /* Reads a frame from a low level decoder. */ DRMP3_API int drmp3dec_decode_frame(drmp3dec *dec, const drmp3_uint8 *mp3, int mp3_bytes, void *pcm, drmp3dec_frame_info *info); #ifndef DR_MP3_NO_S16 /* Helper for converting between f32 and s16. */ DRMP3_API void drmp3dec_f32_to_s16(const float *in, drmp3_int16 *out, size_t num_samples); #endif /* Main API (Pull API) =================== */ typedef enum { DRMP3_SEEK_SET, DRMP3_SEEK_CUR, DRMP3_SEEK_END } drmp3_seek_origin; typedef struct { drmp3_uint64 seekPosInBytes; /* Points to the first byte of an MP3 frame. */ drmp3_uint64 pcmFrameIndex; /* The index of the PCM frame this seek point targets. */ drmp3_uint16 mp3FramesToDiscard; /* The number of whole MP3 frames to be discarded before pcmFramesToDiscard. */ drmp3_uint16 pcmFramesToDiscard; /* The number of leading samples to read and discard. These are discarded after mp3FramesToDiscard. */ } drmp3_seek_point; typedef enum { DRMP3_METADATA_TYPE_ID3V1, DRMP3_METADATA_TYPE_ID3V2, DRMP3_METADATA_TYPE_APE, DRMP3_METADATA_TYPE_XING, DRMP3_METADATA_TYPE_VBRI } drmp3_metadata_type; typedef struct { drmp3_metadata_type type; const void* pRawData; /* A pointer to the raw data. */ size_t rawDataSize; } drmp3_metadata; /* Callback for when data is read. Return value is the number of bytes actually read. pUserData [in] The user data that was passed to drmp3_init(), and family. pBufferOut [out] The output buffer. bytesToRead [in] The number of bytes to read. Returns the number of bytes actually read. A return value of less than bytesToRead indicates the end of the stream. Do _not_ return from this callback until either the entire bytesToRead is filled or you have reached the end of the stream. */ typedef size_t (* drmp3_read_proc)(void* pUserData, void* pBufferOut, size_t bytesToRead); /* Callback for when data needs to be seeked. pUserData [in] The user data that was passed to drmp3_init(), and family. offset [in] The number of bytes to move, relative to the origin. Can be negative. origin [in] The origin of the seek. Returns whether or not the seek was successful. */ typedef drmp3_bool32 (* drmp3_seek_proc)(void* pUserData, int offset, drmp3_seek_origin origin); /* Callback for retrieving the current cursor position. pUserData [in] The user data that was passed to drmp3_init(), and family. pCursor [out] The cursor position in bytes from the start of the stream. Returns whether or not the cursor position was successfully retrieved. */ typedef drmp3_bool32 (* drmp3_tell_proc)(void* pUserData, drmp3_int64* pCursor); /* Callback for when metadata is read. Only the raw data is provided. The client is responsible for parsing the contents of the data themsevles. */ typedef void (* drmp3_meta_proc)(void* pUserData, const drmp3_metadata* pMetadata); typedef struct { drmp3_uint32 channels; drmp3_uint32 sampleRate; } drmp3_config; typedef struct { drmp3dec decoder; drmp3_uint32 channels; drmp3_uint32 sampleRate; drmp3_read_proc onRead; drmp3_seek_proc onSeek; drmp3_meta_proc onMeta; void* pUserData; void* pUserDataMeta; drmp3_allocation_callbacks allocationCallbacks; drmp3_uint32 mp3FrameChannels; /* The number of channels in the currently loaded MP3 frame. Internal use only. */ drmp3_uint32 mp3FrameSampleRate; /* The sample rate of the currently loaded MP3 frame. Internal use only. */ drmp3_uint32 pcmFramesConsumedInMP3Frame; drmp3_uint32 pcmFramesRemainingInMP3Frame; drmp3_uint8 pcmFrames[sizeof(float)*DRMP3_MAX_SAMPLES_PER_FRAME]; /* <-- Multipled by sizeof(float) to ensure there's enough room for DR_MP3_FLOAT_OUTPUT. */ drmp3_uint64 currentPCMFrame; /* The current PCM frame, globally. */ drmp3_uint64 streamCursor; /* The current byte the decoder is sitting on in the raw stream. */ drmp3_uint64 streamLength; /* The length of the stream in bytes. dr_mp3 will not read beyond this. If a ID3v1 or APE tag is present, this will be set to the first byte of the tag. */ drmp3_uint64 streamStartOffset; /* The offset of the start of the MP3 data. This is used for skipping ID3v2 and VBR tags. */ drmp3_seek_point* pSeekPoints; /* NULL by default. Set with drmp3_bind_seek_table(). Memory is owned by the client. dr_mp3 will never attempt to free this pointer. */ drmp3_uint32 seekPointCount; /* The number of items in pSeekPoints. When set to 0 assumes to no seek table. Defaults to zero. */ drmp3_uint32 delayInPCMFrames; drmp3_uint32 paddingInPCMFrames; drmp3_uint64 totalPCMFrameCount; /* Set to DRMP3_UINT64_MAX if the length is unknown. Includes delay and padding. */ drmp3_bool32 isVBR; drmp3_bool32 isCBR; size_t dataSize; size_t dataCapacity; size_t dataConsumed; drmp3_uint8* pData; drmp3_bool32 atEnd; struct { const drmp3_uint8* pData; size_t dataSize; size_t currentReadPos; } memory; /* Only used for decoders that were opened against a block of memory. */ } drmp3; /* Initializes an MP3 decoder. onRead [in] The function to call when data needs to be read from the client. onSeek [in] The function to call when the read position of the client data needs to move. onTell [in] The function to call when the read position of the client data needs to be retrieved. pUserData [in, optional] A pointer to application defined data that will be passed to onRead and onSeek. Returns true if successful; false otherwise. Close the loader with drmp3_uninit(). See also: drmp3_init_file(), drmp3_init_memory(), drmp3_uninit() */ DRMP3_API drmp3_bool32 drmp3_init(drmp3* pMP3, drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, drmp3_meta_proc onMeta, void* pUserData, const drmp3_allocation_callbacks* pAllocationCallbacks); /* Initializes an MP3 decoder from a block of memory. This does not create a copy of the data. It is up to the application to ensure the buffer remains valid for the lifetime of the drmp3 object. The buffer should contain the contents of the entire MP3 file. */ DRMP3_API drmp3_bool32 drmp3_init_memory_with_metadata(drmp3* pMP3, const void* pData, size_t dataSize, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks); DRMP3_API drmp3_bool32 drmp3_init_memory(drmp3* pMP3, const void* pData, size_t dataSize, const drmp3_allocation_callbacks* pAllocationCallbacks); #ifndef DR_MP3_NO_STDIO /* Initializes an MP3 decoder from a file. This holds the internal FILE object until drmp3_uninit() is called. Keep this in mind if you're caching drmp3 objects because the operating system may restrict the number of file handles an application can have open at any given time. */ DRMP3_API drmp3_bool32 drmp3_init_file_with_metadata(drmp3* pMP3, const char* pFilePath, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks); DRMP3_API drmp3_bool32 drmp3_init_file_with_metadata_w(drmp3* pMP3, const wchar_t* pFilePath, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks); DRMP3_API drmp3_bool32 drmp3_init_file(drmp3* pMP3, const char* pFilePath, const drmp3_allocation_callbacks* pAllocationCallbacks); DRMP3_API drmp3_bool32 drmp3_init_file_w(drmp3* pMP3, const wchar_t* pFilePath, const drmp3_allocation_callbacks* pAllocationCallbacks); #endif /* Uninitializes an MP3 decoder. */ DRMP3_API void drmp3_uninit(drmp3* pMP3); /* Reads PCM frames as interleaved 32-bit IEEE floating point PCM. Note that framesToRead specifies the number of PCM frames to read, _not_ the number of MP3 frames. */ DRMP3_API drmp3_uint64 drmp3_read_pcm_frames_f32(drmp3* pMP3, drmp3_uint64 framesToRead, float* pBufferOut); #ifndef DR_MP3_NO_S16 /* Reads PCM frames as interleaved signed 16-bit integer PCM. Note that framesToRead specifies the number of PCM frames to read, _not_ the number of MP3 frames. */ DRMP3_API drmp3_uint64 drmp3_read_pcm_frames_s16(drmp3* pMP3, drmp3_uint64 framesToRead, drmp3_int16* pBufferOut); #endif /* Seeks to a specific frame. Note that this is _not_ an MP3 frame, but rather a PCM frame. */ DRMP3_API drmp3_bool32 drmp3_seek_to_pcm_frame(drmp3* pMP3, drmp3_uint64 frameIndex); /* Calculates the total number of PCM frames in the MP3 stream. Cannot be used for infinite streams such as internet radio. Runs in linear time. Returns 0 on error. */ DRMP3_API drmp3_uint64 drmp3_get_pcm_frame_count(drmp3* pMP3); /* Calculates the total number of MP3 frames in the MP3 stream. Cannot be used for infinite streams such as internet radio. Runs in linear time. Returns 0 on error. */ DRMP3_API drmp3_uint64 drmp3_get_mp3_frame_count(drmp3* pMP3); /* Calculates the total number of MP3 and PCM frames in the MP3 stream. Cannot be used for infinite streams such as internet radio. Runs in linear time. Returns 0 on error. This is equivalent to calling drmp3_get_mp3_frame_count() and drmp3_get_pcm_frame_count() except that it's more efficient. */ DRMP3_API drmp3_bool32 drmp3_get_mp3_and_pcm_frame_count(drmp3* pMP3, drmp3_uint64* pMP3FrameCount, drmp3_uint64* pPCMFrameCount); /* Calculates the seekpoints based on PCM frames. This is slow. pSeekpoint count is a pointer to a uint32 containing the seekpoint count. On input it contains the desired count. On output it contains the actual count. The reason for this design is that the client may request too many seekpoints, in which case dr_mp3 will return a corrected count. Note that seektable seeking is not quite sample exact when the MP3 stream contains inconsistent sample rates. */ DRMP3_API drmp3_bool32 drmp3_calculate_seek_points(drmp3* pMP3, drmp3_uint32* pSeekPointCount, drmp3_seek_point* pSeekPoints); /* Binds a seek table to the decoder. This does _not_ make a copy of pSeekPoints - it only references it. It is up to the application to ensure this remains valid while it is bound to the decoder. Use drmp3_calculate_seek_points() to calculate the seek points. */ DRMP3_API drmp3_bool32 drmp3_bind_seek_table(drmp3* pMP3, drmp3_uint32 seekPointCount, drmp3_seek_point* pSeekPoints); #ifndef DR_MP3_NO_FULL_READ /* Opens an decodes an entire MP3 stream as a single operation. On output pConfig will receive the channel count and sample rate of the stream. Free the returned pointer with drmp3_free(). */ DRMP3_API float* drmp3_open_and_read_pcm_frames_f32(drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, void* pUserData, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_and_read_pcm_frames_s16(drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, void* pUserData, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #endif DRMP3_API float* drmp3_open_memory_and_read_pcm_frames_f32(const void* pData, size_t dataSize, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_memory_and_read_pcm_frames_s16(const void* pData, size_t dataSize, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #endif #ifndef DR_MP3_NO_STDIO DRMP3_API float* drmp3_open_file_and_read_pcm_frames_f32(const char* filePath, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_file_and_read_pcm_frames_s16(const char* filePath, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks); #endif #endif #endif /* Allocates a block of memory on the heap. */ DRMP3_API void* drmp3_malloc(size_t sz, const drmp3_allocation_callbacks* pAllocationCallbacks); /* Frees any memory that was allocated by a public drmp3 API. */ DRMP3_API void drmp3_free(void* p, const drmp3_allocation_callbacks* pAllocationCallbacks); #ifdef __cplusplus } #endif #endif /* dr_mp3_h */ /************************************************************************************************************************************************************ ************************************************************************************************************************************************************ IMPLEMENTATION ************************************************************************************************************************************************************ ************************************************************************************************************************************************************/ #if defined(DR_MP3_IMPLEMENTATION) #ifndef dr_mp3_c #define dr_mp3_c #include #include #include /* For INT_MAX */ DRMP3_API void drmp3_version(drmp3_uint32* pMajor, drmp3_uint32* pMinor, drmp3_uint32* pRevision) { if (pMajor) { *pMajor = DRMP3_VERSION_MAJOR; } if (pMinor) { *pMinor = DRMP3_VERSION_MINOR; } if (pRevision) { *pRevision = DRMP3_VERSION_REVISION; } } DRMP3_API const char* drmp3_version_string(void) { return DRMP3_VERSION_STRING; } /* Disable SIMD when compiling with TCC for now. */ #if defined(__TINYC__) #define DR_MP3_NO_SIMD #endif #define DRMP3_OFFSET_PTR(p, offset) ((void*)((drmp3_uint8*)(p) + (offset))) #ifndef DRMP3_MAX_FRAME_SYNC_MATCHES #define DRMP3_MAX_FRAME_SYNC_MATCHES 10 #endif #define DRMP3_SHORT_BLOCK_TYPE 2 #define DRMP3_STOP_BLOCK_TYPE 3 #define DRMP3_MODE_MONO 3 #define DRMP3_MODE_JOINT_STEREO 1 #define DRMP3_HDR_SIZE 4 #define DRMP3_HDR_IS_MONO(h) (((h[3]) & 0xC0) == 0xC0) #define DRMP3_HDR_IS_MS_STEREO(h) (((h[3]) & 0xE0) == 0x60) #define DRMP3_HDR_IS_FREE_FORMAT(h) (((h[2]) & 0xF0) == 0) #define DRMP3_HDR_IS_CRC(h) (!((h[1]) & 1)) #define DRMP3_HDR_TEST_PADDING(h) ((h[2]) & 0x2) #define DRMP3_HDR_TEST_MPEG1(h) ((h[1]) & 0x8) #define DRMP3_HDR_TEST_NOT_MPEG25(h) ((h[1]) & 0x10) #define DRMP3_HDR_TEST_I_STEREO(h) ((h[3]) & 0x10) #define DRMP3_HDR_TEST_MS_STEREO(h) ((h[3]) & 0x20) #define DRMP3_HDR_GET_STEREO_MODE(h) (((h[3]) >> 6) & 3) #define DRMP3_HDR_GET_STEREO_MODE_EXT(h) (((h[3]) >> 4) & 3) #define DRMP3_HDR_GET_LAYER(h) (((h[1]) >> 1) & 3) #define DRMP3_HDR_GET_BITRATE(h) ((h[2]) >> 4) #define DRMP3_HDR_GET_SAMPLE_RATE(h) (((h[2]) >> 2) & 3) #define DRMP3_HDR_GET_MY_SAMPLE_RATE(h) (DRMP3_HDR_GET_SAMPLE_RATE(h) + (((h[1] >> 3) & 1) + ((h[1] >> 4) & 1))*3) #define DRMP3_HDR_IS_FRAME_576(h) ((h[1] & 14) == 2) #define DRMP3_HDR_IS_LAYER_1(h) ((h[1] & 6) == 6) #define DRMP3_BITS_DEQUANTIZER_OUT -1 #define DRMP3_MAX_SCF (255 + DRMP3_BITS_DEQUANTIZER_OUT*4 - 210) #define DRMP3_MAX_SCFI ((DRMP3_MAX_SCF + 3) & ~3) #define DRMP3_MIN(a, b) ((a) > (b) ? (b) : (a)) #define DRMP3_MAX(a, b) ((a) < (b) ? (b) : (a)) #if !defined(DR_MP3_NO_SIMD) #if !defined(DR_MP3_ONLY_SIMD) && (defined(_M_X64) || defined(__x86_64__) || defined(__aarch64__) || defined(_M_ARM64) || defined(_M_ARM64EC)) /* x64 always have SSE2, arm64 always have neon, no need for generic code */ #define DR_MP3_ONLY_SIMD #endif #if ((defined(_MSC_VER) && _MSC_VER >= 1400) && defined(_M_X64)) || ((defined(__i386) || defined(_M_IX86) || defined(__i386__) || defined(__x86_64__)) && ((defined(_M_IX86_FP) && _M_IX86_FP == 2) || defined(__SSE2__))) #if defined(_MSC_VER) #include #endif #include #define DRMP3_HAVE_SSE 1 #define DRMP3_HAVE_SIMD 1 #define DRMP3_VSTORE _mm_storeu_ps #define DRMP3_VLD _mm_loadu_ps #define DRMP3_VSET _mm_set1_ps #define DRMP3_VADD _mm_add_ps #define DRMP3_VSUB _mm_sub_ps #define DRMP3_VMUL _mm_mul_ps #define DRMP3_VMAC(a, x, y) _mm_add_ps(a, _mm_mul_ps(x, y)) #define DRMP3_VMSB(a, x, y) _mm_sub_ps(a, _mm_mul_ps(x, y)) #define DRMP3_VMUL_S(x, s) _mm_mul_ps(x, _mm_set1_ps(s)) #define DRMP3_VREV(x) _mm_shuffle_ps(x, x, _MM_SHUFFLE(0, 1, 2, 3)) typedef __m128 drmp3_f4; #if (defined(_MSC_VER) || defined(DR_MP3_ONLY_SIMD)) && !defined(__clang__) #define drmp3_cpuid __cpuid #else static __inline__ __attribute__((always_inline)) void drmp3_cpuid(int CPUInfo[], const int InfoType) { #if defined(__PIC__) __asm__ __volatile__( #if defined(__x86_64__) "push %%rbx\n" "cpuid\n" "xchgl %%ebx, %1\n" "pop %%rbx\n" #else "xchgl %%ebx, %1\n" "cpuid\n" "xchgl %%ebx, %1\n" #endif : "=a" (CPUInfo[0]), "=r" (CPUInfo[1]), "=c" (CPUInfo[2]), "=d" (CPUInfo[3]) : "a" (InfoType)); #else __asm__ __volatile__( "cpuid" : "=a" (CPUInfo[0]), "=b" (CPUInfo[1]), "=c" (CPUInfo[2]), "=d" (CPUInfo[3]) : "a" (InfoType)); #endif } #endif static int drmp3_have_simd(void) { #ifdef DR_MP3_ONLY_SIMD return 1; #else static int g_have_simd; int CPUInfo[4]; #ifdef MINIMP3_TEST static int g_counter; if (g_counter++ > 100) return 0; #endif if (g_have_simd) goto end; drmp3_cpuid(CPUInfo, 0); if (CPUInfo[0] > 0) { drmp3_cpuid(CPUInfo, 1); g_have_simd = (CPUInfo[3] & (1 << 26)) + 1; /* SSE2 */ return g_have_simd - 1; } end: return g_have_simd - 1; #endif } #elif defined(__ARM_NEON) || defined(__aarch64__) || defined(_M_ARM64) || defined(_M_ARM64EC) #include #define DRMP3_HAVE_SSE 0 #define DRMP3_HAVE_SIMD 1 #define DRMP3_VSTORE vst1q_f32 #define DRMP3_VLD vld1q_f32 #define DRMP3_VSET vmovq_n_f32 #define DRMP3_VADD vaddq_f32 #define DRMP3_VSUB vsubq_f32 #define DRMP3_VMUL vmulq_f32 #define DRMP3_VMAC(a, x, y) vmlaq_f32(a, x, y) #define DRMP3_VMSB(a, x, y) vmlsq_f32(a, x, y) #define DRMP3_VMUL_S(x, s) vmulq_f32(x, vmovq_n_f32(s)) #define DRMP3_VREV(x) vcombine_f32(vget_high_f32(vrev64q_f32(x)), vget_low_f32(vrev64q_f32(x))) typedef float32x4_t drmp3_f4; static int drmp3_have_simd(void) { /* TODO: detect neon for !DR_MP3_ONLY_SIMD */ return 1; } #else #define DRMP3_HAVE_SSE 0 #define DRMP3_HAVE_SIMD 0 #ifdef DR_MP3_ONLY_SIMD #error DR_MP3_ONLY_SIMD used, but SSE/NEON not enabled #endif #endif #else #define DRMP3_HAVE_SIMD 0 #endif #if defined(__ARM_ARCH) && (__ARM_ARCH >= 6) && !defined(__aarch64__) && !defined(_M_ARM64) && !defined(_M_ARM64EC) && !defined(__ARM_ARCH_6M__) #define DRMP3_HAVE_ARMV6 1 static __inline__ __attribute__((always_inline)) drmp3_int32 drmp3_clip_int16_arm(drmp3_int32 a) { drmp3_int32 x = 0; __asm__ ("ssat %0, #16, %1" : "=r"(x) : "r"(a)); return x; } #else #define DRMP3_HAVE_ARMV6 0 #endif /* Standard library stuff. */ #ifndef DRMP3_ASSERT #include #define DRMP3_ASSERT(expression) assert(expression) #endif #ifndef DRMP3_COPY_MEMORY #define DRMP3_COPY_MEMORY(dst, src, sz) memcpy((dst), (src), (sz)) #endif #ifndef DRMP3_MOVE_MEMORY #define DRMP3_MOVE_MEMORY(dst, src, sz) memmove((dst), (src), (sz)) #endif #ifndef DRMP3_ZERO_MEMORY #define DRMP3_ZERO_MEMORY(p, sz) memset((p), 0, (sz)) #endif #define DRMP3_ZERO_OBJECT(p) DRMP3_ZERO_MEMORY((p), sizeof(*(p))) #ifndef DRMP3_MALLOC #define DRMP3_MALLOC(sz) malloc((sz)) #endif #ifndef DRMP3_REALLOC #define DRMP3_REALLOC(p, sz) realloc((p), (sz)) #endif #ifndef DRMP3_FREE #define DRMP3_FREE(p) free((p)) #endif typedef struct { float scf[3*64]; drmp3_uint8 total_bands, stereo_bands, bitalloc[64], scfcod[64]; } drmp3_L12_scale_info; typedef struct { drmp3_uint8 tab_offset, code_tab_width, band_count; } drmp3_L12_subband_alloc; static void drmp3_bs_init(drmp3_bs *bs, const drmp3_uint8 *data, int bytes) { bs->buf = data; bs->pos = 0; bs->limit = bytes*8; } static drmp3_uint32 drmp3_bs_get_bits(drmp3_bs *bs, int n) { drmp3_uint32 next, cache = 0, s = bs->pos & 7; int shl = n + s; const drmp3_uint8 *p = bs->buf + (bs->pos >> 3); if ((bs->pos += n) > bs->limit) return 0; next = *p++ & (255 >> s); while ((shl -= 8) > 0) { cache |= next << shl; next = *p++; } return cache | (next >> -shl); } static int drmp3_hdr_valid(const drmp3_uint8 *h) { return h[0] == 0xff && ((h[1] & 0xF0) == 0xf0 || (h[1] & 0xFE) == 0xe2) && (DRMP3_HDR_GET_LAYER(h) != 0) && (DRMP3_HDR_GET_BITRATE(h) != 15) && (DRMP3_HDR_GET_SAMPLE_RATE(h) != 3); } static int drmp3_hdr_compare(const drmp3_uint8 *h1, const drmp3_uint8 *h2) { return drmp3_hdr_valid(h2) && ((h1[1] ^ h2[1]) & 0xFE) == 0 && ((h1[2] ^ h2[2]) & 0x0C) == 0 && !(DRMP3_HDR_IS_FREE_FORMAT(h1) ^ DRMP3_HDR_IS_FREE_FORMAT(h2)); } static unsigned drmp3_hdr_bitrate_kbps(const drmp3_uint8 *h) { static const drmp3_uint8 halfrate[2][3][15] = { { { 0,4,8,12,16,20,24,28,32,40,48,56,64,72,80 }, { 0,4,8,12,16,20,24,28,32,40,48,56,64,72,80 }, { 0,16,24,28,32,40,48,56,64,72,80,88,96,112,128 } }, { { 0,16,20,24,28,32,40,48,56,64,80,96,112,128,160 }, { 0,16,24,28,32,40,48,56,64,80,96,112,128,160,192 }, { 0,16,32,48,64,80,96,112,128,144,160,176,192,208,224 } }, }; return 2*halfrate[!!DRMP3_HDR_TEST_MPEG1(h)][DRMP3_HDR_GET_LAYER(h) - 1][DRMP3_HDR_GET_BITRATE(h)]; } static unsigned drmp3_hdr_sample_rate_hz(const drmp3_uint8 *h) { static const unsigned g_hz[3] = { 44100, 48000, 32000 }; return g_hz[DRMP3_HDR_GET_SAMPLE_RATE(h)] >> (int)!DRMP3_HDR_TEST_MPEG1(h) >> (int)!DRMP3_HDR_TEST_NOT_MPEG25(h); } static unsigned drmp3_hdr_frame_samples(const drmp3_uint8 *h) { return DRMP3_HDR_IS_LAYER_1(h) ? 384 : (1152 >> (int)DRMP3_HDR_IS_FRAME_576(h)); } static int drmp3_hdr_frame_bytes(const drmp3_uint8 *h, int free_format_size) { int frame_bytes = drmp3_hdr_frame_samples(h)*drmp3_hdr_bitrate_kbps(h)*125/drmp3_hdr_sample_rate_hz(h); if (DRMP3_HDR_IS_LAYER_1(h)) { frame_bytes &= ~3; /* slot align */ } return frame_bytes ? frame_bytes : free_format_size; } static int drmp3_hdr_padding(const drmp3_uint8 *h) { return DRMP3_HDR_TEST_PADDING(h) ? (DRMP3_HDR_IS_LAYER_1(h) ? 4 : 1) : 0; } #ifndef DR_MP3_ONLY_MP3 static const drmp3_L12_subband_alloc *drmp3_L12_subband_alloc_table(const drmp3_uint8 *hdr, drmp3_L12_scale_info *sci) { const drmp3_L12_subband_alloc *alloc; int mode = DRMP3_HDR_GET_STEREO_MODE(hdr); int nbands, stereo_bands = (mode == DRMP3_MODE_MONO) ? 0 : (mode == DRMP3_MODE_JOINT_STEREO) ? (DRMP3_HDR_GET_STEREO_MODE_EXT(hdr) << 2) + 4 : 32; if (DRMP3_HDR_IS_LAYER_1(hdr)) { static const drmp3_L12_subband_alloc g_alloc_L1[] = { { 76, 4, 32 } }; alloc = g_alloc_L1; nbands = 32; } else if (!DRMP3_HDR_TEST_MPEG1(hdr)) { static const drmp3_L12_subband_alloc g_alloc_L2M2[] = { { 60, 4, 4 }, { 44, 3, 7 }, { 44, 2, 19 } }; alloc = g_alloc_L2M2; nbands = 30; } else { static const drmp3_L12_subband_alloc g_alloc_L2M1[] = { { 0, 4, 3 }, { 16, 4, 8 }, { 32, 3, 12 }, { 40, 2, 7 } }; int sample_rate_idx = DRMP3_HDR_GET_SAMPLE_RATE(hdr); unsigned kbps = drmp3_hdr_bitrate_kbps(hdr) >> (int)(mode != DRMP3_MODE_MONO); if (!kbps) /* free-format */ { kbps = 192; } alloc = g_alloc_L2M1; nbands = 27; if (kbps < 56) { static const drmp3_L12_subband_alloc g_alloc_L2M1_lowrate[] = { { 44, 4, 2 }, { 44, 3, 10 } }; alloc = g_alloc_L2M1_lowrate; nbands = sample_rate_idx == 2 ? 12 : 8; } else if (kbps >= 96 && sample_rate_idx != 1) { nbands = 30; } } sci->total_bands = (drmp3_uint8)nbands; sci->stereo_bands = (drmp3_uint8)DRMP3_MIN(stereo_bands, nbands); return alloc; } static void drmp3_L12_read_scalefactors(drmp3_bs *bs, drmp3_uint8 *pba, drmp3_uint8 *scfcod, int bands, float *scf) { static const float g_deq_L12[18*3] = { #define DRMP3_DQ(x) 9.53674316e-07f/x, 7.56931807e-07f/x, 6.00777173e-07f/x DRMP3_DQ(3),DRMP3_DQ(7),DRMP3_DQ(15),DRMP3_DQ(31),DRMP3_DQ(63),DRMP3_DQ(127),DRMP3_DQ(255),DRMP3_DQ(511),DRMP3_DQ(1023),DRMP3_DQ(2047),DRMP3_DQ(4095),DRMP3_DQ(8191),DRMP3_DQ(16383),DRMP3_DQ(32767),DRMP3_DQ(65535),DRMP3_DQ(3),DRMP3_DQ(5),DRMP3_DQ(9) }; int i, m; for (i = 0; i < bands; i++) { float s = 0; int ba = *pba++; int mask = ba ? 4 + ((19 >> scfcod[i]) & 3) : 0; for (m = 4; m; m >>= 1) { if (mask & m) { int b = drmp3_bs_get_bits(bs, 6); s = g_deq_L12[ba*3 - 6 + b % 3]*(int)(1 << 21 >> b/3); } *scf++ = s; } } } static void drmp3_L12_read_scale_info(const drmp3_uint8 *hdr, drmp3_bs *bs, drmp3_L12_scale_info *sci) { static const drmp3_uint8 g_bitalloc_code_tab[] = { 0,17, 3, 4, 5,6,7, 8,9,10,11,12,13,14,15,16, 0,17,18, 3,19,4,5, 6,7, 8, 9,10,11,12,13,16, 0,17,18, 3,19,4,5,16, 0,17,18,16, 0,17,18,19, 4,5,6, 7,8, 9,10,11,12,13,14,15, 0,17,18, 3,19,4,5, 6,7, 8, 9,10,11,12,13,14, 0, 2, 3, 4, 5,6,7, 8,9,10,11,12,13,14,15,16 }; const drmp3_L12_subband_alloc *subband_alloc = drmp3_L12_subband_alloc_table(hdr, sci); int i, k = 0, ba_bits = 0; const drmp3_uint8 *ba_code_tab = g_bitalloc_code_tab; for (i = 0; i < sci->total_bands; i++) { drmp3_uint8 ba; if (i == k) { k += subband_alloc->band_count; ba_bits = subband_alloc->code_tab_width; ba_code_tab = g_bitalloc_code_tab + subband_alloc->tab_offset; subband_alloc++; } ba = ba_code_tab[drmp3_bs_get_bits(bs, ba_bits)]; sci->bitalloc[2*i] = ba; if (i < sci->stereo_bands) { ba = ba_code_tab[drmp3_bs_get_bits(bs, ba_bits)]; } sci->bitalloc[2*i + 1] = sci->stereo_bands ? ba : 0; } for (i = 0; i < 2*sci->total_bands; i++) { sci->scfcod[i] = (drmp3_uint8)(sci->bitalloc[i] ? DRMP3_HDR_IS_LAYER_1(hdr) ? 2 : drmp3_bs_get_bits(bs, 2) : 6); } drmp3_L12_read_scalefactors(bs, sci->bitalloc, sci->scfcod, sci->total_bands*2, sci->scf); for (i = sci->stereo_bands; i < sci->total_bands; i++) { sci->bitalloc[2*i + 1] = 0; } } static int drmp3_L12_dequantize_granule(float *grbuf, drmp3_bs *bs, drmp3_L12_scale_info *sci, int group_size) { int i, j, k, choff = 576; for (j = 0; j < 4; j++) { float *dst = grbuf + group_size*j; for (i = 0; i < 2*sci->total_bands; i++) { int ba = sci->bitalloc[i]; if (ba != 0) { if (ba < 17) { int half = (1 << (ba - 1)) - 1; for (k = 0; k < group_size; k++) { dst[k] = (float)((int)drmp3_bs_get_bits(bs, ba) - half); } } else { unsigned mod = (2 << (ba - 17)) + 1; /* 3, 5, 9 */ unsigned code = drmp3_bs_get_bits(bs, mod + 2 - (mod >> 3)); /* 5, 7, 10 */ for (k = 0; k < group_size; k++, code /= mod) { dst[k] = (float)((int)(code % mod - mod/2)); } } } dst += choff; choff = 18 - choff; } } return group_size*4; } static void drmp3_L12_apply_scf_384(drmp3_L12_scale_info *sci, const float *scf, float *dst) { int i, k; DRMP3_COPY_MEMORY(dst + 576 + sci->stereo_bands*18, dst + sci->stereo_bands*18, (sci->total_bands - sci->stereo_bands)*18*sizeof(float)); for (i = 0; i < sci->total_bands; i++, dst += 18, scf += 6) { for (k = 0; k < 12; k++) { dst[k + 0] *= scf[0]; dst[k + 576] *= scf[3]; } } } #endif static int drmp3_L3_read_side_info(drmp3_bs *bs, drmp3_L3_gr_info *gr, const drmp3_uint8 *hdr) { static const drmp3_uint8 g_scf_long[8][23] = { { 6,6,6,6,6,6,8,10,12,14,16,20,24,28,32,38,46,52,60,68,58,54,0 }, { 12,12,12,12,12,12,16,20,24,28,32,40,48,56,64,76,90,2,2,2,2,2,0 }, { 6,6,6,6,6,6,8,10,12,14,16,20,24,28,32,38,46,52,60,68,58,54,0 }, { 6,6,6,6,6,6,8,10,12,14,16,18,22,26,32,38,46,54,62,70,76,36,0 }, { 6,6,6,6,6,6,8,10,12,14,16,20,24,28,32,38,46,52,60,68,58,54,0 }, { 4,4,4,4,4,4,6,6,8,8,10,12,16,20,24,28,34,42,50,54,76,158,0 }, { 4,4,4,4,4,4,6,6,6,8,10,12,16,18,22,28,34,40,46,54,54,192,0 }, { 4,4,4,4,4,4,6,6,8,10,12,16,20,24,30,38,46,56,68,84,102,26,0 } }; static const drmp3_uint8 g_scf_short[8][40] = { { 4,4,4,4,4,4,4,4,4,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,30,30,30,40,40,40,18,18,18,0 }, { 8,8,8,8,8,8,8,8,8,12,12,12,16,16,16,20,20,20,24,24,24,28,28,28,36,36,36,2,2,2,2,2,2,2,2,2,26,26,26,0 }, { 4,4,4,4,4,4,4,4,4,6,6,6,6,6,6,8,8,8,10,10,10,14,14,14,18,18,18,26,26,26,32,32,32,42,42,42,18,18,18,0 }, { 4,4,4,4,4,4,4,4,4,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,32,32,32,44,44,44,12,12,12,0 }, { 4,4,4,4,4,4,4,4,4,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,30,30,30,40,40,40,18,18,18,0 }, { 4,4,4,4,4,4,4,4,4,4,4,4,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,22,22,22,30,30,30,56,56,56,0 }, { 4,4,4,4,4,4,4,4,4,4,4,4,6,6,6,6,6,6,10,10,10,12,12,12,14,14,14,16,16,16,20,20,20,26,26,26,66,66,66,0 }, { 4,4,4,4,4,4,4,4,4,4,4,4,6,6,6,8,8,8,12,12,12,16,16,16,20,20,20,26,26,26,34,34,34,42,42,42,12,12,12,0 } }; static const drmp3_uint8 g_scf_mixed[8][40] = { { 6,6,6,6,6,6,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,30,30,30,40,40,40,18,18,18,0 }, { 12,12,12,4,4,4,8,8,8,12,12,12,16,16,16,20,20,20,24,24,24,28,28,28,36,36,36,2,2,2,2,2,2,2,2,2,26,26,26,0 }, { 6,6,6,6,6,6,6,6,6,6,6,6,8,8,8,10,10,10,14,14,14,18,18,18,26,26,26,32,32,32,42,42,42,18,18,18,0 }, { 6,6,6,6,6,6,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,32,32,32,44,44,44,12,12,12,0 }, { 6,6,6,6,6,6,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,24,24,24,30,30,30,40,40,40,18,18,18,0 }, { 4,4,4,4,4,4,6,6,4,4,4,6,6,6,8,8,8,10,10,10,12,12,12,14,14,14,18,18,18,22,22,22,30,30,30,56,56,56,0 }, { 4,4,4,4,4,4,6,6,4,4,4,6,6,6,6,6,6,10,10,10,12,12,12,14,14,14,16,16,16,20,20,20,26,26,26,66,66,66,0 }, { 4,4,4,4,4,4,6,6,4,4,4,6,6,6,8,8,8,12,12,12,16,16,16,20,20,20,26,26,26,34,34,34,42,42,42,12,12,12,0 } }; unsigned tables, scfsi = 0; int main_data_begin, part_23_sum = 0; int gr_count = DRMP3_HDR_IS_MONO(hdr) ? 1 : 2; int sr_idx = DRMP3_HDR_GET_MY_SAMPLE_RATE(hdr); sr_idx -= (sr_idx != 0); if (DRMP3_HDR_TEST_MPEG1(hdr)) { gr_count *= 2; main_data_begin = drmp3_bs_get_bits(bs, 9); scfsi = drmp3_bs_get_bits(bs, 7 + gr_count); } else { main_data_begin = drmp3_bs_get_bits(bs, 8 + gr_count) >> gr_count; } do { if (DRMP3_HDR_IS_MONO(hdr)) { scfsi <<= 4; } gr->part_23_length = (drmp3_uint16)drmp3_bs_get_bits(bs, 12); part_23_sum += gr->part_23_length; gr->big_values = (drmp3_uint16)drmp3_bs_get_bits(bs, 9); if (gr->big_values > 288) { return -1; } gr->global_gain = (drmp3_uint8)drmp3_bs_get_bits(bs, 8); gr->scalefac_compress = (drmp3_uint16)drmp3_bs_get_bits(bs, DRMP3_HDR_TEST_MPEG1(hdr) ? 4 : 9); gr->sfbtab = g_scf_long[sr_idx]; gr->n_long_sfb = 22; gr->n_short_sfb = 0; if (drmp3_bs_get_bits(bs, 1)) { gr->block_type = (drmp3_uint8)drmp3_bs_get_bits(bs, 2); if (!gr->block_type) { return -1; } gr->mixed_block_flag = (drmp3_uint8)drmp3_bs_get_bits(bs, 1); gr->region_count[0] = 7; gr->region_count[1] = 255; if (gr->block_type == DRMP3_SHORT_BLOCK_TYPE) { scfsi &= 0x0F0F; if (!gr->mixed_block_flag) { gr->region_count[0] = 8; gr->sfbtab = g_scf_short[sr_idx]; gr->n_long_sfb = 0; gr->n_short_sfb = 39; } else { gr->sfbtab = g_scf_mixed[sr_idx]; gr->n_long_sfb = DRMP3_HDR_TEST_MPEG1(hdr) ? 8 : 6; gr->n_short_sfb = 30; } } tables = drmp3_bs_get_bits(bs, 10); tables <<= 5; gr->subblock_gain[0] = (drmp3_uint8)drmp3_bs_get_bits(bs, 3); gr->subblock_gain[1] = (drmp3_uint8)drmp3_bs_get_bits(bs, 3); gr->subblock_gain[2] = (drmp3_uint8)drmp3_bs_get_bits(bs, 3); } else { gr->block_type = 0; gr->mixed_block_flag = 0; tables = drmp3_bs_get_bits(bs, 15); gr->region_count[0] = (drmp3_uint8)drmp3_bs_get_bits(bs, 4); gr->region_count[1] = (drmp3_uint8)drmp3_bs_get_bits(bs, 3); gr->region_count[2] = 255; } gr->table_select[0] = (drmp3_uint8)(tables >> 10); gr->table_select[1] = (drmp3_uint8)((tables >> 5) & 31); gr->table_select[2] = (drmp3_uint8)((tables) & 31); gr->preflag = (drmp3_uint8)(DRMP3_HDR_TEST_MPEG1(hdr) ? drmp3_bs_get_bits(bs, 1) : (gr->scalefac_compress >= 500)); gr->scalefac_scale = (drmp3_uint8)drmp3_bs_get_bits(bs, 1); gr->count1_table = (drmp3_uint8)drmp3_bs_get_bits(bs, 1); gr->scfsi = (drmp3_uint8)((scfsi >> 12) & 15); scfsi <<= 4; gr++; } while(--gr_count); if (part_23_sum + bs->pos > bs->limit + main_data_begin*8) { return -1; } return main_data_begin; } static void drmp3_L3_read_scalefactors(drmp3_uint8 *scf, drmp3_uint8 *ist_pos, const drmp3_uint8 *scf_size, const drmp3_uint8 *scf_count, drmp3_bs *bitbuf, int scfsi) { int i, k; for (i = 0; i < 4 && scf_count[i]; i++, scfsi *= 2) { int cnt = scf_count[i]; if (scfsi & 8) { DRMP3_COPY_MEMORY(scf, ist_pos, cnt); } else { int bits = scf_size[i]; if (!bits) { DRMP3_ZERO_MEMORY(scf, cnt); DRMP3_ZERO_MEMORY(ist_pos, cnt); } else { int max_scf = (scfsi < 0) ? (1 << bits) - 1 : -1; for (k = 0; k < cnt; k++) { int s = drmp3_bs_get_bits(bitbuf, bits); ist_pos[k] = (drmp3_uint8)(s == max_scf ? -1 : s); scf[k] = (drmp3_uint8)s; } } } ist_pos += cnt; scf += cnt; } scf[0] = scf[1] = scf[2] = 0; } static float drmp3_L3_ldexp_q2(float y, int exp_q2) { static const float g_expfrac[4] = { 9.31322575e-10f,7.83145814e-10f,6.58544508e-10f,5.53767716e-10f }; int e; do { e = DRMP3_MIN(30*4, exp_q2); y *= g_expfrac[e & 3]*(1 << 30 >> (e >> 2)); } while ((exp_q2 -= e) > 0); return y; } /* I've had reports of GCC 14 throwing an incorrect -Wstringop-overflow warning here. This is an attempt to silence this warning. */ #if (defined(__GNUC__) && (__GNUC__ >= 13)) && !defined(__clang__) #pragma GCC diagnostic push #pragma GCC diagnostic ignored "-Wstringop-overflow" #endif static void drmp3_L3_decode_scalefactors(const drmp3_uint8 *hdr, drmp3_uint8 *ist_pos, drmp3_bs *bs, const drmp3_L3_gr_info *gr, float *scf, int ch) { static const drmp3_uint8 g_scf_partitions[3][28] = { { 6,5,5, 5,6,5,5,5,6,5, 7,3,11,10,0,0, 7, 7, 7,0, 6, 6,6,3, 8, 8,5,0 }, { 8,9,6,12,6,9,9,9,6,9,12,6,15,18,0,0, 6,15,12,0, 6,12,9,6, 6,18,9,0 }, { 9,9,6,12,9,9,9,9,9,9,12,6,18,18,0,0,12,12,12,0,12, 9,9,6,15,12,9,0 } }; const drmp3_uint8 *scf_partition = g_scf_partitions[!!gr->n_short_sfb + !gr->n_long_sfb]; drmp3_uint8 scf_size[4], iscf[40]; int i, scf_shift = gr->scalefac_scale + 1, gain_exp, scfsi = gr->scfsi; float gain; if (DRMP3_HDR_TEST_MPEG1(hdr)) { static const drmp3_uint8 g_scfc_decode[16] = { 0,1,2,3, 12,5,6,7, 9,10,11,13, 14,15,18,19 }; int part = g_scfc_decode[gr->scalefac_compress]; scf_size[1] = scf_size[0] = (drmp3_uint8)(part >> 2); scf_size[3] = scf_size[2] = (drmp3_uint8)(part & 3); } else { static const drmp3_uint8 g_mod[6*4] = { 5,5,4,4,5,5,4,1,4,3,1,1,5,6,6,1,4,4,4,1,4,3,1,1 }; int k, modprod, sfc, ist = DRMP3_HDR_TEST_I_STEREO(hdr) && ch; sfc = gr->scalefac_compress >> ist; for (k = ist*3*4; sfc >= 0; sfc -= modprod, k += 4) { for (modprod = 1, i = 3; i >= 0; i--) { scf_size[i] = (drmp3_uint8)(sfc / modprod % g_mod[k + i]); modprod *= g_mod[k + i]; } } scf_partition += k; scfsi = -16; } drmp3_L3_read_scalefactors(iscf, ist_pos, scf_size, scf_partition, bs, scfsi); if (gr->n_short_sfb) { int sh = 3 - scf_shift; for (i = 0; i < gr->n_short_sfb; i += 3) { iscf[gr->n_long_sfb + i + 0] = (drmp3_uint8)(iscf[gr->n_long_sfb + i + 0] + (gr->subblock_gain[0] << sh)); iscf[gr->n_long_sfb + i + 1] = (drmp3_uint8)(iscf[gr->n_long_sfb + i + 1] + (gr->subblock_gain[1] << sh)); iscf[gr->n_long_sfb + i + 2] = (drmp3_uint8)(iscf[gr->n_long_sfb + i + 2] + (gr->subblock_gain[2] << sh)); } } else if (gr->preflag) { static const drmp3_uint8 g_preamp[10] = { 1,1,1,1,2,2,3,3,3,2 }; for (i = 0; i < 10; i++) { iscf[11 + i] = (drmp3_uint8)(iscf[11 + i] + g_preamp[i]); } } gain_exp = gr->global_gain + DRMP3_BITS_DEQUANTIZER_OUT*4 - 210 - (DRMP3_HDR_IS_MS_STEREO(hdr) ? 2 : 0); gain = drmp3_L3_ldexp_q2(1 << (DRMP3_MAX_SCFI/4), DRMP3_MAX_SCFI - gain_exp); for (i = 0; i < (int)(gr->n_long_sfb + gr->n_short_sfb); i++) { scf[i] = drmp3_L3_ldexp_q2(gain, iscf[i] << scf_shift); } } #if (defined(__GNUC__) && (__GNUC__ >= 13)) && !defined(__clang__) #pragma GCC diagnostic pop #endif static const float g_drmp3_pow43[129 + 16] = { 0,-1,-2.519842f,-4.326749f,-6.349604f,-8.549880f,-10.902724f,-13.390518f,-16.000000f,-18.720754f,-21.544347f,-24.463781f,-27.473142f,-30.567351f,-33.741992f,-36.993181f, 0,1,2.519842f,4.326749f,6.349604f,8.549880f,10.902724f,13.390518f,16.000000f,18.720754f,21.544347f,24.463781f,27.473142f,30.567351f,33.741992f,36.993181f,40.317474f,43.711787f,47.173345f,50.699631f,54.288352f,57.937408f,61.644865f,65.408941f,69.227979f,73.100443f,77.024898f,81.000000f,85.024491f,89.097188f,93.216975f,97.382800f,101.593667f,105.848633f,110.146801f,114.487321f,118.869381f,123.292209f,127.755065f,132.257246f,136.798076f,141.376907f,145.993119f,150.646117f,155.335327f,160.060199f,164.820202f,169.614826f,174.443577f,179.305980f,184.201575f,189.129918f,194.090580f,199.083145f,204.107210f,209.162385f,214.248292f,219.364564f,224.510845f,229.686789f,234.892058f,240.126328f,245.389280f,250.680604f,256.000000f,261.347174f,266.721841f,272.123723f,277.552547f,283.008049f,288.489971f,293.998060f,299.532071f,305.091761f,310.676898f,316.287249f,321.922592f,327.582707f,333.267377f,338.976394f,344.709550f,350.466646f,356.247482f,362.051866f,367.879608f,373.730522f,379.604427f,385.501143f,391.420496f,397.362314f,403.326427f,409.312672f,415.320884f,421.350905f,427.402579f,433.475750f,439.570269f,445.685987f,451.822757f,457.980436f,464.158883f,470.357960f,476.577530f,482.817459f,489.077615f,495.357868f,501.658090f,507.978156f,514.317941f,520.677324f,527.056184f,533.454404f,539.871867f,546.308458f,552.764065f,559.238575f,565.731879f,572.243870f,578.774440f,585.323483f,591.890898f,598.476581f,605.080431f,611.702349f,618.342238f,625.000000f,631.675540f,638.368763f,645.079578f }; static float drmp3_L3_pow_43(int x) { float frac; int sign, mult = 256; if (x < 129) { return g_drmp3_pow43[16 + x]; } if (x < 1024) { mult = 16; x <<= 3; } sign = 2*x & 64; frac = (float)((x & 63) - sign) / ((x & ~63) + sign); return g_drmp3_pow43[16 + ((x + sign) >> 6)]*(1.f + frac*((4.f/3) + frac*(2.f/9)))*mult; } static void drmp3_L3_huffman(float *dst, drmp3_bs *bs, const drmp3_L3_gr_info *gr_info, const float *scf, int layer3gr_limit) { static const drmp3_int16 tabs[] = { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 785,785,785,785,784,784,784,784,513,513,513,513,513,513,513,513,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256, -255,1313,1298,1282,785,785,785,785,784,784,784,784,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,290,288, -255,1313,1298,1282,769,769,769,769,529,529,529,529,529,529,529,529,528,528,528,528,528,528,528,528,512,512,512,512,512,512,512,512,290,288, -253,-318,-351,-367,785,785,785,785,784,784,784,784,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,819,818,547,547,275,275,275,275,561,560,515,546,289,274,288,258, -254,-287,1329,1299,1314,1312,1057,1057,1042,1042,1026,1026,784,784,784,784,529,529,529,529,529,529,529,529,769,769,769,769,768,768,768,768,563,560,306,306,291,259, -252,-413,-477,-542,1298,-575,1041,1041,784,784,784,784,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,-383,-399,1107,1092,1106,1061,849,849,789,789,1104,1091,773,773,1076,1075,341,340,325,309,834,804,577,577,532,532,516,516,832,818,803,816,561,561,531,531,515,546,289,289,288,258, -252,-429,-493,-559,1057,1057,1042,1042,529,529,529,529,529,529,529,529,784,784,784,784,769,769,769,769,512,512,512,512,512,512,512,512,-382,1077,-415,1106,1061,1104,849,849,789,789,1091,1076,1029,1075,834,834,597,581,340,340,339,324,804,833,532,532,832,772,818,803,817,787,816,771,290,290,290,290,288,258, -253,-349,-414,-447,-463,1329,1299,-479,1314,1312,1057,1057,1042,1042,1026,1026,785,785,785,785,784,784,784,784,769,769,769,769,768,768,768,768,-319,851,821,-335,836,850,805,849,341,340,325,336,533,533,579,579,564,564,773,832,578,548,563,516,321,276,306,291,304,259, -251,-572,-733,-830,-863,-879,1041,1041,784,784,784,784,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,-511,-527,-543,1396,1351,1381,1366,1395,1335,1380,-559,1334,1138,1138,1063,1063,1350,1392,1031,1031,1062,1062,1364,1363,1120,1120,1333,1348,881,881,881,881,375,374,359,373,343,358,341,325,791,791,1123,1122,-703,1105,1045,-719,865,865,790,790,774,774,1104,1029,338,293,323,308,-799,-815,833,788,772,818,803,816,322,292,307,320,561,531,515,546,289,274,288,258, -251,-525,-605,-685,-765,-831,-846,1298,1057,1057,1312,1282,785,785,785,785,784,784,784,784,769,769,769,769,512,512,512,512,512,512,512,512,1399,1398,1383,1367,1382,1396,1351,-511,1381,1366,1139,1139,1079,1079,1124,1124,1364,1349,1363,1333,882,882,882,882,807,807,807,807,1094,1094,1136,1136,373,341,535,535,881,775,867,822,774,-591,324,338,-671,849,550,550,866,864,609,609,293,336,534,534,789,835,773,-751,834,804,308,307,833,788,832,772,562,562,547,547,305,275,560,515,290,290, -252,-397,-477,-557,-622,-653,-719,-735,-750,1329,1299,1314,1057,1057,1042,1042,1312,1282,1024,1024,785,785,785,785,784,784,784,784,769,769,769,769,-383,1127,1141,1111,1126,1140,1095,1110,869,869,883,883,1079,1109,882,882,375,374,807,868,838,881,791,-463,867,822,368,263,852,837,836,-543,610,610,550,550,352,336,534,534,865,774,851,821,850,805,593,533,579,564,773,832,578,578,548,548,577,577,307,276,306,291,516,560,259,259, -250,-2107,-2507,-2764,-2909,-2974,-3007,-3023,1041,1041,1040,1040,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,-767,-1052,-1213,-1277,-1358,-1405,-1469,-1535,-1550,-1582,-1614,-1647,-1662,-1694,-1726,-1759,-1774,-1807,-1822,-1854,-1886,1565,-1919,-1935,-1951,-1967,1731,1730,1580,1717,-1983,1729,1564,-1999,1548,-2015,-2031,1715,1595,-2047,1714,-2063,1610,-2079,1609,-2095,1323,1323,1457,1457,1307,1307,1712,1547,1641,1700,1699,1594,1685,1625,1442,1442,1322,1322,-780,-973,-910,1279,1278,1277,1262,1276,1261,1275,1215,1260,1229,-959,974,974,989,989,-943,735,478,478,495,463,506,414,-1039,1003,958,1017,927,942,987,957,431,476,1272,1167,1228,-1183,1256,-1199,895,895,941,941,1242,1227,1212,1135,1014,1014,490,489,503,487,910,1013,985,925,863,894,970,955,1012,847,-1343,831,755,755,984,909,428,366,754,559,-1391,752,486,457,924,997,698,698,983,893,740,740,908,877,739,739,667,667,953,938,497,287,271,271,683,606,590,712,726,574,302,302,738,736,481,286,526,725,605,711,636,724,696,651,589,681,666,710,364,467,573,695,466,466,301,465,379,379,709,604,665,679,316,316,634,633,436,436,464,269,424,394,452,332,438,363,347,408,393,448,331,422,362,407,392,421,346,406,391,376,375,359,1441,1306,-2367,1290,-2383,1337,-2399,-2415,1426,1321,-2431,1411,1336,-2447,-2463,-2479,1169,1169,1049,1049,1424,1289,1412,1352,1319,-2495,1154,1154,1064,1064,1153,1153,416,390,360,404,403,389,344,374,373,343,358,372,327,357,342,311,356,326,1395,1394,1137,1137,1047,1047,1365,1392,1287,1379,1334,1364,1349,1378,1318,1363,792,792,792,792,1152,1152,1032,1032,1121,1121,1046,1046,1120,1120,1030,1030,-2895,1106,1061,1104,849,849,789,789,1091,1076,1029,1090,1060,1075,833,833,309,324,532,532,832,772,818,803,561,561,531,560,515,546,289,274,288,258, -250,-1179,-1579,-1836,-1996,-2124,-2253,-2333,-2413,-2477,-2542,-2574,-2607,-2622,-2655,1314,1313,1298,1312,1282,785,785,785,785,1040,1040,1025,1025,768,768,768,768,-766,-798,-830,-862,-895,-911,-927,-943,-959,-975,-991,-1007,-1023,-1039,-1055,-1070,1724,1647,-1103,-1119,1631,1767,1662,1738,1708,1723,-1135,1780,1615,1779,1599,1677,1646,1778,1583,-1151,1777,1567,1737,1692,1765,1722,1707,1630,1751,1661,1764,1614,1736,1676,1763,1750,1645,1598,1721,1691,1762,1706,1582,1761,1566,-1167,1749,1629,767,766,751,765,494,494,735,764,719,749,734,763,447,447,748,718,477,506,431,491,446,476,461,505,415,430,475,445,504,399,460,489,414,503,383,474,429,459,502,502,746,752,488,398,501,473,413,472,486,271,480,270,-1439,-1455,1357,-1471,-1487,-1503,1341,1325,-1519,1489,1463,1403,1309,-1535,1372,1448,1418,1476,1356,1462,1387,-1551,1475,1340,1447,1402,1386,-1567,1068,1068,1474,1461,455,380,468,440,395,425,410,454,364,467,466,464,453,269,409,448,268,432,1371,1473,1432,1417,1308,1460,1355,1446,1459,1431,1083,1083,1401,1416,1458,1445,1067,1067,1370,1457,1051,1051,1291,1430,1385,1444,1354,1415,1400,1443,1082,1082,1173,1113,1186,1066,1185,1050,-1967,1158,1128,1172,1097,1171,1081,-1983,1157,1112,416,266,375,400,1170,1142,1127,1065,793,793,1169,1033,1156,1096,1141,1111,1155,1080,1126,1140,898,898,808,808,897,897,792,792,1095,1152,1032,1125,1110,1139,1079,1124,882,807,838,881,853,791,-2319,867,368,263,822,852,837,866,806,865,-2399,851,352,262,534,534,821,836,594,594,549,549,593,593,533,533,848,773,579,579,564,578,548,563,276,276,577,576,306,291,516,560,305,305,275,259, -251,-892,-2058,-2620,-2828,-2957,-3023,-3039,1041,1041,1040,1040,769,769,769,769,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,256,-511,-527,-543,-559,1530,-575,-591,1528,1527,1407,1526,1391,1023,1023,1023,1023,1525,1375,1268,1268,1103,1103,1087,1087,1039,1039,1523,-604,815,815,815,815,510,495,509,479,508,463,507,447,431,505,415,399,-734,-782,1262,-815,1259,1244,-831,1258,1228,-847,-863,1196,-879,1253,987,987,748,-767,493,493,462,477,414,414,686,669,478,446,461,445,474,429,487,458,412,471,1266,1264,1009,1009,799,799,-1019,-1276,-1452,-1581,-1677,-1757,-1821,-1886,-1933,-1997,1257,1257,1483,1468,1512,1422,1497,1406,1467,1496,1421,1510,1134,1134,1225,1225,1466,1451,1374,1405,1252,1252,1358,1480,1164,1164,1251,1251,1238,1238,1389,1465,-1407,1054,1101,-1423,1207,-1439,830,830,1248,1038,1237,1117,1223,1148,1236,1208,411,426,395,410,379,269,1193,1222,1132,1235,1221,1116,976,976,1192,1162,1177,1220,1131,1191,963,963,-1647,961,780,-1663,558,558,994,993,437,408,393,407,829,978,813,797,947,-1743,721,721,377,392,844,950,828,890,706,706,812,859,796,960,948,843,934,874,571,571,-1919,690,555,689,421,346,539,539,944,779,918,873,932,842,903,888,570,570,931,917,674,674,-2575,1562,-2591,1609,-2607,1654,1322,1322,1441,1441,1696,1546,1683,1593,1669,1624,1426,1426,1321,1321,1639,1680,1425,1425,1305,1305,1545,1668,1608,1623,1667,1592,1638,1666,1320,1320,1652,1607,1409,1409,1304,1304,1288,1288,1664,1637,1395,1395,1335,1335,1622,1636,1394,1394,1319,1319,1606,1621,1392,1392,1137,1137,1137,1137,345,390,360,375,404,373,1047,-2751,-2767,-2783,1062,1121,1046,-2799,1077,-2815,1106,1061,789,789,1105,1104,263,355,310,340,325,354,352,262,339,324,1091,1076,1029,1090,1060,1075,833,833,788,788,1088,1028,818,818,803,803,561,561,531,531,816,771,546,546,289,274,288,258, -253,-317,-381,-446,-478,-509,1279,1279,-811,-1179,-1451,-1756,-1900,-2028,-2189,-2253,-2333,-2414,-2445,-2511,-2526,1313,1298,-2559,1041,1041,1040,1040,1025,1025,1024,1024,1022,1007,1021,991,1020,975,1019,959,687,687,1018,1017,671,671,655,655,1016,1015,639,639,758,758,623,623,757,607,756,591,755,575,754,559,543,543,1009,783,-575,-621,-685,-749,496,-590,750,749,734,748,974,989,1003,958,988,973,1002,942,987,957,972,1001,926,986,941,971,956,1000,910,985,925,999,894,970,-1071,-1087,-1102,1390,-1135,1436,1509,1451,1374,-1151,1405,1358,1480,1420,-1167,1507,1494,1389,1342,1465,1435,1450,1326,1505,1310,1493,1373,1479,1404,1492,1464,1419,428,443,472,397,736,526,464,464,486,457,442,471,484,482,1357,1449,1434,1478,1388,1491,1341,1490,1325,1489,1463,1403,1309,1477,1372,1448,1418,1433,1476,1356,1462,1387,-1439,1475,1340,1447,1402,1474,1324,1461,1371,1473,269,448,1432,1417,1308,1460,-1711,1459,-1727,1441,1099,1099,1446,1386,1431,1401,-1743,1289,1083,1083,1160,1160,1458,1445,1067,1067,1370,1457,1307,1430,1129,1129,1098,1098,268,432,267,416,266,400,-1887,1144,1187,1082,1173,1113,1186,1066,1050,1158,1128,1143,1172,1097,1171,1081,420,391,1157,1112,1170,1142,1127,1065,1169,1049,1156,1096,1141,1111,1155,1080,1126,1154,1064,1153,1140,1095,1048,-2159,1125,1110,1137,-2175,823,823,1139,1138,807,807,384,264,368,263,868,838,853,791,867,822,852,837,866,806,865,790,-2319,851,821,836,352,262,850,805,849,-2399,533,533,835,820,336,261,578,548,563,577,532,532,832,772,562,562,547,547,305,275,560,515,290,290,288,258 }; static const drmp3_uint8 tab32[] = { 130,162,193,209,44,28,76,140,9,9,9,9,9,9,9,9,190,254,222,238,126,94,157,157,109,61,173,205}; static const drmp3_uint8 tab33[] = { 252,236,220,204,188,172,156,140,124,108,92,76,60,44,28,12 }; static const drmp3_int16 tabindex[2*16] = { 0,32,64,98,0,132,180,218,292,364,426,538,648,746,0,1126,1460,1460,1460,1460,1460,1460,1460,1460,1842,1842,1842,1842,1842,1842,1842,1842 }; static const drmp3_uint8 g_linbits[] = { 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,2,3,4,6,8,10,13,4,5,6,7,8,9,11,13 }; #define DRMP3_PEEK_BITS(n) (bs_cache >> (32 - (n))) #define DRMP3_FLUSH_BITS(n) { bs_cache <<= (n); bs_sh += (n); } #define DRMP3_CHECK_BITS while (bs_sh >= 0) { bs_cache |= (drmp3_uint32)*bs_next_ptr++ << bs_sh; bs_sh -= 8; } #define DRMP3_BSPOS ((bs_next_ptr - bs->buf)*8 - 24 + bs_sh) float one = 0.0f; int ireg = 0, big_val_cnt = gr_info->big_values; const drmp3_uint8 *sfb = gr_info->sfbtab; const drmp3_uint8 *bs_next_ptr = bs->buf + bs->pos/8; drmp3_uint32 bs_cache = (((bs_next_ptr[0]*256u + bs_next_ptr[1])*256u + bs_next_ptr[2])*256u + bs_next_ptr[3]) << (bs->pos & 7); int pairs_to_decode, np, bs_sh = (bs->pos & 7) - 8; bs_next_ptr += 4; while (big_val_cnt > 0) { int tab_num = gr_info->table_select[ireg]; int sfb_cnt = gr_info->region_count[ireg++]; const drmp3_int16 *codebook = tabs + tabindex[tab_num]; int linbits = g_linbits[tab_num]; if (linbits) { do { np = *sfb++ / 2; pairs_to_decode = DRMP3_MIN(big_val_cnt, np); one = *scf++; do { int j, w = 5; int leaf = codebook[DRMP3_PEEK_BITS(w)]; while (leaf < 0) { DRMP3_FLUSH_BITS(w); w = leaf & 7; leaf = codebook[DRMP3_PEEK_BITS(w) - (leaf >> 3)]; } DRMP3_FLUSH_BITS(leaf >> 8); for (j = 0; j < 2; j++, dst++, leaf >>= 4) { int lsb = leaf & 0x0F; if (lsb == 15) { lsb += DRMP3_PEEK_BITS(linbits); DRMP3_FLUSH_BITS(linbits); DRMP3_CHECK_BITS; *dst = one*drmp3_L3_pow_43(lsb)*((drmp3_int32)bs_cache < 0 ? -1: 1); } else { *dst = g_drmp3_pow43[16 + lsb - 16*(bs_cache >> 31)]*one; } DRMP3_FLUSH_BITS(lsb ? 1 : 0); } DRMP3_CHECK_BITS; } while (--pairs_to_decode); } while ((big_val_cnt -= np) > 0 && --sfb_cnt >= 0); } else { do { np = *sfb++ / 2; pairs_to_decode = DRMP3_MIN(big_val_cnt, np); one = *scf++; do { int j, w = 5; int leaf = codebook[DRMP3_PEEK_BITS(w)]; while (leaf < 0) { DRMP3_FLUSH_BITS(w); w = leaf & 7; leaf = codebook[DRMP3_PEEK_BITS(w) - (leaf >> 3)]; } DRMP3_FLUSH_BITS(leaf >> 8); for (j = 0; j < 2; j++, dst++, leaf >>= 4) { int lsb = leaf & 0x0F; *dst = g_drmp3_pow43[16 + lsb - 16*(bs_cache >> 31)]*one; DRMP3_FLUSH_BITS(lsb ? 1 : 0); } DRMP3_CHECK_BITS; } while (--pairs_to_decode); } while ((big_val_cnt -= np) > 0 && --sfb_cnt >= 0); } } for (np = 1 - big_val_cnt;; dst += 4) { const drmp3_uint8 *codebook_count1 = (gr_info->count1_table) ? tab33 : tab32; int leaf = codebook_count1[DRMP3_PEEK_BITS(4)]; if (!(leaf & 8)) { leaf = codebook_count1[(leaf >> 3) + (bs_cache << 4 >> (32 - (leaf & 3)))]; } DRMP3_FLUSH_BITS(leaf & 7); if (DRMP3_BSPOS > layer3gr_limit) { break; } #define DRMP3_RELOAD_SCALEFACTOR if (!--np) { np = *sfb++/2; if (!np) break; one = *scf++; } #define DRMP3_DEQ_COUNT1(s) if (leaf & (128 >> s)) { dst[s] = ((drmp3_int32)bs_cache < 0) ? -one : one; DRMP3_FLUSH_BITS(1) } DRMP3_RELOAD_SCALEFACTOR; DRMP3_DEQ_COUNT1(0); DRMP3_DEQ_COUNT1(1); DRMP3_RELOAD_SCALEFACTOR; DRMP3_DEQ_COUNT1(2); DRMP3_DEQ_COUNT1(3); DRMP3_CHECK_BITS; } bs->pos = layer3gr_limit; } static void drmp3_L3_midside_stereo(float *left, int n) { int i = 0; float *right = left + 576; #if DRMP3_HAVE_SIMD if (drmp3_have_simd()) { for (; i < n - 3; i += 4) { drmp3_f4 vl = DRMP3_VLD(left + i); drmp3_f4 vr = DRMP3_VLD(right + i); DRMP3_VSTORE(left + i, DRMP3_VADD(vl, vr)); DRMP3_VSTORE(right + i, DRMP3_VSUB(vl, vr)); } #ifdef __GNUC__ /* Workaround for spurious -Waggressive-loop-optimizations warning from gcc. * For more info see: https://github.com/lieff/minimp3/issues/88 */ if (__builtin_constant_p(n % 4 == 0) && n % 4 == 0) return; #endif } #endif for (; i < n; i++) { float a = left[i]; float b = right[i]; left[i] = a + b; right[i] = a - b; } } static void drmp3_L3_intensity_stereo_band(float *left, int n, float kl, float kr) { int i; for (i = 0; i < n; i++) { left[i + 576] = left[i]*kr; left[i] = left[i]*kl; } } static void drmp3_L3_stereo_top_band(const float *right, const drmp3_uint8 *sfb, int nbands, int max_band[3]) { int i, k; max_band[0] = max_band[1] = max_band[2] = -1; for (i = 0; i < nbands; i++) { for (k = 0; k < sfb[i]; k += 2) { if (right[k] != 0 || right[k + 1] != 0) { max_band[i % 3] = i; break; } } right += sfb[i]; } } static void drmp3_L3_stereo_process(float *left, const drmp3_uint8 *ist_pos, const drmp3_uint8 *sfb, const drmp3_uint8 *hdr, int max_band[3], int mpeg2_sh) { static const float g_pan[7*2] = { 0,1,0.21132487f,0.78867513f,0.36602540f,0.63397460f,0.5f,0.5f,0.63397460f,0.36602540f,0.78867513f,0.21132487f,1,0 }; unsigned i, max_pos = DRMP3_HDR_TEST_MPEG1(hdr) ? 7 : 64; for (i = 0; sfb[i]; i++) { unsigned ipos = ist_pos[i]; if ((int)i > max_band[i % 3] && ipos < max_pos) { float kl, kr, s = DRMP3_HDR_TEST_MS_STEREO(hdr) ? 1.41421356f : 1; if (DRMP3_HDR_TEST_MPEG1(hdr)) { kl = g_pan[2*ipos]; kr = g_pan[2*ipos + 1]; } else { kl = 1; kr = drmp3_L3_ldexp_q2(1, (ipos + 1) >> 1 << mpeg2_sh); if (ipos & 1) { kl = kr; kr = 1; } } drmp3_L3_intensity_stereo_band(left, sfb[i], kl*s, kr*s); } else if (DRMP3_HDR_TEST_MS_STEREO(hdr)) { drmp3_L3_midside_stereo(left, sfb[i]); } left += sfb[i]; } } static void drmp3_L3_intensity_stereo(float *left, drmp3_uint8 *ist_pos, const drmp3_L3_gr_info *gr, const drmp3_uint8 *hdr) { int max_band[3], n_sfb = gr->n_long_sfb + gr->n_short_sfb; int i, max_blocks = gr->n_short_sfb ? 3 : 1; drmp3_L3_stereo_top_band(left + 576, gr->sfbtab, n_sfb, max_band); if (gr->n_long_sfb) { max_band[0] = max_band[1] = max_band[2] = DRMP3_MAX(DRMP3_MAX(max_band[0], max_band[1]), max_band[2]); } for (i = 0; i < max_blocks; i++) { int default_pos = DRMP3_HDR_TEST_MPEG1(hdr) ? 3 : 0; int itop = n_sfb - max_blocks + i; int prev = itop - max_blocks; ist_pos[itop] = (drmp3_uint8)(max_band[i] >= prev ? default_pos : ist_pos[prev]); } drmp3_L3_stereo_process(left, ist_pos, gr->sfbtab, hdr, max_band, gr[1].scalefac_compress & 1); } static void drmp3_L3_reorder(float *grbuf, float *scratch, const drmp3_uint8 *sfb) { int i, len; float *src = grbuf, *dst = scratch; for (;0 != (len = *sfb); sfb += 3, src += 2*len) { for (i = 0; i < len; i++, src++) { *dst++ = src[0*len]; *dst++ = src[1*len]; *dst++ = src[2*len]; } } DRMP3_COPY_MEMORY(grbuf, scratch, (dst - scratch)*sizeof(float)); } static void drmp3_L3_antialias(float *grbuf, int nbands) { static const float g_aa[2][8] = { {0.85749293f,0.88174200f,0.94962865f,0.98331459f,0.99551782f,0.99916056f,0.99989920f,0.99999316f}, {0.51449576f,0.47173197f,0.31337745f,0.18191320f,0.09457419f,0.04096558f,0.01419856f,0.00369997f} }; for (; nbands > 0; nbands--, grbuf += 18) { int i = 0; #if DRMP3_HAVE_SIMD if (drmp3_have_simd()) for (; i < 8; i += 4) { drmp3_f4 vu = DRMP3_VLD(grbuf + 18 + i); drmp3_f4 vd = DRMP3_VLD(grbuf + 14 - i); drmp3_f4 vc0 = DRMP3_VLD(g_aa[0] + i); drmp3_f4 vc1 = DRMP3_VLD(g_aa[1] + i); vd = DRMP3_VREV(vd); DRMP3_VSTORE(grbuf + 18 + i, DRMP3_VSUB(DRMP3_VMUL(vu, vc0), DRMP3_VMUL(vd, vc1))); vd = DRMP3_VADD(DRMP3_VMUL(vu, vc1), DRMP3_VMUL(vd, vc0)); DRMP3_VSTORE(grbuf + 14 - i, DRMP3_VREV(vd)); } #endif #ifndef DR_MP3_ONLY_SIMD for(; i < 8; i++) { float u = grbuf[18 + i]; float d = grbuf[17 - i]; grbuf[18 + i] = u*g_aa[0][i] - d*g_aa[1][i]; grbuf[17 - i] = u*g_aa[1][i] + d*g_aa[0][i]; } #endif } } static void drmp3_L3_dct3_9(float *y) { float s0, s1, s2, s3, s4, s5, s6, s7, s8, t0, t2, t4; s0 = y[0]; s2 = y[2]; s4 = y[4]; s6 = y[6]; s8 = y[8]; t0 = s0 + s6*0.5f; s0 -= s6; t4 = (s4 + s2)*0.93969262f; t2 = (s8 + s2)*0.76604444f; s6 = (s4 - s8)*0.17364818f; s4 += s8 - s2; s2 = s0 - s4*0.5f; y[4] = s4 + s0; s8 = t0 - t2 + s6; s0 = t0 - t4 + t2; s4 = t0 + t4 - s6; s1 = y[1]; s3 = y[3]; s5 = y[5]; s7 = y[7]; s3 *= 0.86602540f; t0 = (s5 + s1)*0.98480775f; t4 = (s5 - s7)*0.34202014f; t2 = (s1 + s7)*0.64278761f; s1 = (s1 - s5 - s7)*0.86602540f; s5 = t0 - s3 - t2; s7 = t4 - s3 - t0; s3 = t4 + s3 - t2; y[0] = s4 - s7; y[1] = s2 + s1; y[2] = s0 - s3; y[3] = s8 + s5; y[5] = s8 - s5; y[6] = s0 + s3; y[7] = s2 - s1; y[8] = s4 + s7; } static void drmp3_L3_imdct36(float *grbuf, float *overlap, const float *window, int nbands) { int i, j; static const float g_twid9[18] = { 0.73727734f,0.79335334f,0.84339145f,0.88701083f,0.92387953f,0.95371695f,0.97629601f,0.99144486f,0.99904822f,0.67559021f,0.60876143f,0.53729961f,0.46174861f,0.38268343f,0.30070580f,0.21643961f,0.13052619f,0.04361938f }; for (j = 0; j < nbands; j++, grbuf += 18, overlap += 9) { float co[9], si[9]; co[0] = -grbuf[0]; si[0] = grbuf[17]; for (i = 0; i < 4; i++) { si[8 - 2*i] = grbuf[4*i + 1] - grbuf[4*i + 2]; co[1 + 2*i] = grbuf[4*i + 1] + grbuf[4*i + 2]; si[7 - 2*i] = grbuf[4*i + 4] - grbuf[4*i + 3]; co[2 + 2*i] = -(grbuf[4*i + 3] + grbuf[4*i + 4]); } drmp3_L3_dct3_9(co); drmp3_L3_dct3_9(si); si[1] = -si[1]; si[3] = -si[3]; si[5] = -si[5]; si[7] = -si[7]; i = 0; #if DRMP3_HAVE_SIMD if (drmp3_have_simd()) for (; i < 8; i += 4) { drmp3_f4 vovl = DRMP3_VLD(overlap + i); drmp3_f4 vc = DRMP3_VLD(co + i); drmp3_f4 vs = DRMP3_VLD(si + i); drmp3_f4 vr0 = DRMP3_VLD(g_twid9 + i); drmp3_f4 vr1 = DRMP3_VLD(g_twid9 + 9 + i); drmp3_f4 vw0 = DRMP3_VLD(window + i); drmp3_f4 vw1 = DRMP3_VLD(window + 9 + i); drmp3_f4 vsum = DRMP3_VADD(DRMP3_VMUL(vc, vr1), DRMP3_VMUL(vs, vr0)); DRMP3_VSTORE(overlap + i, DRMP3_VSUB(DRMP3_VMUL(vc, vr0), DRMP3_VMUL(vs, vr1))); DRMP3_VSTORE(grbuf + i, DRMP3_VSUB(DRMP3_VMUL(vovl, vw0), DRMP3_VMUL(vsum, vw1))); vsum = DRMP3_VADD(DRMP3_VMUL(vovl, vw1), DRMP3_VMUL(vsum, vw0)); DRMP3_VSTORE(grbuf + 14 - i, DRMP3_VREV(vsum)); } #endif for (; i < 9; i++) { float ovl = overlap[i]; float sum = co[i]*g_twid9[9 + i] + si[i]*g_twid9[0 + i]; overlap[i] = co[i]*g_twid9[0 + i] - si[i]*g_twid9[9 + i]; grbuf[i] = ovl*window[0 + i] - sum*window[9 + i]; grbuf[17 - i] = ovl*window[9 + i] + sum*window[0 + i]; } } } static void drmp3_L3_idct3(float x0, float x1, float x2, float *dst) { float m1 = x1*0.86602540f; float a1 = x0 - x2*0.5f; dst[1] = x0 + x2; dst[0] = a1 + m1; dst[2] = a1 - m1; } static void drmp3_L3_imdct12(float *x, float *dst, float *overlap) { static const float g_twid3[6] = { 0.79335334f,0.92387953f,0.99144486f, 0.60876143f,0.38268343f,0.13052619f }; float co[3], si[3]; int i; drmp3_L3_idct3(-x[0], x[6] + x[3], x[12] + x[9], co); drmp3_L3_idct3(x[15], x[12] - x[9], x[6] - x[3], si); si[1] = -si[1]; for (i = 0; i < 3; i++) { float ovl = overlap[i]; float sum = co[i]*g_twid3[3 + i] + si[i]*g_twid3[0 + i]; overlap[i] = co[i]*g_twid3[0 + i] - si[i]*g_twid3[3 + i]; dst[i] = ovl*g_twid3[2 - i] - sum*g_twid3[5 - i]; dst[5 - i] = ovl*g_twid3[5 - i] + sum*g_twid3[2 - i]; } } static void drmp3_L3_imdct_short(float *grbuf, float *overlap, int nbands) { for (;nbands > 0; nbands--, overlap += 9, grbuf += 18) { float tmp[18]; DRMP3_COPY_MEMORY(tmp, grbuf, sizeof(tmp)); DRMP3_COPY_MEMORY(grbuf, overlap, 6*sizeof(float)); drmp3_L3_imdct12(tmp, grbuf + 6, overlap + 6); drmp3_L3_imdct12(tmp + 1, grbuf + 12, overlap + 6); drmp3_L3_imdct12(tmp + 2, overlap, overlap + 6); } } static void drmp3_L3_change_sign(float *grbuf) { int b, i; for (b = 0, grbuf += 18; b < 32; b += 2, grbuf += 36) for (i = 1; i < 18; i += 2) grbuf[i] = -grbuf[i]; } static void drmp3_L3_imdct_gr(float *grbuf, float *overlap, unsigned block_type, unsigned n_long_bands) { static const float g_mdct_window[2][18] = { { 0.99904822f,0.99144486f,0.97629601f,0.95371695f,0.92387953f,0.88701083f,0.84339145f,0.79335334f,0.73727734f,0.04361938f,0.13052619f,0.21643961f,0.30070580f,0.38268343f,0.46174861f,0.53729961f,0.60876143f,0.67559021f }, { 1,1,1,1,1,1,0.99144486f,0.92387953f,0.79335334f,0,0,0,0,0,0,0.13052619f,0.38268343f,0.60876143f } }; if (n_long_bands) { drmp3_L3_imdct36(grbuf, overlap, g_mdct_window[0], n_long_bands); grbuf += 18*n_long_bands; overlap += 9*n_long_bands; } if (block_type == DRMP3_SHORT_BLOCK_TYPE) drmp3_L3_imdct_short(grbuf, overlap, 32 - n_long_bands); else drmp3_L3_imdct36(grbuf, overlap, g_mdct_window[block_type == DRMP3_STOP_BLOCK_TYPE], 32 - n_long_bands); } static void drmp3_L3_save_reservoir(drmp3dec *h, drmp3dec_scratch *s) { int pos = (s->bs.pos + 7)/8u; int remains = s->bs.limit/8u - pos; if (remains > DRMP3_MAX_BITRESERVOIR_BYTES) { pos += remains - DRMP3_MAX_BITRESERVOIR_BYTES; remains = DRMP3_MAX_BITRESERVOIR_BYTES; } if (remains > 0) { DRMP3_MOVE_MEMORY(h->reserv_buf, s->maindata + pos, remains); } h->reserv = remains; } static int drmp3_L3_restore_reservoir(drmp3dec *h, drmp3_bs *bs, drmp3dec_scratch *s, int main_data_begin) { int frame_bytes = (bs->limit - bs->pos)/8; int bytes_have = DRMP3_MIN(h->reserv, main_data_begin); DRMP3_COPY_MEMORY(s->maindata, h->reserv_buf + DRMP3_MAX(0, h->reserv - main_data_begin), DRMP3_MIN(h->reserv, main_data_begin)); DRMP3_COPY_MEMORY(s->maindata + bytes_have, bs->buf + bs->pos/8, frame_bytes); drmp3_bs_init(&s->bs, s->maindata, bytes_have + frame_bytes); return h->reserv >= main_data_begin; } static void drmp3_L3_decode(drmp3dec *h, drmp3dec_scratch *s, drmp3_L3_gr_info *gr_info, int nch) { int ch; for (ch = 0; ch < nch; ch++) { int layer3gr_limit = s->bs.pos + gr_info[ch].part_23_length; drmp3_L3_decode_scalefactors(h->header, s->ist_pos[ch], &s->bs, gr_info + ch, s->scf, ch); drmp3_L3_huffman(s->grbuf[ch], &s->bs, gr_info + ch, s->scf, layer3gr_limit); } if (DRMP3_HDR_TEST_I_STEREO(h->header)) { drmp3_L3_intensity_stereo(s->grbuf[0], s->ist_pos[1], gr_info, h->header); } else if (DRMP3_HDR_IS_MS_STEREO(h->header)) { drmp3_L3_midside_stereo(s->grbuf[0], 576); } for (ch = 0; ch < nch; ch++, gr_info++) { int aa_bands = 31; int n_long_bands = (gr_info->mixed_block_flag ? 2 : 0) << (int)(DRMP3_HDR_GET_MY_SAMPLE_RATE(h->header) == 2); if (gr_info->n_short_sfb) { aa_bands = n_long_bands - 1; drmp3_L3_reorder(s->grbuf[ch] + n_long_bands*18, s->syn[0], gr_info->sfbtab + gr_info->n_long_sfb); } drmp3_L3_antialias(s->grbuf[ch], aa_bands); drmp3_L3_imdct_gr(s->grbuf[ch], h->mdct_overlap[ch], gr_info->block_type, n_long_bands); drmp3_L3_change_sign(s->grbuf[ch]); } } static void drmp3d_DCT_II(float *grbuf, int n) { static const float g_sec[24] = { 10.19000816f,0.50060302f,0.50241929f,3.40760851f,0.50547093f,0.52249861f,2.05778098f,0.51544732f,0.56694406f,1.48416460f,0.53104258f,0.64682180f,1.16943991f,0.55310392f,0.78815460f,0.97256821f,0.58293498f,1.06067765f,0.83934963f,0.62250412f,1.72244716f,0.74453628f,0.67480832f,5.10114861f }; int i, k = 0; #if DRMP3_HAVE_SIMD if (drmp3_have_simd()) for (; k < n; k += 4) { drmp3_f4 t[4][8], *x; float *y = grbuf + k; for (x = t[0], i = 0; i < 8; i++, x++) { drmp3_f4 x0 = DRMP3_VLD(&y[i*18]); drmp3_f4 x1 = DRMP3_VLD(&y[(15 - i)*18]); drmp3_f4 x2 = DRMP3_VLD(&y[(16 + i)*18]); drmp3_f4 x3 = DRMP3_VLD(&y[(31 - i)*18]); drmp3_f4 t0 = DRMP3_VADD(x0, x3); drmp3_f4 t1 = DRMP3_VADD(x1, x2); drmp3_f4 t2 = DRMP3_VMUL_S(DRMP3_VSUB(x1, x2), g_sec[3*i + 0]); drmp3_f4 t3 = DRMP3_VMUL_S(DRMP3_VSUB(x0, x3), g_sec[3*i + 1]); x[0] = DRMP3_VADD(t0, t1); x[8] = DRMP3_VMUL_S(DRMP3_VSUB(t0, t1), g_sec[3*i + 2]); x[16] = DRMP3_VADD(t3, t2); x[24] = DRMP3_VMUL_S(DRMP3_VSUB(t3, t2), g_sec[3*i + 2]); } for (x = t[0], i = 0; i < 4; i++, x += 8) { drmp3_f4 x0 = x[0], x1 = x[1], x2 = x[2], x3 = x[3], x4 = x[4], x5 = x[5], x6 = x[6], x7 = x[7], xt; xt = DRMP3_VSUB(x0, x7); x0 = DRMP3_VADD(x0, x7); x7 = DRMP3_VSUB(x1, x6); x1 = DRMP3_VADD(x1, x6); x6 = DRMP3_VSUB(x2, x5); x2 = DRMP3_VADD(x2, x5); x5 = DRMP3_VSUB(x3, x4); x3 = DRMP3_VADD(x3, x4); x4 = DRMP3_VSUB(x0, x3); x0 = DRMP3_VADD(x0, x3); x3 = DRMP3_VSUB(x1, x2); x1 = DRMP3_VADD(x1, x2); x[0] = DRMP3_VADD(x0, x1); x[4] = DRMP3_VMUL_S(DRMP3_VSUB(x0, x1), 0.70710677f); x5 = DRMP3_VADD(x5, x6); x6 = DRMP3_VMUL_S(DRMP3_VADD(x6, x7), 0.70710677f); x7 = DRMP3_VADD(x7, xt); x3 = DRMP3_VMUL_S(DRMP3_VADD(x3, x4), 0.70710677f); x5 = DRMP3_VSUB(x5, DRMP3_VMUL_S(x7, 0.198912367f)); /* rotate by PI/8 */ x7 = DRMP3_VADD(x7, DRMP3_VMUL_S(x5, 0.382683432f)); x5 = DRMP3_VSUB(x5, DRMP3_VMUL_S(x7, 0.198912367f)); x0 = DRMP3_VSUB(xt, x6); xt = DRMP3_VADD(xt, x6); x[1] = DRMP3_VMUL_S(DRMP3_VADD(xt, x7), 0.50979561f); x[2] = DRMP3_VMUL_S(DRMP3_VADD(x4, x3), 0.54119611f); x[3] = DRMP3_VMUL_S(DRMP3_VSUB(x0, x5), 0.60134488f); x[5] = DRMP3_VMUL_S(DRMP3_VADD(x0, x5), 0.89997619f); x[6] = DRMP3_VMUL_S(DRMP3_VSUB(x4, x3), 1.30656302f); x[7] = DRMP3_VMUL_S(DRMP3_VSUB(xt, x7), 2.56291556f); } if (k > n - 3) { #if DRMP3_HAVE_SSE #define DRMP3_VSAVE2(i, v) _mm_storel_pi((__m64 *)(void*)&y[i*18], v) #else #define DRMP3_VSAVE2(i, v) vst1_f32((float32_t *)&y[(i)*18], vget_low_f32(v)) #endif for (i = 0; i < 7; i++, y += 4*18) { drmp3_f4 s = DRMP3_VADD(t[3][i], t[3][i + 1]); DRMP3_VSAVE2(0, t[0][i]); DRMP3_VSAVE2(1, DRMP3_VADD(t[2][i], s)); DRMP3_VSAVE2(2, DRMP3_VADD(t[1][i], t[1][i + 1])); DRMP3_VSAVE2(3, DRMP3_VADD(t[2][1 + i], s)); } DRMP3_VSAVE2(0, t[0][7]); DRMP3_VSAVE2(1, DRMP3_VADD(t[2][7], t[3][7])); DRMP3_VSAVE2(2, t[1][7]); DRMP3_VSAVE2(3, t[3][7]); } else { #define DRMP3_VSAVE4(i, v) DRMP3_VSTORE(&y[(i)*18], v) for (i = 0; i < 7; i++, y += 4*18) { drmp3_f4 s = DRMP3_VADD(t[3][i], t[3][i + 1]); DRMP3_VSAVE4(0, t[0][i]); DRMP3_VSAVE4(1, DRMP3_VADD(t[2][i], s)); DRMP3_VSAVE4(2, DRMP3_VADD(t[1][i], t[1][i + 1])); DRMP3_VSAVE4(3, DRMP3_VADD(t[2][1 + i], s)); } DRMP3_VSAVE4(0, t[0][7]); DRMP3_VSAVE4(1, DRMP3_VADD(t[2][7], t[3][7])); DRMP3_VSAVE4(2, t[1][7]); DRMP3_VSAVE4(3, t[3][7]); } } else #endif #ifdef DR_MP3_ONLY_SIMD {} /* for HAVE_SIMD=1, MINIMP3_ONLY_SIMD=1 case we do not need non-intrinsic "else" branch */ #else for (; k < n; k++) { float t[4][8], *x, *y = grbuf + k; for (x = t[0], i = 0; i < 8; i++, x++) { float x0 = y[i*18]; float x1 = y[(15 - i)*18]; float x2 = y[(16 + i)*18]; float x3 = y[(31 - i)*18]; float t0 = x0 + x3; float t1 = x1 + x2; float t2 = (x1 - x2)*g_sec[3*i + 0]; float t3 = (x0 - x3)*g_sec[3*i + 1]; x[0] = t0 + t1; x[8] = (t0 - t1)*g_sec[3*i + 2]; x[16] = t3 + t2; x[24] = (t3 - t2)*g_sec[3*i + 2]; } for (x = t[0], i = 0; i < 4; i++, x += 8) { float x0 = x[0], x1 = x[1], x2 = x[2], x3 = x[3], x4 = x[4], x5 = x[5], x6 = x[6], x7 = x[7], xt; xt = x0 - x7; x0 += x7; x7 = x1 - x6; x1 += x6; x6 = x2 - x5; x2 += x5; x5 = x3 - x4; x3 += x4; x4 = x0 - x3; x0 += x3; x3 = x1 - x2; x1 += x2; x[0] = x0 + x1; x[4] = (x0 - x1)*0.70710677f; x5 = x5 + x6; x6 = (x6 + x7)*0.70710677f; x7 = x7 + xt; x3 = (x3 + x4)*0.70710677f; x5 -= x7*0.198912367f; /* rotate by PI/8 */ x7 += x5*0.382683432f; x5 -= x7*0.198912367f; x0 = xt - x6; xt += x6; x[1] = (xt + x7)*0.50979561f; x[2] = (x4 + x3)*0.54119611f; x[3] = (x0 - x5)*0.60134488f; x[5] = (x0 + x5)*0.89997619f; x[6] = (x4 - x3)*1.30656302f; x[7] = (xt - x7)*2.56291556f; } for (i = 0; i < 7; i++, y += 4*18) { y[0*18] = t[0][i]; y[1*18] = t[2][i] + t[3][i] + t[3][i + 1]; y[2*18] = t[1][i] + t[1][i + 1]; y[3*18] = t[2][i + 1] + t[3][i] + t[3][i + 1]; } y[0*18] = t[0][7]; y[1*18] = t[2][7] + t[3][7]; y[2*18] = t[1][7]; y[3*18] = t[3][7]; } #endif } #ifndef DR_MP3_FLOAT_OUTPUT typedef drmp3_int16 drmp3d_sample_t; static drmp3_int16 drmp3d_scale_pcm(float sample) { drmp3_int16 s; #if DRMP3_HAVE_ARMV6 drmp3_int32 s32 = (drmp3_int32)(sample + .5f); s32 -= (s32 < 0); s = (drmp3_int16)drmp3_clip_int16_arm(s32); #else if (sample >= 32766.5f) return (drmp3_int16) 32767; if (sample <= -32767.5f) return (drmp3_int16)-32768; s = (drmp3_int16)(sample + .5f); s -= (s < 0); /* away from zero, to be compliant */ #endif return s; } #else typedef float drmp3d_sample_t; static float drmp3d_scale_pcm(float sample) { return sample*(1.f/32768.f); } #endif static void drmp3d_synth_pair(drmp3d_sample_t *pcm, int nch, const float *z) { float a; a = (z[14*64] - z[ 0]) * 29; a += (z[ 1*64] + z[13*64]) * 213; a += (z[12*64] - z[ 2*64]) * 459; a += (z[ 3*64] + z[11*64]) * 2037; a += (z[10*64] - z[ 4*64]) * 5153; a += (z[ 5*64] + z[ 9*64]) * 6574; a += (z[ 8*64] - z[ 6*64]) * 37489; a += z[ 7*64] * 75038; pcm[0] = drmp3d_scale_pcm(a); z += 2; a = z[14*64] * 104; a += z[12*64] * 1567; a += z[10*64] * 9727; a += z[ 8*64] * 64019; a += z[ 6*64] * -9975; a += z[ 4*64] * -45; a += z[ 2*64] * 146; a += z[ 0*64] * -5; pcm[16*nch] = drmp3d_scale_pcm(a); } static void drmp3d_synth(float *xl, drmp3d_sample_t *dstl, int nch, float *lins) { int i; float *xr = xl + 576*(nch - 1); drmp3d_sample_t *dstr = dstl + (nch - 1); static const float g_win[] = { -1,26,-31,208,218,401,-519,2063,2000,4788,-5517,7134,5959,35640,-39336,74992, -1,24,-35,202,222,347,-581,2080,1952,4425,-5879,7640,5288,33791,-41176,74856, -1,21,-38,196,225,294,-645,2087,1893,4063,-6237,8092,4561,31947,-43006,74630, -1,19,-41,190,227,244,-711,2085,1822,3705,-6589,8492,3776,30112,-44821,74313, -1,17,-45,183,228,197,-779,2075,1739,3351,-6935,8840,2935,28289,-46617,73908, -1,16,-49,176,228,153,-848,2057,1644,3004,-7271,9139,2037,26482,-48390,73415, -2,14,-53,169,227,111,-919,2032,1535,2663,-7597,9389,1082,24694,-50137,72835, -2,13,-58,161,224,72,-991,2001,1414,2330,-7910,9592,70,22929,-51853,72169, -2,11,-63,154,221,36,-1064,1962,1280,2006,-8209,9750,-998,21189,-53534,71420, -2,10,-68,147,215,2,-1137,1919,1131,1692,-8491,9863,-2122,19478,-55178,70590, -3,9,-73,139,208,-29,-1210,1870,970,1388,-8755,9935,-3300,17799,-56778,69679, -3,8,-79,132,200,-57,-1283,1817,794,1095,-8998,9966,-4533,16155,-58333,68692, -4,7,-85,125,189,-83,-1356,1759,605,814,-9219,9959,-5818,14548,-59838,67629, -4,7,-91,117,177,-106,-1428,1698,402,545,-9416,9916,-7154,12980,-61289,66494, -5,6,-97,111,163,-127,-1498,1634,185,288,-9585,9838,-8540,11455,-62684,65290 }; float *zlin = lins + 15*64; const float *w = g_win; zlin[4*15] = xl[18*16]; zlin[4*15 + 1] = xr[18*16]; zlin[4*15 + 2] = xl[0]; zlin[4*15 + 3] = xr[0]; zlin[4*31] = xl[1 + 18*16]; zlin[4*31 + 1] = xr[1 + 18*16]; zlin[4*31 + 2] = xl[1]; zlin[4*31 + 3] = xr[1]; drmp3d_synth_pair(dstr, nch, lins + 4*15 + 1); drmp3d_synth_pair(dstr + 32*nch, nch, lins + 4*15 + 64 + 1); drmp3d_synth_pair(dstl, nch, lins + 4*15); drmp3d_synth_pair(dstl + 32*nch, nch, lins + 4*15 + 64); #if DRMP3_HAVE_SIMD if (drmp3_have_simd()) for (i = 14; i >= 0; i--) { #define DRMP3_VLOAD(k) drmp3_f4 w0 = DRMP3_VSET(*w++); drmp3_f4 w1 = DRMP3_VSET(*w++); drmp3_f4 vz = DRMP3_VLD(&zlin[4*i - 64*k]); drmp3_f4 vy = DRMP3_VLD(&zlin[4*i - 64*(15 - k)]); #define DRMP3_V0(k) { DRMP3_VLOAD(k) b = DRMP3_VADD(DRMP3_VMUL(vz, w1), DRMP3_VMUL(vy, w0)) ; a = DRMP3_VSUB(DRMP3_VMUL(vz, w0), DRMP3_VMUL(vy, w1)); } #define DRMP3_V1(k) { DRMP3_VLOAD(k) b = DRMP3_VADD(b, DRMP3_VADD(DRMP3_VMUL(vz, w1), DRMP3_VMUL(vy, w0))); a = DRMP3_VADD(a, DRMP3_VSUB(DRMP3_VMUL(vz, w0), DRMP3_VMUL(vy, w1))); } #define DRMP3_V2(k) { DRMP3_VLOAD(k) b = DRMP3_VADD(b, DRMP3_VADD(DRMP3_VMUL(vz, w1), DRMP3_VMUL(vy, w0))); a = DRMP3_VADD(a, DRMP3_VSUB(DRMP3_VMUL(vy, w1), DRMP3_VMUL(vz, w0))); } drmp3_f4 a, b; zlin[4*i] = xl[18*(31 - i)]; zlin[4*i + 1] = xr[18*(31 - i)]; zlin[4*i + 2] = xl[1 + 18*(31 - i)]; zlin[4*i + 3] = xr[1 + 18*(31 - i)]; zlin[4*i + 64] = xl[1 + 18*(1 + i)]; zlin[4*i + 64 + 1] = xr[1 + 18*(1 + i)]; zlin[4*i - 64 + 2] = xl[18*(1 + i)]; zlin[4*i - 64 + 3] = xr[18*(1 + i)]; DRMP3_V0(0) DRMP3_V2(1) DRMP3_V1(2) DRMP3_V2(3) DRMP3_V1(4) DRMP3_V2(5) DRMP3_V1(6) DRMP3_V2(7) { #ifndef DR_MP3_FLOAT_OUTPUT #if DRMP3_HAVE_SSE static const drmp3_f4 g_max = { 32767.0f, 32767.0f, 32767.0f, 32767.0f }; static const drmp3_f4 g_min = { -32768.0f, -32768.0f, -32768.0f, -32768.0f }; __m128i pcm8 = _mm_packs_epi32(_mm_cvtps_epi32(_mm_max_ps(_mm_min_ps(a, g_max), g_min)), _mm_cvtps_epi32(_mm_max_ps(_mm_min_ps(b, g_max), g_min))); dstr[(15 - i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 1); dstr[(17 + i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 5); dstl[(15 - i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 0); dstl[(17 + i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 4); dstr[(47 - i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 3); dstr[(49 + i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 7); dstl[(47 - i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 2); dstl[(49 + i)*nch] = (drmp3_int16)_mm_extract_epi16(pcm8, 6); #else int16x4_t pcma, pcmb; a = DRMP3_VADD(a, DRMP3_VSET(0.5f)); b = DRMP3_VADD(b, DRMP3_VSET(0.5f)); pcma = vqmovn_s32(vqaddq_s32(vcvtq_s32_f32(a), vreinterpretq_s32_u32(vcltq_f32(a, DRMP3_VSET(0))))); pcmb = vqmovn_s32(vqaddq_s32(vcvtq_s32_f32(b), vreinterpretq_s32_u32(vcltq_f32(b, DRMP3_VSET(0))))); vst1_lane_s16(dstr + (15 - i)*nch, pcma, 1); vst1_lane_s16(dstr + (17 + i)*nch, pcmb, 1); vst1_lane_s16(dstl + (15 - i)*nch, pcma, 0); vst1_lane_s16(dstl + (17 + i)*nch, pcmb, 0); vst1_lane_s16(dstr + (47 - i)*nch, pcma, 3); vst1_lane_s16(dstr + (49 + i)*nch, pcmb, 3); vst1_lane_s16(dstl + (47 - i)*nch, pcma, 2); vst1_lane_s16(dstl + (49 + i)*nch, pcmb, 2); #endif #else #if DRMP3_HAVE_SSE static const drmp3_f4 g_scale = { 1.0f/32768.0f, 1.0f/32768.0f, 1.0f/32768.0f, 1.0f/32768.0f }; #else const drmp3_f4 g_scale = vdupq_n_f32(1.0f/32768.0f); #endif a = DRMP3_VMUL(a, g_scale); b = DRMP3_VMUL(b, g_scale); #if DRMP3_HAVE_SSE _mm_store_ss(dstr + (15 - i)*nch, _mm_shuffle_ps(a, a, _MM_SHUFFLE(1, 1, 1, 1))); _mm_store_ss(dstr + (17 + i)*nch, _mm_shuffle_ps(b, b, _MM_SHUFFLE(1, 1, 1, 1))); _mm_store_ss(dstl + (15 - i)*nch, _mm_shuffle_ps(a, a, _MM_SHUFFLE(0, 0, 0, 0))); _mm_store_ss(dstl + (17 + i)*nch, _mm_shuffle_ps(b, b, _MM_SHUFFLE(0, 0, 0, 0))); _mm_store_ss(dstr + (47 - i)*nch, _mm_shuffle_ps(a, a, _MM_SHUFFLE(3, 3, 3, 3))); _mm_store_ss(dstr + (49 + i)*nch, _mm_shuffle_ps(b, b, _MM_SHUFFLE(3, 3, 3, 3))); _mm_store_ss(dstl + (47 - i)*nch, _mm_shuffle_ps(a, a, _MM_SHUFFLE(2, 2, 2, 2))); _mm_store_ss(dstl + (49 + i)*nch, _mm_shuffle_ps(b, b, _MM_SHUFFLE(2, 2, 2, 2))); #else vst1q_lane_f32(dstr + (15 - i)*nch, a, 1); vst1q_lane_f32(dstr + (17 + i)*nch, b, 1); vst1q_lane_f32(dstl + (15 - i)*nch, a, 0); vst1q_lane_f32(dstl + (17 + i)*nch, b, 0); vst1q_lane_f32(dstr + (47 - i)*nch, a, 3); vst1q_lane_f32(dstr + (49 + i)*nch, b, 3); vst1q_lane_f32(dstl + (47 - i)*nch, a, 2); vst1q_lane_f32(dstl + (49 + i)*nch, b, 2); #endif #endif /* DR_MP3_FLOAT_OUTPUT */ } } else #endif #ifdef DR_MP3_ONLY_SIMD {} /* for HAVE_SIMD=1, MINIMP3_ONLY_SIMD=1 case we do not need non-intrinsic "else" branch */ #else for (i = 14; i >= 0; i--) { #define DRMP3_LOAD(k) float w0 = *w++; float w1 = *w++; float *vz = &zlin[4*i - k*64]; float *vy = &zlin[4*i - (15 - k)*64]; #define DRMP3_S0(k) { int j; DRMP3_LOAD(k); for (j = 0; j < 4; j++) b[j] = vz[j]*w1 + vy[j]*w0, a[j] = vz[j]*w0 - vy[j]*w1; } #define DRMP3_S1(k) { int j; DRMP3_LOAD(k); for (j = 0; j < 4; j++) b[j] += vz[j]*w1 + vy[j]*w0, a[j] += vz[j]*w0 - vy[j]*w1; } #define DRMP3_S2(k) { int j; DRMP3_LOAD(k); for (j = 0; j < 4; j++) b[j] += vz[j]*w1 + vy[j]*w0, a[j] += vy[j]*w1 - vz[j]*w0; } float a[4], b[4]; zlin[4*i] = xl[18*(31 - i)]; zlin[4*i + 1] = xr[18*(31 - i)]; zlin[4*i + 2] = xl[1 + 18*(31 - i)]; zlin[4*i + 3] = xr[1 + 18*(31 - i)]; zlin[4*(i + 16)] = xl[1 + 18*(1 + i)]; zlin[4*(i + 16) + 1] = xr[1 + 18*(1 + i)]; zlin[4*(i - 16) + 2] = xl[18*(1 + i)]; zlin[4*(i - 16) + 3] = xr[18*(1 + i)]; DRMP3_S0(0) DRMP3_S2(1) DRMP3_S1(2) DRMP3_S2(3) DRMP3_S1(4) DRMP3_S2(5) DRMP3_S1(6) DRMP3_S2(7) dstr[(15 - i)*nch] = drmp3d_scale_pcm(a[1]); dstr[(17 + i)*nch] = drmp3d_scale_pcm(b[1]); dstl[(15 - i)*nch] = drmp3d_scale_pcm(a[0]); dstl[(17 + i)*nch] = drmp3d_scale_pcm(b[0]); dstr[(47 - i)*nch] = drmp3d_scale_pcm(a[3]); dstr[(49 + i)*nch] = drmp3d_scale_pcm(b[3]); dstl[(47 - i)*nch] = drmp3d_scale_pcm(a[2]); dstl[(49 + i)*nch] = drmp3d_scale_pcm(b[2]); } #endif } static void drmp3d_synth_granule(float *qmf_state, float *grbuf, int nbands, int nch, drmp3d_sample_t *pcm, float *lins) { int i; for (i = 0; i < nch; i++) { drmp3d_DCT_II(grbuf + 576*i, nbands); } DRMP3_COPY_MEMORY(lins, qmf_state, sizeof(float)*15*64); for (i = 0; i < nbands; i += 2) { drmp3d_synth(grbuf + i, pcm + 32*nch*i, nch, lins + i*64); } #ifndef DR_MP3_NONSTANDARD_BUT_LOGICAL if (nch == 1) { for (i = 0; i < 15*64; i += 2) { qmf_state[i] = lins[nbands*64 + i]; } } else #endif { DRMP3_COPY_MEMORY(qmf_state, lins + nbands*64, sizeof(float)*15*64); } } static int drmp3d_match_frame(const drmp3_uint8 *hdr, int mp3_bytes, int frame_bytes) { int i, nmatch; for (i = 0, nmatch = 0; nmatch < DRMP3_MAX_FRAME_SYNC_MATCHES; nmatch++) { i += drmp3_hdr_frame_bytes(hdr + i, frame_bytes) + drmp3_hdr_padding(hdr + i); if (i + DRMP3_HDR_SIZE > mp3_bytes) return nmatch > 0; if (!drmp3_hdr_compare(hdr, hdr + i)) return 0; } return 1; } static int drmp3d_find_frame(const drmp3_uint8 *mp3, int mp3_bytes, int *free_format_bytes, int *ptr_frame_bytes) { int i, k; for (i = 0; i < mp3_bytes - DRMP3_HDR_SIZE; i++, mp3++) { if (drmp3_hdr_valid(mp3)) { int frame_bytes = drmp3_hdr_frame_bytes(mp3, *free_format_bytes); int frame_and_padding = frame_bytes + drmp3_hdr_padding(mp3); for (k = DRMP3_HDR_SIZE; !frame_bytes && k < DRMP3_MAX_FREE_FORMAT_FRAME_SIZE && i + 2*k < mp3_bytes - DRMP3_HDR_SIZE; k++) { if (drmp3_hdr_compare(mp3, mp3 + k)) { int fb = k - drmp3_hdr_padding(mp3); int nextfb = fb + drmp3_hdr_padding(mp3 + k); if (i + k + nextfb + DRMP3_HDR_SIZE > mp3_bytes || !drmp3_hdr_compare(mp3, mp3 + k + nextfb)) continue; frame_and_padding = k; frame_bytes = fb; *free_format_bytes = fb; } } if ((frame_bytes && i + frame_and_padding <= mp3_bytes && drmp3d_match_frame(mp3, mp3_bytes - i, frame_bytes)) || (!i && frame_and_padding == mp3_bytes)) { *ptr_frame_bytes = frame_and_padding; return i; } *free_format_bytes = 0; } } *ptr_frame_bytes = 0; return mp3_bytes; } DRMP3_API void drmp3dec_init(drmp3dec *dec) { dec->header[0] = 0; } DRMP3_API int drmp3dec_decode_frame(drmp3dec *dec, const drmp3_uint8 *mp3, int mp3_bytes, void *pcm, drmp3dec_frame_info *info) { int i = 0, igr, frame_size = 0, success = 1; const drmp3_uint8 *hdr; drmp3_bs bs_frame[1]; if (mp3_bytes > 4 && dec->header[0] == 0xff && drmp3_hdr_compare(dec->header, mp3)) { frame_size = drmp3_hdr_frame_bytes(mp3, dec->free_format_bytes) + drmp3_hdr_padding(mp3); if (frame_size != mp3_bytes && (frame_size + DRMP3_HDR_SIZE > mp3_bytes || !drmp3_hdr_compare(mp3, mp3 + frame_size))) { frame_size = 0; } } if (!frame_size) { DRMP3_ZERO_MEMORY(dec, sizeof(drmp3dec)); i = drmp3d_find_frame(mp3, mp3_bytes, &dec->free_format_bytes, &frame_size); if (!frame_size || i + frame_size > mp3_bytes) { info->frame_bytes = i; return 0; } } hdr = mp3 + i; DRMP3_COPY_MEMORY(dec->header, hdr, DRMP3_HDR_SIZE); info->frame_bytes = i + frame_size; info->channels = DRMP3_HDR_IS_MONO(hdr) ? 1 : 2; info->sample_rate = drmp3_hdr_sample_rate_hz(hdr); info->layer = 4 - DRMP3_HDR_GET_LAYER(hdr); info->bitrate_kbps = drmp3_hdr_bitrate_kbps(hdr); drmp3_bs_init(bs_frame, hdr + DRMP3_HDR_SIZE, frame_size - DRMP3_HDR_SIZE); if (DRMP3_HDR_IS_CRC(hdr)) { drmp3_bs_get_bits(bs_frame, 16); } if (info->layer == 3) { int main_data_begin = drmp3_L3_read_side_info(bs_frame, dec->scratch.gr_info, hdr); if (main_data_begin < 0 || bs_frame->pos > bs_frame->limit) { drmp3dec_init(dec); return 0; } success = drmp3_L3_restore_reservoir(dec, bs_frame, &dec->scratch, main_data_begin); if (success && pcm != NULL) { for (igr = 0; igr < (DRMP3_HDR_TEST_MPEG1(hdr) ? 2 : 1); igr++, pcm = DRMP3_OFFSET_PTR(pcm, sizeof(drmp3d_sample_t)*576*info->channels)) { DRMP3_ZERO_MEMORY(dec->scratch.grbuf[0], 576*2*sizeof(float)); drmp3_L3_decode(dec, &dec->scratch, dec->scratch.gr_info + igr*info->channels, info->channels); drmp3d_synth_granule(dec->qmf_state, dec->scratch.grbuf[0], 18, info->channels, (drmp3d_sample_t*)pcm, dec->scratch.syn[0]); } } drmp3_L3_save_reservoir(dec, &dec->scratch); } else { #ifdef DR_MP3_ONLY_MP3 return 0; #else drmp3_L12_scale_info sci[1]; if (pcm == NULL) { return drmp3_hdr_frame_samples(hdr); } drmp3_L12_read_scale_info(hdr, bs_frame, sci); DRMP3_ZERO_MEMORY(dec->scratch.grbuf[0], 576*2*sizeof(float)); for (i = 0, igr = 0; igr < 3; igr++) { if (12 == (i += drmp3_L12_dequantize_granule(dec->scratch.grbuf[0] + i, bs_frame, sci, info->layer | 1))) { i = 0; drmp3_L12_apply_scf_384(sci, sci->scf + igr, dec->scratch.grbuf[0]); drmp3d_synth_granule(dec->qmf_state, dec->scratch.grbuf[0], 12, info->channels, (drmp3d_sample_t*)pcm, dec->scratch.syn[0]); DRMP3_ZERO_MEMORY(dec->scratch.grbuf[0], 576*2*sizeof(float)); pcm = DRMP3_OFFSET_PTR(pcm, sizeof(drmp3d_sample_t)*384*info->channels); } if (bs_frame->pos > bs_frame->limit) { drmp3dec_init(dec); return 0; } } #endif } return success*drmp3_hdr_frame_samples(dec->header); } #ifndef DR_MP3_NO_S16 DRMP3_API void drmp3dec_f32_to_s16(const float *in, drmp3_int16 *out, size_t num_samples) { size_t i = 0; #if DRMP3_HAVE_SIMD size_t aligned_count = num_samples & ~7; for(; i < aligned_count; i+=8) { drmp3_f4 scale = DRMP3_VSET(32768.0f); drmp3_f4 a = DRMP3_VMUL(DRMP3_VLD(&in[i ]), scale); drmp3_f4 b = DRMP3_VMUL(DRMP3_VLD(&in[i+4]), scale); #if DRMP3_HAVE_SSE drmp3_f4 s16max = DRMP3_VSET( 32767.0f); drmp3_f4 s16min = DRMP3_VSET(-32768.0f); __m128i pcm8 = _mm_packs_epi32(_mm_cvtps_epi32(_mm_max_ps(_mm_min_ps(a, s16max), s16min)), _mm_cvtps_epi32(_mm_max_ps(_mm_min_ps(b, s16max), s16min))); out[i ] = (drmp3_int16)_mm_extract_epi16(pcm8, 0); out[i+1] = (drmp3_int16)_mm_extract_epi16(pcm8, 1); out[i+2] = (drmp3_int16)_mm_extract_epi16(pcm8, 2); out[i+3] = (drmp3_int16)_mm_extract_epi16(pcm8, 3); out[i+4] = (drmp3_int16)_mm_extract_epi16(pcm8, 4); out[i+5] = (drmp3_int16)_mm_extract_epi16(pcm8, 5); out[i+6] = (drmp3_int16)_mm_extract_epi16(pcm8, 6); out[i+7] = (drmp3_int16)_mm_extract_epi16(pcm8, 7); #else int16x4_t pcma, pcmb; a = DRMP3_VADD(a, DRMP3_VSET(0.5f)); b = DRMP3_VADD(b, DRMP3_VSET(0.5f)); pcma = vqmovn_s32(vqaddq_s32(vcvtq_s32_f32(a), vreinterpretq_s32_u32(vcltq_f32(a, DRMP3_VSET(0))))); pcmb = vqmovn_s32(vqaddq_s32(vcvtq_s32_f32(b), vreinterpretq_s32_u32(vcltq_f32(b, DRMP3_VSET(0))))); vst1_lane_s16(out+i , pcma, 0); vst1_lane_s16(out+i+1, pcma, 1); vst1_lane_s16(out+i+2, pcma, 2); vst1_lane_s16(out+i+3, pcma, 3); vst1_lane_s16(out+i+4, pcmb, 0); vst1_lane_s16(out+i+5, pcmb, 1); vst1_lane_s16(out+i+6, pcmb, 2); vst1_lane_s16(out+i+7, pcmb, 3); #endif } #endif for(; i < num_samples; i++) { float sample = in[i] * 32768.0f; if (sample >= 32766.5f) out[i] = (drmp3_int16) 32767; else if (sample <= -32767.5f) out[i] = (drmp3_int16)-32768; else { short s = (drmp3_int16)(sample + .5f); s -= (s < 0); /* away from zero, to be compliant */ out[i] = s; } } } #endif /************************************************************************************************************************************************************ Main Public API ************************************************************************************************************************************************************/ /* SIZE_MAX */ #if defined(SIZE_MAX) #define DRMP3_SIZE_MAX SIZE_MAX #else #if defined(_WIN64) || defined(_LP64) || defined(__LP64__) #define DRMP3_SIZE_MAX ((drmp3_uint64)0xFFFFFFFFFFFFFFFF) #else #define DRMP3_SIZE_MAX 0xFFFFFFFF #endif #endif /* End SIZE_MAX */ /* Options. */ #ifndef DRMP3_SEEK_LEADING_MP3_FRAMES #define DRMP3_SEEK_LEADING_MP3_FRAMES 2 #endif #define DRMP3_MIN_DATA_CHUNK_SIZE 16384 /* The size in bytes of each chunk of data to read from the MP3 stream. minimp3 recommends at least 16K, but in an attempt to reduce data movement I'm making this slightly larger. */ #ifndef DRMP3_DATA_CHUNK_SIZE #define DRMP3_DATA_CHUNK_SIZE (DRMP3_MIN_DATA_CHUNK_SIZE*4) #endif #define DRMP3_COUNTOF(x) (sizeof(x) / sizeof(x[0])) #define DRMP3_CLAMP(x, lo, hi) (DRMP3_MAX(lo, DRMP3_MIN(x, hi))) #ifndef DRMP3_PI_D #define DRMP3_PI_D 3.14159265358979323846264 #endif #define DRMP3_DEFAULT_RESAMPLER_LPF_ORDER 2 static DRMP3_INLINE float drmp3_mix_f32(float x, float y, float a) { return x*(1-a) + y*a; } static DRMP3_INLINE float drmp3_mix_f32_fast(float x, float y, float a) { float r0 = (y - x); float r1 = r0*a; return x + r1; /*return x + (y - x)*a;*/ } /* Greatest common factor using Euclid's algorithm iteratively. */ static DRMP3_INLINE drmp3_uint32 drmp3_gcf_u32(drmp3_uint32 a, drmp3_uint32 b) { for (;;) { if (b == 0) { break; } else { drmp3_uint32 t = a; a = b; b = t % a; } } return a; } static void* drmp3__malloc_default(size_t sz, void* pUserData) { (void)pUserData; return DRMP3_MALLOC(sz); } static void* drmp3__realloc_default(void* p, size_t sz, void* pUserData) { (void)pUserData; return DRMP3_REALLOC(p, sz); } static void drmp3__free_default(void* p, void* pUserData) { (void)pUserData; DRMP3_FREE(p); } static void* drmp3__malloc_from_callbacks(size_t sz, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pAllocationCallbacks == NULL) { return NULL; } if (pAllocationCallbacks->onMalloc != NULL) { return pAllocationCallbacks->onMalloc(sz, pAllocationCallbacks->pUserData); } /* Try using realloc(). */ if (pAllocationCallbacks->onRealloc != NULL) { return pAllocationCallbacks->onRealloc(NULL, sz, pAllocationCallbacks->pUserData); } return NULL; } static void* drmp3__realloc_from_callbacks(void* p, size_t szNew, size_t szOld, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pAllocationCallbacks == NULL) { return NULL; } if (pAllocationCallbacks->onRealloc != NULL) { return pAllocationCallbacks->onRealloc(p, szNew, pAllocationCallbacks->pUserData); } /* Try emulating realloc() in terms of malloc()/free(). */ if (pAllocationCallbacks->onMalloc != NULL && pAllocationCallbacks->onFree != NULL) { void* p2; p2 = pAllocationCallbacks->onMalloc(szNew, pAllocationCallbacks->pUserData); if (p2 == NULL) { return NULL; } if (p != NULL) { DRMP3_COPY_MEMORY(p2, p, szOld); pAllocationCallbacks->onFree(p, pAllocationCallbacks->pUserData); } return p2; } return NULL; } static void drmp3__free_from_callbacks(void* p, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (p == NULL || pAllocationCallbacks == NULL) { return; } if (pAllocationCallbacks->onFree != NULL) { pAllocationCallbacks->onFree(p, pAllocationCallbacks->pUserData); } } static drmp3_allocation_callbacks drmp3_copy_allocation_callbacks_or_defaults(const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pAllocationCallbacks != NULL) { /* Copy. */ return *pAllocationCallbacks; } else { /* Defaults. */ drmp3_allocation_callbacks allocationCallbacks; allocationCallbacks.pUserData = NULL; allocationCallbacks.onMalloc = drmp3__malloc_default; allocationCallbacks.onRealloc = drmp3__realloc_default; allocationCallbacks.onFree = drmp3__free_default; return allocationCallbacks; } } static size_t drmp3__on_read(drmp3* pMP3, void* pBufferOut, size_t bytesToRead) { size_t bytesRead; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->onRead != NULL); /* Don't try reading 0 bytes from the callback. This can happen when the stream is clamped against ID3v1 or APE tags at the end of the stream. */ if (bytesToRead == 0) { return 0; } bytesRead = pMP3->onRead(pMP3->pUserData, pBufferOut, bytesToRead); pMP3->streamCursor += bytesRead; return bytesRead; } static size_t drmp3__on_read_clamped(drmp3* pMP3, void* pBufferOut, size_t bytesToRead) { DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->onRead != NULL); if (pMP3->streamLength == DRMP3_UINT64_MAX) { return drmp3__on_read(pMP3, pBufferOut, bytesToRead); } else { drmp3_uint64 bytesRemaining; bytesRemaining = (pMP3->streamLength - pMP3->streamCursor); if (bytesToRead > bytesRemaining) { bytesToRead = (size_t)bytesRemaining; } return drmp3__on_read(pMP3, pBufferOut, bytesToRead); } } static drmp3_bool32 drmp3__on_seek(drmp3* pMP3, int offset, drmp3_seek_origin origin) { DRMP3_ASSERT(offset >= 0); DRMP3_ASSERT(origin == DRMP3_SEEK_SET || origin == DRMP3_SEEK_CUR); if (!pMP3->onSeek(pMP3->pUserData, offset, origin)) { return DRMP3_FALSE; } if (origin == DRMP3_SEEK_SET) { pMP3->streamCursor = (drmp3_uint64)offset; } else{ pMP3->streamCursor += offset; } return DRMP3_TRUE; } static drmp3_bool32 drmp3__on_seek_64(drmp3* pMP3, drmp3_uint64 offset, drmp3_seek_origin origin) { if (offset <= 0x7FFFFFFF) { return drmp3__on_seek(pMP3, (int)offset, origin); } /* Getting here "offset" is too large for a 32-bit integer. We just keep seeking forward until we hit the offset. */ if (!drmp3__on_seek(pMP3, 0x7FFFFFFF, DRMP3_SEEK_SET)) { return DRMP3_FALSE; } offset -= 0x7FFFFFFF; while (offset > 0) { if (offset <= 0x7FFFFFFF) { if (!drmp3__on_seek(pMP3, (int)offset, DRMP3_SEEK_CUR)) { return DRMP3_FALSE; } offset = 0; } else { if (!drmp3__on_seek(pMP3, 0x7FFFFFFF, DRMP3_SEEK_CUR)) { return DRMP3_FALSE; } offset -= 0x7FFFFFFF; } } return DRMP3_TRUE; } static void drmp3__on_meta(drmp3* pMP3, drmp3_metadata_type type, const void* pRawData, size_t rawDataSize) { if (pMP3->onMeta) { drmp3_metadata metadata; DRMP3_ZERO_OBJECT(&metadata); metadata.type = type; metadata.pRawData = pRawData; metadata.rawDataSize = rawDataSize; pMP3->onMeta(pMP3->pUserDataMeta, &metadata); } } static drmp3_uint32 drmp3_decode_next_frame_ex__callbacks(drmp3* pMP3, drmp3d_sample_t* pPCMFrames, drmp3dec_frame_info* pMP3FrameInfo, const drmp3_uint8** ppMP3FrameData) { drmp3_uint32 pcmFramesRead = 0; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->onRead != NULL); if (pMP3->atEnd) { return 0; } for (;;) { drmp3dec_frame_info info; /* minimp3 recommends doing data submission in chunks of at least 16K. If we don't have at least 16K bytes available, get more. */ if (pMP3->dataSize < DRMP3_MIN_DATA_CHUNK_SIZE) { size_t bytesRead; /* First we need to move the data down. */ if (pMP3->pData != NULL) { DRMP3_MOVE_MEMORY(pMP3->pData, pMP3->pData + pMP3->dataConsumed, pMP3->dataSize); } pMP3->dataConsumed = 0; if (pMP3->dataCapacity < DRMP3_DATA_CHUNK_SIZE) { drmp3_uint8* pNewData; size_t newDataCap; newDataCap = DRMP3_DATA_CHUNK_SIZE; pNewData = (drmp3_uint8*)drmp3__realloc_from_callbacks(pMP3->pData, newDataCap, pMP3->dataCapacity, &pMP3->allocationCallbacks); if (pNewData == NULL) { return 0; /* Out of memory. */ } pMP3->pData = pNewData; pMP3->dataCapacity = newDataCap; } bytesRead = drmp3__on_read_clamped(pMP3, pMP3->pData + pMP3->dataSize, (pMP3->dataCapacity - pMP3->dataSize)); if (bytesRead == 0) { if (pMP3->dataSize == 0) { pMP3->atEnd = DRMP3_TRUE; return 0; /* No data. */ } } pMP3->dataSize += bytesRead; } if (pMP3->dataSize > INT_MAX) { pMP3->atEnd = DRMP3_TRUE; return 0; /* File too big. */ } DRMP3_ASSERT(pMP3->pData != NULL); DRMP3_ASSERT(pMP3->dataCapacity > 0); /* Do a runtime check here to try silencing a false-positive from clang-analyzer. */ if (pMP3->pData == NULL) { return 0; } pcmFramesRead = drmp3dec_decode_frame(&pMP3->decoder, pMP3->pData + pMP3->dataConsumed, (int)pMP3->dataSize, pPCMFrames, &info); /* <-- Safe size_t -> int conversion thanks to the check above. */ /* Consume the data. */ pMP3->dataConsumed += (size_t)info.frame_bytes; pMP3->dataSize -= (size_t)info.frame_bytes; /* pcmFramesRead will be equal to 0 if decoding failed. If it is zero and info.frame_bytes > 0 then we have successfully decoded the frame. */ if (pcmFramesRead > 0) { pcmFramesRead = drmp3_hdr_frame_samples(pMP3->decoder.header); pMP3->pcmFramesConsumedInMP3Frame = 0; pMP3->pcmFramesRemainingInMP3Frame = pcmFramesRead; pMP3->mp3FrameChannels = info.channels; pMP3->mp3FrameSampleRate = info.sample_rate; if (pMP3FrameInfo != NULL) { *pMP3FrameInfo = info; } if (ppMP3FrameData != NULL) { *ppMP3FrameData = pMP3->pData + pMP3->dataConsumed - (size_t)info.frame_bytes; } break; } else if (info.frame_bytes == 0) { /* Need more data. minimp3 recommends doing data submission in 16K chunks. */ size_t bytesRead; /* First we need to move the data down. */ DRMP3_MOVE_MEMORY(pMP3->pData, pMP3->pData + pMP3->dataConsumed, pMP3->dataSize); pMP3->dataConsumed = 0; if (pMP3->dataCapacity == pMP3->dataSize) { /* No room. Expand. */ drmp3_uint8* pNewData; size_t newDataCap; newDataCap = pMP3->dataCapacity + DRMP3_DATA_CHUNK_SIZE; pNewData = (drmp3_uint8*)drmp3__realloc_from_callbacks(pMP3->pData, newDataCap, pMP3->dataCapacity, &pMP3->allocationCallbacks); if (pNewData == NULL) { return 0; /* Out of memory. */ } pMP3->pData = pNewData; pMP3->dataCapacity = newDataCap; } /* Fill in a chunk. */ bytesRead = drmp3__on_read_clamped(pMP3, pMP3->pData + pMP3->dataSize, (pMP3->dataCapacity - pMP3->dataSize)); if (bytesRead == 0) { pMP3->atEnd = DRMP3_TRUE; return 0; /* Error reading more data. */ } pMP3->dataSize += bytesRead; } }; return pcmFramesRead; } static drmp3_uint32 drmp3_decode_next_frame_ex__memory(drmp3* pMP3, drmp3d_sample_t* pPCMFrames, drmp3dec_frame_info* pMP3FrameInfo, const drmp3_uint8** ppMP3FrameData) { drmp3_uint32 pcmFramesRead = 0; drmp3dec_frame_info info; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->memory.pData != NULL); if (pMP3->atEnd) { return 0; } for (;;) { pcmFramesRead = drmp3dec_decode_frame(&pMP3->decoder, pMP3->memory.pData + pMP3->memory.currentReadPos, (int)(pMP3->memory.dataSize - pMP3->memory.currentReadPos), pPCMFrames, &info); if (pcmFramesRead > 0) { pcmFramesRead = drmp3_hdr_frame_samples(pMP3->decoder.header); pMP3->pcmFramesConsumedInMP3Frame = 0; pMP3->pcmFramesRemainingInMP3Frame = pcmFramesRead; pMP3->mp3FrameChannels = info.channels; pMP3->mp3FrameSampleRate = info.sample_rate; if (pMP3FrameInfo != NULL) { *pMP3FrameInfo = info; } if (ppMP3FrameData != NULL) { *ppMP3FrameData = pMP3->memory.pData + pMP3->memory.currentReadPos; } break; } else if (info.frame_bytes > 0) { /* No frames were read, but it looks like we skipped past one. Read the next MP3 frame. */ pMP3->memory.currentReadPos += (size_t)info.frame_bytes; pMP3->streamCursor += (size_t)info.frame_bytes; } else { /* Nothing at all was read. Abort. */ break; } } /* Consume the data. */ pMP3->memory.currentReadPos += (size_t)info.frame_bytes; pMP3->streamCursor += (size_t)info.frame_bytes; return pcmFramesRead; } static drmp3_uint32 drmp3_decode_next_frame_ex(drmp3* pMP3, drmp3d_sample_t* pPCMFrames, drmp3dec_frame_info* pMP3FrameInfo, const drmp3_uint8** ppMP3FrameData) { if (pMP3->memory.pData != NULL && pMP3->memory.dataSize > 0) { return drmp3_decode_next_frame_ex__memory(pMP3, pPCMFrames, pMP3FrameInfo, ppMP3FrameData); } else { return drmp3_decode_next_frame_ex__callbacks(pMP3, pPCMFrames, pMP3FrameInfo, ppMP3FrameData); } } static drmp3_uint32 drmp3_decode_next_frame(drmp3* pMP3) { DRMP3_ASSERT(pMP3 != NULL); return drmp3_decode_next_frame_ex(pMP3, (drmp3d_sample_t*)pMP3->pcmFrames, NULL, NULL); } #if 0 static drmp3_uint32 drmp3_seek_next_frame(drmp3* pMP3) { drmp3_uint32 pcmFrameCount; DRMP3_ASSERT(pMP3 != NULL); pcmFrameCount = drmp3_decode_next_frame_ex(pMP3, NULL, NULL, NULL); if (pcmFrameCount == 0) { return 0; } /* We have essentially just skipped past the frame, so just set the remaining samples to 0. */ pMP3->currentPCMFrame += pcmFrameCount; pMP3->pcmFramesConsumedInMP3Frame = pcmFrameCount; pMP3->pcmFramesRemainingInMP3Frame = 0; return pcmFrameCount; } #endif static drmp3_bool32 drmp3_init_internal(drmp3* pMP3, drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, drmp3_meta_proc onMeta, void* pUserData, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3dec_frame_info firstFrameInfo; const drmp3_uint8* pFirstFrameData; drmp3_uint32 firstFramePCMFrameCount; drmp3_uint32 detectedMP3FrameCount = 0xFFFFFFFF; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(onRead != NULL); /* This function assumes the output object has already been reset to 0. Do not do that here, otherwise things will break. */ drmp3dec_init(&pMP3->decoder); pMP3->onRead = onRead; pMP3->onSeek = onSeek; pMP3->onMeta = onMeta; pMP3->pUserData = pUserData; pMP3->pUserDataMeta = pUserDataMeta; pMP3->allocationCallbacks = drmp3_copy_allocation_callbacks_or_defaults(pAllocationCallbacks); if (pMP3->allocationCallbacks.onFree == NULL || (pMP3->allocationCallbacks.onMalloc == NULL && pMP3->allocationCallbacks.onRealloc == NULL)) { return DRMP3_FALSE; /* Invalid allocation callbacks. */ } pMP3->streamCursor = 0; pMP3->streamLength = DRMP3_UINT64_MAX; pMP3->streamStartOffset = 0; pMP3->delayInPCMFrames = 0; pMP3->paddingInPCMFrames = 0; pMP3->totalPCMFrameCount = DRMP3_UINT64_MAX; /* We'll first check for any ID3v1 or APE tags. */ #if 1 if (onSeek != NULL && onTell != NULL) { if (onSeek(pUserData, 0, DRMP3_SEEK_END)) { drmp3_int64 streamLen; int streamEndOffset = 0; /* First get the length of the stream. We need this so we can ensure the stream is big enough to store the tags. */ if (onTell(pUserData, &streamLen)) { /* ID3v1 */ if (streamLen > 128) { char id3[3]; if (onSeek(pUserData, streamEndOffset - 128, DRMP3_SEEK_END)) { if (onRead(pUserData, id3, 3) == 3 && id3[0] == 'T' && id3[1] == 'A' && id3[2] == 'G') { /* We have an ID3v1 tag. */ streamEndOffset -= 128; streamLen -= 128; /* Fire a metadata callback for the TAG data. */ if (onMeta != NULL) { drmp3_uint8 tag[128]; tag[0] = 'T'; tag[1] = 'A'; tag[2] = 'G'; if (onRead(pUserData, tag + 3, 125) == 125) { drmp3__on_meta(pMP3, DRMP3_METADATA_TYPE_ID3V1, tag, 128); } } } else { /* No ID3v1 tag. */ } } else { /* Failed to seek to the ID3v1 tag. */ } } else { /* Stream too short. No ID3v1 tag. */ } /* APE */ if (streamLen > 32) { char ape[32]; /* The footer. */ if (onSeek(pUserData, streamEndOffset - 32, DRMP3_SEEK_END)) { if (onRead(pUserData, ape, 32) == 32 && ape[0] == 'A' && ape[1] == 'P' && ape[2] == 'E' && ape[3] == 'T' && ape[4] == 'A' && ape[5] == 'G' && ape[6] == 'E' && ape[7] == 'X') { /* We have an APE tag. */ drmp3_uint32 tagSize = ((drmp3_uint32)ape[24] << 0) | ((drmp3_uint32)ape[25] << 8) | ((drmp3_uint32)ape[26] << 16) | ((drmp3_uint32)ape[27] << 24); if (32 + tagSize < streamLen) { streamEndOffset -= 32 + tagSize; streamLen -= 32 + tagSize; /* Fire a metadata callback for the APE data. Must include both the main content and footer. */ if (onMeta != NULL) { /* We first need to seek to the start of the APE tag. */ if (onSeek(pUserData, streamEndOffset, DRMP3_SEEK_END)) { size_t apeTagSize = (size_t)tagSize + 32; drmp3_uint8* pTagData = (drmp3_uint8*)drmp3_malloc(apeTagSize, pAllocationCallbacks); if (pTagData != NULL) { if (onRead(pUserData, pTagData, apeTagSize) == apeTagSize) { drmp3__on_meta(pMP3, DRMP3_METADATA_TYPE_APE, pTagData, apeTagSize); } drmp3_free(pTagData, pAllocationCallbacks); } } } } else { /* The tag size is larger than the stream. Invalid APE tag. */ } } } } else { /* Stream too short. No APE tag. */ } /* Seek back to the start. */ if (!onSeek(pUserData, 0, DRMP3_SEEK_SET)) { return DRMP3_FALSE; /* Failed to seek back to the start. */ } pMP3->streamLength = (drmp3_uint64)streamLen; if (pMP3->memory.pData != NULL) { pMP3->memory.dataSize = (size_t)pMP3->streamLength; } } else { /* Failed to get the length of the stream. ID3v1 and APE tags cannot be skipped. */ if (!onSeek(pUserData, 0, DRMP3_SEEK_SET)) { return DRMP3_FALSE; /* Failed to seek back to the start. */ } } } else { /* Failed to seek to the end. Cannot skip ID3v1 or APE tags. */ } } else { /* No onSeek or onTell callback. Cannot skip ID3v1 or APE tags. */ } #endif /* ID3v2 tags */ #if 1 { char header[10]; if (onRead(pUserData, header, 10) == 10) { if (header[0] == 'I' && header[1] == 'D' && header[2] == '3') { drmp3_uint32 tagSize = (((drmp3_uint32)header[6] & 0x7F) << 21) | (((drmp3_uint32)header[7] & 0x7F) << 14) | (((drmp3_uint32)header[8] & 0x7F) << 7) | (((drmp3_uint32)header[9] & 0x7F) << 0); /* Account for the footer. */ if (header[5] & 0x10) { tagSize += 10; } /* Read the tag content and fire a metadata callback. */ if (onMeta != NULL) { size_t tagSizeWithHeader = 10 + tagSize; drmp3_uint8* pTagData = (drmp3_uint8*)drmp3_malloc(tagSizeWithHeader, pAllocationCallbacks); if (pTagData != NULL) { DRMP3_COPY_MEMORY(pTagData, header, 10); if (onRead(pUserData, pTagData + 10, tagSize) == tagSize) { drmp3__on_meta(pMP3, DRMP3_METADATA_TYPE_ID3V2, pTagData, tagSizeWithHeader); } drmp3_free(pTagData, pAllocationCallbacks); } } else { /* Don't have a metadata callback, so just skip the tag. */ if (onSeek != NULL) { if (!onSeek(pUserData, tagSize, DRMP3_SEEK_CUR)) { return DRMP3_FALSE; /* Failed to seek past the ID3v2 tag. */ } } else { /* Don't have a seek callback. Read and discard. */ char discard[1024]; while (tagSize > 0) { size_t bytesToRead = tagSize; if (bytesToRead > sizeof(discard)) { bytesToRead = sizeof(discard); } if (onRead(pUserData, discard, bytesToRead) != bytesToRead) { return DRMP3_FALSE; /* Failed to read data. */ } tagSize -= (drmp3_uint32)bytesToRead; } } } pMP3->streamStartOffset += 10 + tagSize; /* +10 for the header. */ pMP3->streamCursor = pMP3->streamStartOffset; } else { /* Not an ID3v2 tag. Seek back to the start. */ if (onSeek != NULL) { if (!onSeek(pUserData, 0, DRMP3_SEEK_SET)) { return DRMP3_FALSE; /* Failed to seek back to the start. */ } } else { /* Don't have a seek callback to move backwards. We'll just fall through and let the decoding process re-sync. The ideal solution here would be to read into the cache. */ /* TODO: Copy the header into the cache. Will need to allocate space. See drmp3_decode_next_frame_ex__callbacks. There is not need to handle the memory case because that will always have a seek implementation and will never hit this code path. */ } } } else { /* Failed to read the header. We can return false here. If we couldn't read 10 bytes there's no way we'll have a valid MP3 stream. */ return DRMP3_FALSE; } } #endif /* Decode the first frame to confirm that it is indeed a valid MP3 stream. Note that it's possible the first frame is actually a Xing/LAME/VBRI header. If this is the case we need to skip over it. */ firstFramePCMFrameCount = drmp3_decode_next_frame_ex(pMP3, (drmp3d_sample_t*)pMP3->pcmFrames, &firstFrameInfo, &pFirstFrameData); if (firstFramePCMFrameCount > 0) { DRMP3_ASSERT(pFirstFrameData != NULL); /* It might be a header. If so, we need to clear out the cached PCM frames in order to trigger a reload of fresh data when decoding starts. We can assume all validation has already been performed to check if this is a valid MP3 frame and that there is more than 0 bytes making up the frame. We're going to be basing this parsing code off the minimp3_ex implementation. */ #if 1 DRMP3_ASSERT(firstFrameInfo.frame_bytes > 0); { drmp3_bs bs; drmp3_L3_gr_info grInfo[4]; drmp3_bs_init(&bs, pFirstFrameData + DRMP3_HDR_SIZE, firstFrameInfo.frame_bytes - DRMP3_HDR_SIZE); if (DRMP3_HDR_IS_CRC(pFirstFrameData)) { drmp3_bs_get_bits(&bs, 16); /* CRC. */ } if (drmp3_L3_read_side_info(&bs, grInfo, pFirstFrameData) >= 0) { drmp3_bool32 isXing = DRMP3_FALSE; drmp3_bool32 isInfo = DRMP3_FALSE; const drmp3_uint8* pTagData; const drmp3_uint8* pTagDataBeg; pTagDataBeg = pFirstFrameData + DRMP3_HDR_SIZE + (bs.pos/8); pTagData = pTagDataBeg; /* Check for both "Xing" and "Info" identifiers. */ isXing = (pTagData[0] == 'X' && pTagData[1] == 'i' && pTagData[2] == 'n' && pTagData[3] == 'g'); isInfo = (pTagData[0] == 'I' && pTagData[1] == 'n' && pTagData[2] == 'f' && pTagData[3] == 'o'); if (isXing || isInfo) { drmp3_uint32 bytes = 0; drmp3_uint32 flags = pTagData[7]; pTagData += 8; /* Skip past the ID and flags. */ if (flags & 0x01) { /* FRAMES flag. */ detectedMP3FrameCount = (drmp3_uint32)pTagData[0] << 24 | (drmp3_uint32)pTagData[1] << 16 | (drmp3_uint32)pTagData[2] << 8 | (drmp3_uint32)pTagData[3]; pTagData += 4; } if (flags & 0x02) { /* BYTES flag. */ bytes = (drmp3_uint32)pTagData[0] << 24 | (drmp3_uint32)pTagData[1] << 16 | (drmp3_uint32)pTagData[2] << 8 | (drmp3_uint32)pTagData[3]; (void)bytes; /* <-- Just to silence a warning about `bytes` being assigned but unused. Want to leave this here in case I want to make use of it later. */ pTagData += 4; } if (flags & 0x04) { /* TOC flag. */ /* TODO: Extract and bind seek points. */ pTagData += 100; } if (flags & 0x08) { /* SCALE flag. */ pTagData += 4; } /* At this point we're done with the Xing/Info header. Now we can look at the LAME data. */ if (pTagData[0]) { pTagData += 21; if (pTagData - pFirstFrameData + 14 < firstFrameInfo.frame_bytes) { int delayInPCMFrames; int paddingInPCMFrames; delayInPCMFrames = (( (drmp3_uint32)pTagData[0] << 4) | ((drmp3_uint32)pTagData[1] >> 4)) + (528 + 1); paddingInPCMFrames = ((((drmp3_uint32)pTagData[1] & 0xF) << 8) | ((drmp3_uint32)pTagData[2] )) - (528 + 1); if (paddingInPCMFrames < 0) { paddingInPCMFrames = 0; /* Padding cannot be negative. Probably a malformed file. Ignore. */ } pMP3->delayInPCMFrames = (drmp3_uint32)delayInPCMFrames; pMP3->paddingInPCMFrames = (drmp3_uint32)paddingInPCMFrames; } } /* My understanding is that if the "Xing" header is present we can consider this to be a VBR stream and if the "Info" header is present it's a CBR stream. If this is not the case let me know! I'm just tracking this for the time being in case I want to look at doing some CBR optimizations later on, such as faster seeking. */ if (isXing) { pMP3->isVBR = DRMP3_TRUE; } else if (isInfo) { pMP3->isCBR = DRMP3_TRUE; } /* Post the raw data of the tag to the metadata callback. */ if (onMeta != NULL) { drmp3_metadata_type metadataType = isXing ? DRMP3_METADATA_TYPE_XING : DRMP3_METADATA_TYPE_VBRI; size_t tagDataSize; tagDataSize = (size_t)firstFrameInfo.frame_bytes; tagDataSize -= (size_t)(pTagDataBeg - pFirstFrameData); drmp3__on_meta(pMP3, metadataType, pTagDataBeg, tagDataSize); } /* Since this was identified as a tag, we don't want to treat it as audio. We need to clear out the PCM cache. */ pMP3->pcmFramesRemainingInMP3Frame = 0; /* The start offset needs to be moved to the end of this frame so it's not included in any audio processing after seeking. */ pMP3->streamStartOffset += (drmp3_uint32)(firstFrameInfo.frame_bytes); pMP3->streamCursor = pMP3->streamStartOffset; /* The internal decoder needs to be reset to clear out any state. If we don't reset this state, it's possible for there to be inconsistencies in the number of samples read when reading to the end of the stream depending on whether or not the caller seeks to the start of the stream. */ drmp3dec_init(&pMP3->decoder); } } else { /* Failed to read the side info. */ } } #endif } else { /* Not a valid MP3 stream. */ drmp3__free_from_callbacks(pMP3->pData, &pMP3->allocationCallbacks); /* The call above may have allocated memory. Need to make sure it's freed before aborting. */ return DRMP3_FALSE; } if (detectedMP3FrameCount != 0xFFFFFFFF) { pMP3->totalPCMFrameCount = detectedMP3FrameCount * firstFramePCMFrameCount; } pMP3->channels = pMP3->mp3FrameChannels; pMP3->sampleRate = pMP3->mp3FrameSampleRate; return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init(drmp3* pMP3, drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, drmp3_meta_proc onMeta, void* pUserData, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pMP3 == NULL || onRead == NULL) { return DRMP3_FALSE; } DRMP3_ZERO_OBJECT(pMP3); return drmp3_init_internal(pMP3, onRead, onSeek, onTell, onMeta, pUserData, pUserData, pAllocationCallbacks); } static size_t drmp3__on_read_memory(void* pUserData, void* pBufferOut, size_t bytesToRead) { drmp3* pMP3 = (drmp3*)pUserData; size_t bytesRemaining; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->memory.dataSize >= pMP3->memory.currentReadPos); bytesRemaining = pMP3->memory.dataSize - pMP3->memory.currentReadPos; if (bytesToRead > bytesRemaining) { bytesToRead = bytesRemaining; } if (bytesToRead > 0) { DRMP3_COPY_MEMORY(pBufferOut, pMP3->memory.pData + pMP3->memory.currentReadPos, bytesToRead); pMP3->memory.currentReadPos += bytesToRead; } return bytesToRead; } static drmp3_bool32 drmp3__on_seek_memory(void* pUserData, int byteOffset, drmp3_seek_origin origin) { drmp3* pMP3 = (drmp3*)pUserData; drmp3_int64 newCursor; DRMP3_ASSERT(pMP3 != NULL); if (origin == DRMP3_SEEK_SET) { newCursor = 0; } else if (origin == DRMP3_SEEK_CUR) { newCursor = (drmp3_int64)pMP3->memory.currentReadPos; } else if (origin == DRMP3_SEEK_END) { newCursor = (drmp3_int64)pMP3->memory.dataSize; } else { DRMP3_ASSERT(!"Invalid seek origin"); return DRMP3_FALSE; } newCursor += byteOffset; if (newCursor < 0) { return DRMP3_FALSE; /* Trying to seek prior to the start of the buffer. */ } if ((size_t)newCursor > pMP3->memory.dataSize) { return DRMP3_FALSE; /* Trying to seek beyond the end of the buffer. */ } pMP3->memory.currentReadPos = (size_t)newCursor; return DRMP3_TRUE; } static drmp3_bool32 drmp3__on_tell_memory(void* pUserData, drmp3_int64* pCursor) { drmp3* pMP3 = (drmp3*)pUserData; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pCursor != NULL); *pCursor = (drmp3_int64)pMP3->memory.currentReadPos; return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init_memory_with_metadata(drmp3* pMP3, const void* pData, size_t dataSize, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3_bool32 result; if (pMP3 == NULL) { return DRMP3_FALSE; } DRMP3_ZERO_OBJECT(pMP3); if (pData == NULL || dataSize == 0) { return DRMP3_FALSE; } pMP3->memory.pData = (const drmp3_uint8*)pData; pMP3->memory.dataSize = dataSize; pMP3->memory.currentReadPos = 0; result = drmp3_init_internal(pMP3, drmp3__on_read_memory, drmp3__on_seek_memory, drmp3__on_tell_memory, onMeta, pMP3, pUserDataMeta, pAllocationCallbacks); if (result == DRMP3_FALSE) { return DRMP3_FALSE; } /* Adjust the length of the memory stream to account for ID3v1 and APE tags. */ if (pMP3->streamLength <= (drmp3_uint64)DRMP3_SIZE_MAX) { pMP3->memory.dataSize = (size_t)pMP3->streamLength; /* Safe cast. */ } if (pMP3->streamStartOffset > (drmp3_uint64)DRMP3_SIZE_MAX) { return DRMP3_FALSE; /* Tags too big. */ } return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init_memory(drmp3* pMP3, const void* pData, size_t dataSize, const drmp3_allocation_callbacks* pAllocationCallbacks) { return drmp3_init_memory_with_metadata(pMP3, pData, dataSize, NULL, NULL, pAllocationCallbacks); } #ifndef DR_MP3_NO_STDIO #include #include /* For wcslen(), wcsrtombs() */ /* Errno */ /* drmp3_result_from_errno() is only used inside DR_MP3_NO_STDIO for now. Move this out if it's ever used elsewhere. */ #include static drmp3_result drmp3_result_from_errno(int e) { switch (e) { case 0: return DRMP3_SUCCESS; #ifdef EPERM case EPERM: return DRMP3_INVALID_OPERATION; #endif #ifdef ENOENT case ENOENT: return DRMP3_DOES_NOT_EXIST; #endif #ifdef ESRCH case ESRCH: return DRMP3_DOES_NOT_EXIST; #endif #ifdef EINTR case EINTR: return DRMP3_INTERRUPT; #endif #ifdef EIO case EIO: return DRMP3_IO_ERROR; #endif #ifdef ENXIO case ENXIO: return DRMP3_DOES_NOT_EXIST; #endif #ifdef E2BIG case E2BIG: return DRMP3_INVALID_ARGS; #endif #ifdef ENOEXEC case ENOEXEC: return DRMP3_INVALID_FILE; #endif #ifdef EBADF case EBADF: return DRMP3_INVALID_FILE; #endif #ifdef ECHILD case ECHILD: return DRMP3_ERROR; #endif #ifdef EAGAIN case EAGAIN: return DRMP3_UNAVAILABLE; #endif #ifdef ENOMEM case ENOMEM: return DRMP3_OUT_OF_MEMORY; #endif #ifdef EACCES case EACCES: return DRMP3_ACCESS_DENIED; #endif #ifdef EFAULT case EFAULT: return DRMP3_BAD_ADDRESS; #endif #ifdef ENOTBLK case ENOTBLK: return DRMP3_ERROR; #endif #ifdef EBUSY case EBUSY: return DRMP3_BUSY; #endif #ifdef EEXIST case EEXIST: return DRMP3_ALREADY_EXISTS; #endif #ifdef EXDEV case EXDEV: return DRMP3_ERROR; #endif #ifdef ENODEV case ENODEV: return DRMP3_DOES_NOT_EXIST; #endif #ifdef ENOTDIR case ENOTDIR: return DRMP3_NOT_DIRECTORY; #endif #ifdef EISDIR case EISDIR: return DRMP3_IS_DIRECTORY; #endif #ifdef EINVAL case EINVAL: return DRMP3_INVALID_ARGS; #endif #ifdef ENFILE case ENFILE: return DRMP3_TOO_MANY_OPEN_FILES; #endif #ifdef EMFILE case EMFILE: return DRMP3_TOO_MANY_OPEN_FILES; #endif #ifdef ENOTTY case ENOTTY: return DRMP3_INVALID_OPERATION; #endif #ifdef ETXTBSY case ETXTBSY: return DRMP3_BUSY; #endif #ifdef EFBIG case EFBIG: return DRMP3_TOO_BIG; #endif #ifdef ENOSPC case ENOSPC: return DRMP3_NO_SPACE; #endif #ifdef ESPIPE case ESPIPE: return DRMP3_BAD_SEEK; #endif #ifdef EROFS case EROFS: return DRMP3_ACCESS_DENIED; #endif #ifdef EMLINK case EMLINK: return DRMP3_TOO_MANY_LINKS; #endif #ifdef EPIPE case EPIPE: return DRMP3_BAD_PIPE; #endif #ifdef EDOM case EDOM: return DRMP3_OUT_OF_RANGE; #endif #ifdef ERANGE case ERANGE: return DRMP3_OUT_OF_RANGE; #endif #ifdef EDEADLK case EDEADLK: return DRMP3_DEADLOCK; #endif #ifdef ENAMETOOLONG case ENAMETOOLONG: return DRMP3_PATH_TOO_LONG; #endif #ifdef ENOLCK case ENOLCK: return DRMP3_ERROR; #endif #ifdef ENOSYS case ENOSYS: return DRMP3_NOT_IMPLEMENTED; #endif #if defined(ENOTEMPTY) && ENOTEMPTY != EEXIST /* In AIX, ENOTEMPTY and EEXIST use the same value. */ case ENOTEMPTY: return DRMP3_DIRECTORY_NOT_EMPTY; #endif #ifdef ELOOP case ELOOP: return DRMP3_TOO_MANY_LINKS; #endif #ifdef ENOMSG case ENOMSG: return DRMP3_NO_MESSAGE; #endif #ifdef EIDRM case EIDRM: return DRMP3_ERROR; #endif #ifdef ECHRNG case ECHRNG: return DRMP3_ERROR; #endif #ifdef EL2NSYNC case EL2NSYNC: return DRMP3_ERROR; #endif #ifdef EL3HLT case EL3HLT: return DRMP3_ERROR; #endif #ifdef EL3RST case EL3RST: return DRMP3_ERROR; #endif #ifdef ELNRNG case ELNRNG: return DRMP3_OUT_OF_RANGE; #endif #ifdef EUNATCH case EUNATCH: return DRMP3_ERROR; #endif #ifdef ENOCSI case ENOCSI: return DRMP3_ERROR; #endif #ifdef EL2HLT case EL2HLT: return DRMP3_ERROR; #endif #ifdef EBADE case EBADE: return DRMP3_ERROR; #endif #ifdef EBADR case EBADR: return DRMP3_ERROR; #endif #ifdef EXFULL case EXFULL: return DRMP3_ERROR; #endif #ifdef ENOANO case ENOANO: return DRMP3_ERROR; #endif #ifdef EBADRQC case EBADRQC: return DRMP3_ERROR; #endif #ifdef EBADSLT case EBADSLT: return DRMP3_ERROR; #endif #ifdef EBFONT case EBFONT: return DRMP3_INVALID_FILE; #endif #ifdef ENOSTR case ENOSTR: return DRMP3_ERROR; #endif #ifdef ENODATA case ENODATA: return DRMP3_NO_DATA_AVAILABLE; #endif #ifdef ETIME case ETIME: return DRMP3_TIMEOUT; #endif #ifdef ENOSR case ENOSR: return DRMP3_NO_DATA_AVAILABLE; #endif #ifdef ENONET case ENONET: return DRMP3_NO_NETWORK; #endif #ifdef ENOPKG case ENOPKG: return DRMP3_ERROR; #endif #ifdef EREMOTE case EREMOTE: return DRMP3_ERROR; #endif #ifdef ENOLINK case ENOLINK: return DRMP3_ERROR; #endif #ifdef EADV case EADV: return DRMP3_ERROR; #endif #ifdef ESRMNT case ESRMNT: return DRMP3_ERROR; #endif #ifdef ECOMM case ECOMM: return DRMP3_ERROR; #endif #ifdef EPROTO case EPROTO: return DRMP3_ERROR; #endif #ifdef EMULTIHOP case EMULTIHOP: return DRMP3_ERROR; #endif #ifdef EDOTDOT case EDOTDOT: return DRMP3_ERROR; #endif #ifdef EBADMSG case EBADMSG: return DRMP3_BAD_MESSAGE; #endif #ifdef EOVERFLOW case EOVERFLOW: return DRMP3_TOO_BIG; #endif #ifdef ENOTUNIQ case ENOTUNIQ: return DRMP3_NOT_UNIQUE; #endif #ifdef EBADFD case EBADFD: return DRMP3_ERROR; #endif #ifdef EREMCHG case EREMCHG: return DRMP3_ERROR; #endif #ifdef ELIBACC case ELIBACC: return DRMP3_ACCESS_DENIED; #endif #ifdef ELIBBAD case ELIBBAD: return DRMP3_INVALID_FILE; #endif #ifdef ELIBSCN case ELIBSCN: return DRMP3_INVALID_FILE; #endif #ifdef ELIBMAX case ELIBMAX: return DRMP3_ERROR; #endif #ifdef ELIBEXEC case ELIBEXEC: return DRMP3_ERROR; #endif #ifdef EILSEQ case EILSEQ: return DRMP3_INVALID_DATA; #endif #ifdef ERESTART case ERESTART: return DRMP3_ERROR; #endif #ifdef ESTRPIPE case ESTRPIPE: return DRMP3_ERROR; #endif #ifdef EUSERS case EUSERS: return DRMP3_ERROR; #endif #ifdef ENOTSOCK case ENOTSOCK: return DRMP3_NOT_SOCKET; #endif #ifdef EDESTADDRREQ case EDESTADDRREQ: return DRMP3_NO_ADDRESS; #endif #ifdef EMSGSIZE case EMSGSIZE: return DRMP3_TOO_BIG; #endif #ifdef EPROTOTYPE case EPROTOTYPE: return DRMP3_BAD_PROTOCOL; #endif #ifdef ENOPROTOOPT case ENOPROTOOPT: return DRMP3_PROTOCOL_UNAVAILABLE; #endif #ifdef EPROTONOSUPPORT case EPROTONOSUPPORT: return DRMP3_PROTOCOL_NOT_SUPPORTED; #endif #ifdef ESOCKTNOSUPPORT case ESOCKTNOSUPPORT: return DRMP3_SOCKET_NOT_SUPPORTED; #endif #ifdef EOPNOTSUPP case EOPNOTSUPP: return DRMP3_INVALID_OPERATION; #endif #ifdef EPFNOSUPPORT case EPFNOSUPPORT: return DRMP3_PROTOCOL_FAMILY_NOT_SUPPORTED; #endif #ifdef EAFNOSUPPORT case EAFNOSUPPORT: return DRMP3_ADDRESS_FAMILY_NOT_SUPPORTED; #endif #ifdef EADDRINUSE case EADDRINUSE: return DRMP3_ALREADY_IN_USE; #endif #ifdef EADDRNOTAVAIL case EADDRNOTAVAIL: return DRMP3_ERROR; #endif #ifdef ENETDOWN case ENETDOWN: return DRMP3_NO_NETWORK; #endif #ifdef ENETUNREACH case ENETUNREACH: return DRMP3_NO_NETWORK; #endif #ifdef ENETRESET case ENETRESET: return DRMP3_NO_NETWORK; #endif #ifdef ECONNABORTED case ECONNABORTED: return DRMP3_NO_NETWORK; #endif #ifdef ECONNRESET case ECONNRESET: return DRMP3_CONNECTION_RESET; #endif #ifdef ENOBUFS case ENOBUFS: return DRMP3_NO_SPACE; #endif #ifdef EISCONN case EISCONN: return DRMP3_ALREADY_CONNECTED; #endif #ifdef ENOTCONN case ENOTCONN: return DRMP3_NOT_CONNECTED; #endif #ifdef ESHUTDOWN case ESHUTDOWN: return DRMP3_ERROR; #endif #ifdef ETOOMANYREFS case ETOOMANYREFS: return DRMP3_ERROR; #endif #ifdef ETIMEDOUT case ETIMEDOUT: return DRMP3_TIMEOUT; #endif #ifdef ECONNREFUSED case ECONNREFUSED: return DRMP3_CONNECTION_REFUSED; #endif #ifdef EHOSTDOWN case EHOSTDOWN: return DRMP3_NO_HOST; #endif #ifdef EHOSTUNREACH case EHOSTUNREACH: return DRMP3_NO_HOST; #endif #ifdef EALREADY case EALREADY: return DRMP3_IN_PROGRESS; #endif #ifdef EINPROGRESS case EINPROGRESS: return DRMP3_IN_PROGRESS; #endif #ifdef ESTALE case ESTALE: return DRMP3_INVALID_FILE; #endif #ifdef EUCLEAN case EUCLEAN: return DRMP3_ERROR; #endif #ifdef ENOTNAM case ENOTNAM: return DRMP3_ERROR; #endif #ifdef ENAVAIL case ENAVAIL: return DRMP3_ERROR; #endif #ifdef EISNAM case EISNAM: return DRMP3_ERROR; #endif #ifdef EREMOTEIO case EREMOTEIO: return DRMP3_IO_ERROR; #endif #ifdef EDQUOT case EDQUOT: return DRMP3_NO_SPACE; #endif #ifdef ENOMEDIUM case ENOMEDIUM: return DRMP3_DOES_NOT_EXIST; #endif #ifdef EMEDIUMTYPE case EMEDIUMTYPE: return DRMP3_ERROR; #endif #ifdef ECANCELED case ECANCELED: return DRMP3_CANCELLED; #endif #ifdef ENOKEY case ENOKEY: return DRMP3_ERROR; #endif #ifdef EKEYEXPIRED case EKEYEXPIRED: return DRMP3_ERROR; #endif #ifdef EKEYREVOKED case EKEYREVOKED: return DRMP3_ERROR; #endif #ifdef EKEYREJECTED case EKEYREJECTED: return DRMP3_ERROR; #endif #ifdef EOWNERDEAD case EOWNERDEAD: return DRMP3_ERROR; #endif #ifdef ENOTRECOVERABLE case ENOTRECOVERABLE: return DRMP3_ERROR; #endif #ifdef ERFKILL case ERFKILL: return DRMP3_ERROR; #endif #ifdef EHWPOISON case EHWPOISON: return DRMP3_ERROR; #endif default: return DRMP3_ERROR; } } /* End Errno */ /* fopen */ static drmp3_result drmp3_fopen(FILE** ppFile, const char* pFilePath, const char* pOpenMode) { #if defined(_MSC_VER) && _MSC_VER >= 1400 errno_t err; #endif if (ppFile != NULL) { *ppFile = NULL; /* Safety. */ } if (pFilePath == NULL || pOpenMode == NULL || ppFile == NULL) { return DRMP3_INVALID_ARGS; } #if defined(_MSC_VER) && _MSC_VER >= 1400 err = fopen_s(ppFile, pFilePath, pOpenMode); if (err != 0) { return drmp3_result_from_errno(err); } #else #if defined(_WIN32) || defined(__APPLE__) *ppFile = fopen(pFilePath, pOpenMode); #else #if defined(_FILE_OFFSET_BITS) && _FILE_OFFSET_BITS == 64 && defined(_LARGEFILE64_SOURCE) *ppFile = fopen64(pFilePath, pOpenMode); #else *ppFile = fopen(pFilePath, pOpenMode); #endif #endif if (*ppFile == NULL) { drmp3_result result = drmp3_result_from_errno(errno); if (result == DRMP3_SUCCESS) { result = DRMP3_ERROR; /* Just a safety check to make sure we never ever return success when pFile == NULL. */ } return result; } #endif return DRMP3_SUCCESS; } /* _wfopen() isn't always available in all compilation environments. * Windows only. * MSVC seems to support it universally as far back as VC6 from what I can tell (haven't checked further back). * MinGW-64 (both 32- and 64-bit) seems to support it. * MinGW wraps it in !defined(__STRICT_ANSI__). * OpenWatcom wraps it in !defined(_NO_EXT_KEYS). This can be reviewed as compatibility issues arise. The preference is to use _wfopen_s() and _wfopen() as opposed to the wcsrtombs() fallback, so if you notice your compiler not detecting this properly I'm happy to look at adding support. */ #if defined(_WIN32) #if defined(_MSC_VER) || defined(__MINGW64__) || (!defined(__STRICT_ANSI__) && !defined(_NO_EXT_KEYS)) #define DRMP3_HAS_WFOPEN #endif #endif static drmp3_result drmp3_wfopen(FILE** ppFile, const wchar_t* pFilePath, const wchar_t* pOpenMode, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (ppFile != NULL) { *ppFile = NULL; /* Safety. */ } if (pFilePath == NULL || pOpenMode == NULL || ppFile == NULL) { return DRMP3_INVALID_ARGS; } #if defined(DRMP3_HAS_WFOPEN) { /* Use _wfopen() on Windows. */ #if defined(_MSC_VER) && _MSC_VER >= 1400 errno_t err = _wfopen_s(ppFile, pFilePath, pOpenMode); if (err != 0) { return drmp3_result_from_errno(err); } #else *ppFile = _wfopen(pFilePath, pOpenMode); if (*ppFile == NULL) { return drmp3_result_from_errno(errno); } #endif (void)pAllocationCallbacks; } #else /* Use fopen() on anything other than Windows. Requires a conversion. This is annoying because fopen() is locale specific. The only real way I can think of to do this is with wcsrtombs(). Note that wcstombs() is apparently not thread-safe because it uses a static global mbstate_t object for maintaining state. I've checked this with -std=c89 and it works, but if somebody get's a compiler error I'll look into improving compatibility. */ /* Some compilers don't support wchar_t or wcsrtombs() which we're using below. In this case we just need to abort with an error. If you encounter a compiler lacking such support, add it to this list and submit a bug report and it'll be added to the library upstream. */ #if defined(__DJGPP__) { /* Nothing to do here. This will fall through to the error check below. */ } #else { mbstate_t mbs; size_t lenMB; const wchar_t* pFilePathTemp = pFilePath; char* pFilePathMB = NULL; char pOpenModeMB[32] = {0}; /* Get the length first. */ DRMP3_ZERO_OBJECT(&mbs); lenMB = wcsrtombs(NULL, &pFilePathTemp, 0, &mbs); if (lenMB == (size_t)-1) { return drmp3_result_from_errno(errno); } pFilePathMB = (char*)drmp3__malloc_from_callbacks(lenMB + 1, pAllocationCallbacks); if (pFilePathMB == NULL) { return DRMP3_OUT_OF_MEMORY; } pFilePathTemp = pFilePath; DRMP3_ZERO_OBJECT(&mbs); wcsrtombs(pFilePathMB, &pFilePathTemp, lenMB + 1, &mbs); /* The open mode should always consist of ASCII characters so we should be able to do a trivial conversion. */ { size_t i = 0; for (;;) { if (pOpenMode[i] == 0) { pOpenModeMB[i] = '\0'; break; } pOpenModeMB[i] = (char)pOpenMode[i]; i += 1; } } *ppFile = fopen(pFilePathMB, pOpenModeMB); drmp3__free_from_callbacks(pFilePathMB, pAllocationCallbacks); } #endif if (*ppFile == NULL) { return DRMP3_ERROR; } #endif return DRMP3_SUCCESS; } /* End fopen */ static size_t drmp3__on_read_stdio(void* pUserData, void* pBufferOut, size_t bytesToRead) { return fread(pBufferOut, 1, bytesToRead, (FILE*)pUserData); } static drmp3_bool32 drmp3__on_seek_stdio(void* pUserData, int offset, drmp3_seek_origin origin) { int whence = SEEK_SET; if (origin == DRMP3_SEEK_CUR) { whence = SEEK_CUR; } else if (origin == DRMP3_SEEK_END) { whence = SEEK_END; } return fseek((FILE*)pUserData, offset, whence) == 0; } static drmp3_bool32 drmp3__on_tell_stdio(void* pUserData, drmp3_int64* pCursor) { FILE* pFileStdio = (FILE*)pUserData; drmp3_int64 result; /* These were all validated at a higher level. */ DRMP3_ASSERT(pFileStdio != NULL); DRMP3_ASSERT(pCursor != NULL); #if defined(_WIN32) && !defined(NXDK) #if defined(_MSC_VER) && _MSC_VER > 1200 result = _ftelli64(pFileStdio); #else result = ftell(pFileStdio); #endif #else result = ftell(pFileStdio); #endif *pCursor = result; return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init_file_with_metadata(drmp3* pMP3, const char* pFilePath, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3_bool32 result; FILE* pFile; if (pMP3 == NULL) { return DRMP3_FALSE; } DRMP3_ZERO_OBJECT(pMP3); if (drmp3_fopen(&pFile, pFilePath, "rb") != DRMP3_SUCCESS) { return DRMP3_FALSE; } result = drmp3_init_internal(pMP3, drmp3__on_read_stdio, drmp3__on_seek_stdio, drmp3__on_tell_stdio, onMeta, (void*)pFile, pUserDataMeta, pAllocationCallbacks); if (result != DRMP3_TRUE) { fclose(pFile); return result; } return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init_file_with_metadata_w(drmp3* pMP3, const wchar_t* pFilePath, drmp3_meta_proc onMeta, void* pUserDataMeta, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3_bool32 result; FILE* pFile; if (pMP3 == NULL) { return DRMP3_FALSE; } DRMP3_ZERO_OBJECT(pMP3); if (drmp3_wfopen(&pFile, pFilePath, L"rb", pAllocationCallbacks) != DRMP3_SUCCESS) { return DRMP3_FALSE; } result = drmp3_init_internal(pMP3, drmp3__on_read_stdio, drmp3__on_seek_stdio, drmp3__on_tell_stdio, onMeta, (void*)pFile, pUserDataMeta, pAllocationCallbacks); if (result != DRMP3_TRUE) { fclose(pFile); return result; } return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_init_file(drmp3* pMP3, const char* pFilePath, const drmp3_allocation_callbacks* pAllocationCallbacks) { return drmp3_init_file_with_metadata(pMP3, pFilePath, NULL, NULL, pAllocationCallbacks); } DRMP3_API drmp3_bool32 drmp3_init_file_w(drmp3* pMP3, const wchar_t* pFilePath, const drmp3_allocation_callbacks* pAllocationCallbacks) { return drmp3_init_file_with_metadata_w(pMP3, pFilePath, NULL, NULL, pAllocationCallbacks); } #endif DRMP3_API void drmp3_uninit(drmp3* pMP3) { if (pMP3 == NULL) { return; } #ifndef DR_MP3_NO_STDIO if (pMP3->onRead == drmp3__on_read_stdio) { FILE* pFile = (FILE*)pMP3->pUserData; if (pFile != NULL) { fclose(pFile); pMP3->pUserData = NULL; /* Make sure the file handle is cleared to NULL to we don't attempt to close it a second time. */ } } #endif drmp3__free_from_callbacks(pMP3->pData, &pMP3->allocationCallbacks); } #ifndef DR_MP3_NO_S16 #if defined(DR_MP3_FLOAT_OUTPUT) static void drmp3_f32_to_s16(drmp3_int16* dst, const float* src, drmp3_uint64 sampleCount) { drmp3_uint64 i; drmp3_uint64 i4; drmp3_uint64 sampleCount4; /* Unrolled. */ i = 0; sampleCount4 = sampleCount >> 2; for (i4 = 0; i4 < sampleCount4; i4 += 1) { float x0 = src[i+0]; float x1 = src[i+1]; float x2 = src[i+2]; float x3 = src[i+3]; x0 = ((x0 < -1) ? -1 : ((x0 > 1) ? 1 : x0)); x1 = ((x1 < -1) ? -1 : ((x1 > 1) ? 1 : x1)); x2 = ((x2 < -1) ? -1 : ((x2 > 1) ? 1 : x2)); x3 = ((x3 < -1) ? -1 : ((x3 > 1) ? 1 : x3)); x0 = x0 * 32767.0f; x1 = x1 * 32767.0f; x2 = x2 * 32767.0f; x3 = x3 * 32767.0f; dst[i+0] = (drmp3_int16)x0; dst[i+1] = (drmp3_int16)x1; dst[i+2] = (drmp3_int16)x2; dst[i+3] = (drmp3_int16)x3; i += 4; } /* Leftover. */ for (; i < sampleCount; i += 1) { float x = src[i]; x = ((x < -1) ? -1 : ((x > 1) ? 1 : x)); /* clip */ x = x * 32767.0f; /* -1..1 to -32767..32767 */ dst[i] = (drmp3_int16)x; } } #endif #if !defined(DR_MP3_FLOAT_OUTPUT) static void drmp3_s16_to_f32(float* dst, const drmp3_int16* src, drmp3_uint64 sampleCount) { drmp3_uint64 i; for (i = 0; i < sampleCount; i += 1) { float x = (float)src[i]; x = x * 0.000030517578125f; /* -32768..32767 to -1..0.999969482421875 */ dst[i] = x; } } #endif #endif static drmp3_uint64 drmp3_read_pcm_frames_raw(drmp3* pMP3, drmp3_uint64 framesToRead, void* pBufferOut) { drmp3_uint64 totalFramesRead = 0; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->onRead != NULL); while (framesToRead > 0) { drmp3_uint32 framesToConsume; /* Skip frames if necessary. */ if (pMP3->currentPCMFrame < pMP3->delayInPCMFrames) { drmp3_uint32 framesToSkip = (drmp3_uint32)DRMP3_MIN(pMP3->pcmFramesRemainingInMP3Frame, pMP3->delayInPCMFrames - pMP3->currentPCMFrame); pMP3->currentPCMFrame += framesToSkip; pMP3->pcmFramesConsumedInMP3Frame += framesToSkip; pMP3->pcmFramesRemainingInMP3Frame -= framesToSkip; } framesToConsume = (drmp3_uint32)DRMP3_MIN(pMP3->pcmFramesRemainingInMP3Frame, framesToRead); /* Clamp the number of frames to read to the padding. */ if (pMP3->totalPCMFrameCount != DRMP3_UINT64_MAX && pMP3->totalPCMFrameCount > pMP3->paddingInPCMFrames) { if (pMP3->currentPCMFrame < (pMP3->totalPCMFrameCount - pMP3->paddingInPCMFrames)) { drmp3_uint64 framesRemainigToPadding = (pMP3->totalPCMFrameCount - pMP3->paddingInPCMFrames) - pMP3->currentPCMFrame; if (framesToConsume > framesRemainigToPadding) { framesToConsume = (drmp3_uint32)framesRemainigToPadding; } } else { /* We're into the padding. Abort. */ break; } } if (pBufferOut != NULL) { #if defined(DR_MP3_FLOAT_OUTPUT) { /* f32 */ float* pFramesOutF32 = (float*)DRMP3_OFFSET_PTR(pBufferOut, sizeof(float) * totalFramesRead * pMP3->channels); float* pFramesInF32 = (float*)DRMP3_OFFSET_PTR(&pMP3->pcmFrames[0], sizeof(float) * pMP3->pcmFramesConsumedInMP3Frame * pMP3->mp3FrameChannels); DRMP3_COPY_MEMORY(pFramesOutF32, pFramesInF32, sizeof(float) * framesToConsume * pMP3->channels); } #else { /* s16 */ drmp3_int16* pFramesOutS16 = (drmp3_int16*)DRMP3_OFFSET_PTR(pBufferOut, sizeof(drmp3_int16) * totalFramesRead * pMP3->channels); drmp3_int16* pFramesInS16 = (drmp3_int16*)DRMP3_OFFSET_PTR(&pMP3->pcmFrames[0], sizeof(drmp3_int16) * pMP3->pcmFramesConsumedInMP3Frame * pMP3->mp3FrameChannels); DRMP3_COPY_MEMORY(pFramesOutS16, pFramesInS16, sizeof(drmp3_int16) * framesToConsume * pMP3->channels); } #endif } pMP3->currentPCMFrame += framesToConsume; pMP3->pcmFramesConsumedInMP3Frame += framesToConsume; pMP3->pcmFramesRemainingInMP3Frame -= framesToConsume; totalFramesRead += framesToConsume; framesToRead -= framesToConsume; if (framesToRead == 0) { break; } /* If the cursor is already at the padding we need to abort. */ if (pMP3->totalPCMFrameCount != DRMP3_UINT64_MAX && pMP3->totalPCMFrameCount > pMP3->paddingInPCMFrames && pMP3->currentPCMFrame >= (pMP3->totalPCMFrameCount - pMP3->paddingInPCMFrames)) { break; } DRMP3_ASSERT(pMP3->pcmFramesRemainingInMP3Frame == 0); /* At this point we have exhausted our in-memory buffer so we need to re-fill. */ if (drmp3_decode_next_frame(pMP3) == 0) { break; } } return totalFramesRead; } DRMP3_API drmp3_uint64 drmp3_read_pcm_frames_f32(drmp3* pMP3, drmp3_uint64 framesToRead, float* pBufferOut) { if (pMP3 == NULL || pMP3->onRead == NULL) { return 0; } #if defined(DR_MP3_FLOAT_OUTPUT) /* Fast path. No conversion required. */ return drmp3_read_pcm_frames_raw(pMP3, framesToRead, pBufferOut); #else /* Slow path. Convert from s16 to f32. */ { drmp3_int16 pTempS16[8192]; drmp3_uint64 totalPCMFramesRead = 0; while (totalPCMFramesRead < framesToRead) { drmp3_uint64 framesJustRead; drmp3_uint64 framesRemaining = framesToRead - totalPCMFramesRead; drmp3_uint64 framesToReadNow = DRMP3_COUNTOF(pTempS16) / pMP3->channels; if (framesToReadNow > framesRemaining) { framesToReadNow = framesRemaining; } framesJustRead = drmp3_read_pcm_frames_raw(pMP3, framesToReadNow, pTempS16); if (framesJustRead == 0) { break; } drmp3_s16_to_f32((float*)DRMP3_OFFSET_PTR(pBufferOut, sizeof(float) * totalPCMFramesRead * pMP3->channels), pTempS16, framesJustRead * pMP3->channels); totalPCMFramesRead += framesJustRead; } return totalPCMFramesRead; } #endif } #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_uint64 drmp3_read_pcm_frames_s16(drmp3* pMP3, drmp3_uint64 framesToRead, drmp3_int16* pBufferOut) { if (pMP3 == NULL || pMP3->onRead == NULL) { return 0; } #if !defined(DR_MP3_FLOAT_OUTPUT) /* Fast path. No conversion required. */ return drmp3_read_pcm_frames_raw(pMP3, framesToRead, pBufferOut); #else /* Slow path. Convert from f32 to s16. */ { float pTempF32[4096]; drmp3_uint64 totalPCMFramesRead = 0; while (totalPCMFramesRead < framesToRead) { drmp3_uint64 framesJustRead; drmp3_uint64 framesRemaining = framesToRead - totalPCMFramesRead; drmp3_uint64 framesToReadNow = DRMP3_COUNTOF(pTempF32) / pMP3->channels; if (framesToReadNow > framesRemaining) { framesToReadNow = framesRemaining; } framesJustRead = drmp3_read_pcm_frames_raw(pMP3, framesToReadNow, pTempF32); if (framesJustRead == 0) { break; } drmp3_f32_to_s16((drmp3_int16*)DRMP3_OFFSET_PTR(pBufferOut, sizeof(drmp3_int16) * totalPCMFramesRead * pMP3->channels), pTempF32, framesJustRead * pMP3->channels); totalPCMFramesRead += framesJustRead; } return totalPCMFramesRead; } #endif } #endif static void drmp3_reset(drmp3* pMP3) { DRMP3_ASSERT(pMP3 != NULL); pMP3->pcmFramesConsumedInMP3Frame = 0; pMP3->pcmFramesRemainingInMP3Frame = 0; pMP3->currentPCMFrame = 0; pMP3->dataSize = 0; pMP3->atEnd = DRMP3_FALSE; drmp3dec_init(&pMP3->decoder); } static drmp3_bool32 drmp3_seek_to_start_of_stream(drmp3* pMP3) { DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->onSeek != NULL); /* Seek to the start of the stream to begin with. */ if (!drmp3__on_seek_64(pMP3, pMP3->streamStartOffset, DRMP3_SEEK_SET)) { return DRMP3_FALSE; } /* Clear any cached data. */ drmp3_reset(pMP3); return DRMP3_TRUE; } static drmp3_bool32 drmp3_seek_forward_by_pcm_frames__brute_force(drmp3* pMP3, drmp3_uint64 frameOffset) { drmp3_uint64 framesRead; /* Just using a dumb read-and-discard for now. What would be nice is to parse only the header of the MP3 frame, and then skip over leading frames without spending the time doing a full decode. I cannot see an easy way to do this in minimp3, however, so it may involve some kind of manual processing. */ #if defined(DR_MP3_FLOAT_OUTPUT) framesRead = drmp3_read_pcm_frames_f32(pMP3, frameOffset, NULL); #else framesRead = drmp3_read_pcm_frames_s16(pMP3, frameOffset, NULL); #endif if (framesRead != frameOffset) { return DRMP3_FALSE; } return DRMP3_TRUE; } static drmp3_bool32 drmp3_seek_to_pcm_frame__brute_force(drmp3* pMP3, drmp3_uint64 frameIndex) { DRMP3_ASSERT(pMP3 != NULL); if (frameIndex == pMP3->currentPCMFrame) { return DRMP3_TRUE; } /* If we're moving foward we just read from where we're at. Otherwise we need to move back to the start of the stream and read from the beginning. */ if (frameIndex < pMP3->currentPCMFrame) { /* Moving backward. Move to the start of the stream and then move forward. */ if (!drmp3_seek_to_start_of_stream(pMP3)) { return DRMP3_FALSE; } } DRMP3_ASSERT(frameIndex >= pMP3->currentPCMFrame); return drmp3_seek_forward_by_pcm_frames__brute_force(pMP3, (frameIndex - pMP3->currentPCMFrame)); } static drmp3_bool32 drmp3_find_closest_seek_point(drmp3* pMP3, drmp3_uint64 frameIndex, drmp3_uint32* pSeekPointIndex) { drmp3_uint32 iSeekPoint; DRMP3_ASSERT(pSeekPointIndex != NULL); *pSeekPointIndex = 0; if (frameIndex < pMP3->pSeekPoints[0].pcmFrameIndex) { return DRMP3_FALSE; } /* Linear search for simplicity to begin with while I'm getting this thing working. Once it's all working change this to a binary search. */ for (iSeekPoint = 0; iSeekPoint < pMP3->seekPointCount; ++iSeekPoint) { if (pMP3->pSeekPoints[iSeekPoint].pcmFrameIndex > frameIndex) { break; /* Found it. */ } *pSeekPointIndex = iSeekPoint; } return DRMP3_TRUE; } static drmp3_bool32 drmp3_seek_to_pcm_frame__seek_table(drmp3* pMP3, drmp3_uint64 frameIndex) { drmp3_seek_point seekPoint; drmp3_uint32 priorSeekPointIndex; drmp3_uint16 iMP3Frame; drmp3_uint64 leftoverFrames; DRMP3_ASSERT(pMP3 != NULL); DRMP3_ASSERT(pMP3->pSeekPoints != NULL); DRMP3_ASSERT(pMP3->seekPointCount > 0); /* If there is no prior seekpoint it means the target PCM frame comes before the first seek point. Just assume a seekpoint at the start of the file in this case. */ if (drmp3_find_closest_seek_point(pMP3, frameIndex, &priorSeekPointIndex)) { seekPoint = pMP3->pSeekPoints[priorSeekPointIndex]; } else { seekPoint.seekPosInBytes = 0; seekPoint.pcmFrameIndex = 0; seekPoint.mp3FramesToDiscard = 0; seekPoint.pcmFramesToDiscard = 0; } /* First thing to do is seek to the first byte of the relevant MP3 frame. */ if (!drmp3__on_seek_64(pMP3, seekPoint.seekPosInBytes, DRMP3_SEEK_SET)) { return DRMP3_FALSE; /* Failed to seek. */ } /* Clear any cached data. */ drmp3_reset(pMP3); /* Whole MP3 frames need to be discarded first. */ for (iMP3Frame = 0; iMP3Frame < seekPoint.mp3FramesToDiscard; ++iMP3Frame) { drmp3_uint32 pcmFramesRead; drmp3d_sample_t* pPCMFrames; /* Pass in non-null for the last frame because we want to ensure the sample rate converter is preloaded correctly. */ pPCMFrames = NULL; if (iMP3Frame == seekPoint.mp3FramesToDiscard-1) { pPCMFrames = (drmp3d_sample_t*)pMP3->pcmFrames; } /* We first need to decode the next frame. */ pcmFramesRead = drmp3_decode_next_frame_ex(pMP3, pPCMFrames, NULL, NULL); if (pcmFramesRead == 0) { return DRMP3_FALSE; } } /* We seeked to an MP3 frame in the raw stream so we need to make sure the current PCM frame is set correctly. */ pMP3->currentPCMFrame = seekPoint.pcmFrameIndex - seekPoint.pcmFramesToDiscard; /* Now at this point we can follow the same process as the brute force technique where we just skip over unnecessary MP3 frames and then read-and-discard at least 2 whole MP3 frames. */ leftoverFrames = frameIndex - pMP3->currentPCMFrame; return drmp3_seek_forward_by_pcm_frames__brute_force(pMP3, leftoverFrames); } DRMP3_API drmp3_bool32 drmp3_seek_to_pcm_frame(drmp3* pMP3, drmp3_uint64 frameIndex) { if (pMP3 == NULL || pMP3->onSeek == NULL) { return DRMP3_FALSE; } if (frameIndex == 0) { return drmp3_seek_to_start_of_stream(pMP3); } /* Use the seek table if we have one. */ if (pMP3->pSeekPoints != NULL && pMP3->seekPointCount > 0) { return drmp3_seek_to_pcm_frame__seek_table(pMP3, frameIndex); } else { return drmp3_seek_to_pcm_frame__brute_force(pMP3, frameIndex); } } DRMP3_API drmp3_bool32 drmp3_get_mp3_and_pcm_frame_count(drmp3* pMP3, drmp3_uint64* pMP3FrameCount, drmp3_uint64* pPCMFrameCount) { drmp3_uint64 currentPCMFrame; drmp3_uint64 totalPCMFrameCount; drmp3_uint64 totalMP3FrameCount; if (pMP3 == NULL) { return DRMP3_FALSE; } /* The way this works is we move back to the start of the stream, iterate over each MP3 frame and calculate the frame count based on our output sample rate, the seek back to the PCM frame we were sitting on before calling this function. */ /* The stream must support seeking for this to work. */ if (pMP3->onSeek == NULL) { return DRMP3_FALSE; } /* We'll need to seek back to where we were, so grab the PCM frame we're currently sitting on so we can restore later. */ currentPCMFrame = pMP3->currentPCMFrame; if (!drmp3_seek_to_start_of_stream(pMP3)) { return DRMP3_FALSE; } totalPCMFrameCount = 0; totalMP3FrameCount = 0; for (;;) { drmp3_uint32 pcmFramesInCurrentMP3Frame; pcmFramesInCurrentMP3Frame = drmp3_decode_next_frame_ex(pMP3, NULL, NULL, NULL); if (pcmFramesInCurrentMP3Frame == 0) { break; } totalPCMFrameCount += pcmFramesInCurrentMP3Frame; totalMP3FrameCount += 1; } /* Finally, we need to seek back to where we were. */ if (!drmp3_seek_to_start_of_stream(pMP3)) { return DRMP3_FALSE; } if (!drmp3_seek_to_pcm_frame(pMP3, currentPCMFrame)) { return DRMP3_FALSE; } if (pMP3FrameCount != NULL) { *pMP3FrameCount = totalMP3FrameCount; } if (pPCMFrameCount != NULL) { *pPCMFrameCount = totalPCMFrameCount; } return DRMP3_TRUE; } DRMP3_API drmp3_uint64 drmp3_get_pcm_frame_count(drmp3* pMP3) { drmp3_uint64 totalPCMFrameCount; if (pMP3 == NULL) { return 0; } if (pMP3->totalPCMFrameCount != DRMP3_UINT64_MAX) { totalPCMFrameCount = pMP3->totalPCMFrameCount; if (totalPCMFrameCount >= pMP3->delayInPCMFrames) { totalPCMFrameCount -= pMP3->delayInPCMFrames; } else { /* The delay is greater than the frame count reported by the Xing/Info tag. Assume it's invalid and ignore. */ } if (totalPCMFrameCount >= pMP3->paddingInPCMFrames) { totalPCMFrameCount -= pMP3->paddingInPCMFrames; } else { /* The padding is greater than the frame count reported by the Xing/Info tag. Assume it's invalid and ignore. */ } return totalPCMFrameCount; } else { /* Unknown frame count. Need to calculate it. */ if (!drmp3_get_mp3_and_pcm_frame_count(pMP3, NULL, &totalPCMFrameCount)) { return 0; } return totalPCMFrameCount; } } DRMP3_API drmp3_uint64 drmp3_get_mp3_frame_count(drmp3* pMP3) { drmp3_uint64 totalMP3FrameCount; if (!drmp3_get_mp3_and_pcm_frame_count(pMP3, &totalMP3FrameCount, NULL)) { return 0; } return totalMP3FrameCount; } static void drmp3__accumulate_running_pcm_frame_count(drmp3* pMP3, drmp3_uint32 pcmFrameCountIn, drmp3_uint64* pRunningPCMFrameCount, float* pRunningPCMFrameCountFractionalPart) { float srcRatio; float pcmFrameCountOutF; drmp3_uint32 pcmFrameCountOut; srcRatio = (float)pMP3->mp3FrameSampleRate / (float)pMP3->sampleRate; DRMP3_ASSERT(srcRatio > 0); pcmFrameCountOutF = *pRunningPCMFrameCountFractionalPart + (pcmFrameCountIn / srcRatio); pcmFrameCountOut = (drmp3_uint32)pcmFrameCountOutF; *pRunningPCMFrameCountFractionalPart = pcmFrameCountOutF - pcmFrameCountOut; *pRunningPCMFrameCount += pcmFrameCountOut; } typedef struct { drmp3_uint64 bytePos; drmp3_uint64 pcmFrameIndex; /* <-- After sample rate conversion. */ } drmp3__seeking_mp3_frame_info; DRMP3_API drmp3_bool32 drmp3_calculate_seek_points(drmp3* pMP3, drmp3_uint32* pSeekPointCount, drmp3_seek_point* pSeekPoints) { drmp3_uint32 seekPointCount; drmp3_uint64 currentPCMFrame; drmp3_uint64 totalMP3FrameCount; drmp3_uint64 totalPCMFrameCount; if (pMP3 == NULL || pSeekPointCount == NULL || pSeekPoints == NULL) { return DRMP3_FALSE; /* Invalid args. */ } seekPointCount = *pSeekPointCount; if (seekPointCount == 0) { return DRMP3_FALSE; /* The client has requested no seek points. Consider this to be invalid arguments since the client has probably not intended this. */ } /* We'll need to seek back to the current sample after calculating the seekpoints so we need to go ahead and grab the current location at the top. */ currentPCMFrame = pMP3->currentPCMFrame; /* We never do more than the total number of MP3 frames and we limit it to 32-bits. */ if (!drmp3_get_mp3_and_pcm_frame_count(pMP3, &totalMP3FrameCount, &totalPCMFrameCount)) { return DRMP3_FALSE; } /* If there's less than DRMP3_SEEK_LEADING_MP3_FRAMES+1 frames we just report 1 seek point which will be the very start of the stream. */ if (totalMP3FrameCount < DRMP3_SEEK_LEADING_MP3_FRAMES+1) { seekPointCount = 1; pSeekPoints[0].seekPosInBytes = 0; pSeekPoints[0].pcmFrameIndex = 0; pSeekPoints[0].mp3FramesToDiscard = 0; pSeekPoints[0].pcmFramesToDiscard = 0; } else { drmp3_uint64 pcmFramesBetweenSeekPoints; drmp3__seeking_mp3_frame_info mp3FrameInfo[DRMP3_SEEK_LEADING_MP3_FRAMES+1]; drmp3_uint64 runningPCMFrameCount = 0; float runningPCMFrameCountFractionalPart = 0; drmp3_uint64 nextTargetPCMFrame; drmp3_uint32 iMP3Frame; drmp3_uint32 iSeekPoint; if (seekPointCount > totalMP3FrameCount-1) { seekPointCount = (drmp3_uint32)totalMP3FrameCount-1; } pcmFramesBetweenSeekPoints = totalPCMFrameCount / (seekPointCount+1); /* Here is where we actually calculate the seek points. We need to start by moving the start of the stream. We then enumerate over each MP3 frame. */ if (!drmp3_seek_to_start_of_stream(pMP3)) { return DRMP3_FALSE; } /* We need to cache the byte positions of the previous MP3 frames. As a new MP3 frame is iterated, we cycle the byte positions in this array. The value in the first item in this array is the byte position that will be reported in the next seek point. */ /* We need to initialize the array of MP3 byte positions for the leading MP3 frames. */ for (iMP3Frame = 0; iMP3Frame < DRMP3_SEEK_LEADING_MP3_FRAMES+1; ++iMP3Frame) { drmp3_uint32 pcmFramesInCurrentMP3FrameIn; /* The byte position of the next frame will be the stream's cursor position, minus whatever is sitting in the buffer. */ DRMP3_ASSERT(pMP3->streamCursor >= pMP3->dataSize); mp3FrameInfo[iMP3Frame].bytePos = pMP3->streamCursor - pMP3->dataSize; mp3FrameInfo[iMP3Frame].pcmFrameIndex = runningPCMFrameCount; /* We need to get information about this frame so we can know how many samples it contained. */ pcmFramesInCurrentMP3FrameIn = drmp3_decode_next_frame_ex(pMP3, NULL, NULL, NULL); if (pcmFramesInCurrentMP3FrameIn == 0) { return DRMP3_FALSE; /* This should never happen. */ } drmp3__accumulate_running_pcm_frame_count(pMP3, pcmFramesInCurrentMP3FrameIn, &runningPCMFrameCount, &runningPCMFrameCountFractionalPart); } /* At this point we will have extracted the byte positions of the leading MP3 frames. We can now start iterating over each seek point and calculate them. */ nextTargetPCMFrame = 0; for (iSeekPoint = 0; iSeekPoint < seekPointCount; ++iSeekPoint) { nextTargetPCMFrame += pcmFramesBetweenSeekPoints; for (;;) { if (nextTargetPCMFrame < runningPCMFrameCount) { /* The next seek point is in the current MP3 frame. */ pSeekPoints[iSeekPoint].seekPosInBytes = mp3FrameInfo[0].bytePos; pSeekPoints[iSeekPoint].pcmFrameIndex = nextTargetPCMFrame; pSeekPoints[iSeekPoint].mp3FramesToDiscard = DRMP3_SEEK_LEADING_MP3_FRAMES; pSeekPoints[iSeekPoint].pcmFramesToDiscard = (drmp3_uint16)(nextTargetPCMFrame - mp3FrameInfo[DRMP3_SEEK_LEADING_MP3_FRAMES-1].pcmFrameIndex); break; } else { size_t i; drmp3_uint32 pcmFramesInCurrentMP3FrameIn; /* The next seek point is not in the current MP3 frame, so continue on to the next one. The first thing to do is cycle the cached MP3 frame info. */ for (i = 0; i < DRMP3_COUNTOF(mp3FrameInfo)-1; ++i) { mp3FrameInfo[i] = mp3FrameInfo[i+1]; } /* Cache previous MP3 frame info. */ mp3FrameInfo[DRMP3_COUNTOF(mp3FrameInfo)-1].bytePos = pMP3->streamCursor - pMP3->dataSize; mp3FrameInfo[DRMP3_COUNTOF(mp3FrameInfo)-1].pcmFrameIndex = runningPCMFrameCount; /* Go to the next MP3 frame. This shouldn't ever fail, but just in case it does we just set the seek point and break. If it happens, it should only ever do it for the last seek point. */ pcmFramesInCurrentMP3FrameIn = drmp3_decode_next_frame_ex(pMP3, NULL, NULL, NULL); if (pcmFramesInCurrentMP3FrameIn == 0) { pSeekPoints[iSeekPoint].seekPosInBytes = mp3FrameInfo[0].bytePos; pSeekPoints[iSeekPoint].pcmFrameIndex = nextTargetPCMFrame; pSeekPoints[iSeekPoint].mp3FramesToDiscard = DRMP3_SEEK_LEADING_MP3_FRAMES; pSeekPoints[iSeekPoint].pcmFramesToDiscard = (drmp3_uint16)(nextTargetPCMFrame - mp3FrameInfo[DRMP3_SEEK_LEADING_MP3_FRAMES-1].pcmFrameIndex); break; } drmp3__accumulate_running_pcm_frame_count(pMP3, pcmFramesInCurrentMP3FrameIn, &runningPCMFrameCount, &runningPCMFrameCountFractionalPart); } } } /* Finally, we need to seek back to where we were. */ if (!drmp3_seek_to_start_of_stream(pMP3)) { return DRMP3_FALSE; } if (!drmp3_seek_to_pcm_frame(pMP3, currentPCMFrame)) { return DRMP3_FALSE; } } *pSeekPointCount = seekPointCount; return DRMP3_TRUE; } DRMP3_API drmp3_bool32 drmp3_bind_seek_table(drmp3* pMP3, drmp3_uint32 seekPointCount, drmp3_seek_point* pSeekPoints) { if (pMP3 == NULL) { return DRMP3_FALSE; } if (seekPointCount == 0 || pSeekPoints == NULL) { /* Unbinding. */ pMP3->seekPointCount = 0; pMP3->pSeekPoints = NULL; } else { /* Binding. */ pMP3->seekPointCount = seekPointCount; pMP3->pSeekPoints = pSeekPoints; } return DRMP3_TRUE; } #ifndef DR_MP3_NO_FULL_READ static float* drmp3__full_read_and_close_f32(drmp3* pMP3, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount) { drmp3_uint64 totalFramesRead = 0; drmp3_uint64 framesCapacity = 0; float* pFrames = NULL; float temp[4096]; DRMP3_ASSERT(pMP3 != NULL); for (;;) { drmp3_uint64 framesToReadRightNow = DRMP3_COUNTOF(temp) / pMP3->channels; drmp3_uint64 framesJustRead = drmp3_read_pcm_frames_f32(pMP3, framesToReadRightNow, temp); if (framesJustRead == 0) { break; } /* Reallocate the output buffer if there's not enough room. */ if (framesCapacity < totalFramesRead + framesJustRead) { drmp3_uint64 oldFramesBufferSize; drmp3_uint64 newFramesBufferSize; drmp3_uint64 newFramesCap; float* pNewFrames; newFramesCap = framesCapacity * 2; if (newFramesCap < totalFramesRead + framesJustRead) { newFramesCap = totalFramesRead + framesJustRead; } oldFramesBufferSize = framesCapacity * pMP3->channels * sizeof(float); newFramesBufferSize = newFramesCap * pMP3->channels * sizeof(float); if (newFramesBufferSize > (drmp3_uint64)DRMP3_SIZE_MAX) { break; } pNewFrames = (float*)drmp3__realloc_from_callbacks(pFrames, (size_t)newFramesBufferSize, (size_t)oldFramesBufferSize, &pMP3->allocationCallbacks); if (pNewFrames == NULL) { drmp3__free_from_callbacks(pFrames, &pMP3->allocationCallbacks); pFrames = NULL; totalFramesRead = 0; break; } pFrames = pNewFrames; framesCapacity = newFramesCap; } DRMP3_COPY_MEMORY(pFrames + totalFramesRead*pMP3->channels, temp, (size_t)(framesJustRead*pMP3->channels*sizeof(float))); totalFramesRead += framesJustRead; /* If the number of frames we asked for is less that what we actually read it means we've reached the end. */ if (framesJustRead != framesToReadRightNow) { break; } } if (pConfig != NULL) { pConfig->channels = pMP3->channels; pConfig->sampleRate = pMP3->sampleRate; } drmp3_uninit(pMP3); if (pTotalFrameCount) { *pTotalFrameCount = totalFramesRead; } return pFrames; } #ifndef DR_MP3_NO_S16 static drmp3_int16* drmp3__full_read_and_close_s16(drmp3* pMP3, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount) { drmp3_uint64 totalFramesRead = 0; drmp3_uint64 framesCapacity = 0; drmp3_int16* pFrames = NULL; drmp3_int16 temp[4096]; DRMP3_ASSERT(pMP3 != NULL); for (;;) { drmp3_uint64 framesToReadRightNow = DRMP3_COUNTOF(temp) / pMP3->channels; drmp3_uint64 framesJustRead = drmp3_read_pcm_frames_s16(pMP3, framesToReadRightNow, temp); if (framesJustRead == 0) { break; } /* Reallocate the output buffer if there's not enough room. */ if (framesCapacity < totalFramesRead + framesJustRead) { drmp3_uint64 newFramesBufferSize; drmp3_uint64 oldFramesBufferSize; drmp3_uint64 newFramesCap; drmp3_int16* pNewFrames; newFramesCap = framesCapacity * 2; if (newFramesCap < totalFramesRead + framesJustRead) { newFramesCap = totalFramesRead + framesJustRead; } oldFramesBufferSize = framesCapacity * pMP3->channels * sizeof(drmp3_int16); newFramesBufferSize = newFramesCap * pMP3->channels * sizeof(drmp3_int16); if (newFramesBufferSize > (drmp3_uint64)DRMP3_SIZE_MAX) { break; } pNewFrames = (drmp3_int16*)drmp3__realloc_from_callbacks(pFrames, (size_t)newFramesBufferSize, (size_t)oldFramesBufferSize, &pMP3->allocationCallbacks); if (pNewFrames == NULL) { drmp3__free_from_callbacks(pFrames, &pMP3->allocationCallbacks); pFrames = NULL; totalFramesRead = 0; break; } pFrames = pNewFrames; framesCapacity = newFramesCap; } DRMP3_COPY_MEMORY(pFrames + totalFramesRead*pMP3->channels, temp, (size_t)(framesJustRead*pMP3->channels*sizeof(drmp3_int16))); totalFramesRead += framesJustRead; /* If the number of frames we asked for is less that what we actually read it means we've reached the end. */ if (framesJustRead != framesToReadRightNow) { break; } } if (pConfig != NULL) { pConfig->channels = pMP3->channels; pConfig->sampleRate = pMP3->sampleRate; } drmp3_uninit(pMP3); if (pTotalFrameCount) { *pTotalFrameCount = totalFramesRead; } return pFrames; } #endif DRMP3_API float* drmp3_open_and_read_pcm_frames_f32(drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, void* pUserData, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init(&mp3, onRead, onSeek, onTell, NULL, pUserData, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_f32(&mp3, pConfig, pTotalFrameCount); } #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_and_read_pcm_frames_s16(drmp3_read_proc onRead, drmp3_seek_proc onSeek, drmp3_tell_proc onTell, void* pUserData, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init(&mp3, onRead, onSeek, onTell, NULL, pUserData, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_s16(&mp3, pConfig, pTotalFrameCount); } #endif DRMP3_API float* drmp3_open_memory_and_read_pcm_frames_f32(const void* pData, size_t dataSize, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init_memory(&mp3, pData, dataSize, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_f32(&mp3, pConfig, pTotalFrameCount); } #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_memory_and_read_pcm_frames_s16(const void* pData, size_t dataSize, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init_memory(&mp3, pData, dataSize, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_s16(&mp3, pConfig, pTotalFrameCount); } #endif #ifndef DR_MP3_NO_STDIO DRMP3_API float* drmp3_open_file_and_read_pcm_frames_f32(const char* filePath, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init_file(&mp3, filePath, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_f32(&mp3, pConfig, pTotalFrameCount); } #ifndef DR_MP3_NO_S16 DRMP3_API drmp3_int16* drmp3_open_file_and_read_pcm_frames_s16(const char* filePath, drmp3_config* pConfig, drmp3_uint64* pTotalFrameCount, const drmp3_allocation_callbacks* pAllocationCallbacks) { drmp3 mp3; if (!drmp3_init_file(&mp3, filePath, pAllocationCallbacks)) { return NULL; } return drmp3__full_read_and_close_s16(&mp3, pConfig, pTotalFrameCount); } #endif #endif #endif DRMP3_API void* drmp3_malloc(size_t sz, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pAllocationCallbacks != NULL) { return drmp3__malloc_from_callbacks(sz, pAllocationCallbacks); } else { return drmp3__malloc_default(sz, NULL); } } DRMP3_API void drmp3_free(void* p, const drmp3_allocation_callbacks* pAllocationCallbacks) { if (pAllocationCallbacks != NULL) { drmp3__free_from_callbacks(p, pAllocationCallbacks); } else { drmp3__free_default(p, NULL); } } #endif /* dr_mp3_c */ #endif /*DR_MP3_IMPLEMENTATION*/ /* DIFFERENCES BETWEEN minimp3 AND dr_mp3 ====================================== - First, keep in mind that minimp3 (https://github.com/lieff/minimp3) is where all the real work was done. All of the code relating to the actual decoding remains mostly unmodified, apart from some namespacing changes. - dr_mp3 adds a pulling style API which allows you to deliver raw data via callbacks. So, rather than pushing data to the decoder, the decoder _pulls_ data from your callbacks. - In addition to callbacks, a decoder can be initialized from a block of memory and a file. - The dr_mp3 pull API reads PCM frames rather than whole MP3 frames. - dr_mp3 adds convenience APIs for opening and decoding entire files in one go. - dr_mp3 is fully namespaced, including the implementation section, which is more suitable when compiling projects as a single translation unit (aka unity builds). At the time of writing this, a unity build is not possible when using minimp3 in conjunction with stb_vorbis. dr_mp3 addresses this. */ /* REVISION HISTORY ================ v0.7.3 - 2026-01-17 - Fix an error in drmp3_open_and_read_pcm_frames_s16() and family when memory allocation fails. - Fix some compilation warnings. v0.7.2 - 2025-12-02 - Reduce stack space to improve robustness on embedded systems. - Fix a compilation error with MSVC Clang toolset relating to cpuid. - Fix an error with APE tag parsing. v0.7.1 - 2025-09-10 - Silence a warning with GCC. - Fix an error with the NXDK build. - Fix a decoding inconsistency when seeking. Prior to this change, reading to the end of the stream immediately after initializing will result in a different number of samples read than if the stream is seeked to the start and read to the end. v0.7.0 - 2025-07-23 - The old `DRMP3_IMPLEMENTATION` has been removed. Use `DR_MP3_IMPLEMENTATION` instead. The reason for this change is that in the future everything will eventually be using the underscored naming convention in the future, so `drmp3` will become `dr_mp3`. - API CHANGE: Seek origins have been renamed to match the naming convention used by dr_wav and my other libraries. - drmp3_seek_origin_start -> DRMP3_SEEK_SET - drmp3_seek_origin_current -> DRMP3_SEEK_CUR - DRMP3_SEEK_END (new) - API CHANGE: Add DRMP3_SEEK_END as a seek origin for the seek callback. This is required for detection of ID3v1 and APE tags. - API CHANGE: Add onTell callback to `drmp3_init()`. This is needed in order to track the location of ID3v1 and APE tags. - API CHANGE: Add onMeta callback to `drmp3_init()`. This is used for reporting tag data back to the caller. Currently this only reports the raw tag data which means applications need to parse the data themselves. - API CHANGE: Rename `drmp3dec_frame_info.hz` to `drmp3dec_frame_info.sample_rate`. - Add detection of ID3v2, ID3v1, APE and Xing/VBRI tags. This should fix errors with some files where the decoder was reading tags as audio data. - Delay and padding samples from LAME tags are now handled. - Fix compilation for AIX OS. v0.6.40 - 2024-12-17 - Improve detection of ARM64EC v0.6.39 - 2024-02-27 - Fix a Wdouble-promotion warning. v0.6.38 - 2023-11-02 - Fix build for ARMv6-M. v0.6.37 - 2023-07-07 - Silence a static analysis warning. v0.6.36 - 2023-06-17 - Fix an incorrect date in revision history. No functional change. v0.6.35 - 2023-05-22 - Minor code restructure. No functional change. v0.6.34 - 2022-09-17 - Fix compilation with DJGPP. - Fix compilation when compiling with x86 with no SSE2. - Remove an unnecessary variable from the drmp3 structure. v0.6.33 - 2022-04-10 - Fix compilation error with the MSVC ARM64 build. - Fix compilation error on older versions of GCC. - Remove some unused functions. v0.6.32 - 2021-12-11 - Fix a warning with Clang. v0.6.31 - 2021-08-22 - Fix a bug when loading from memory. v0.6.30 - 2021-08-16 - Silence some warnings. - Replace memory operations with DRMP3_* macros. v0.6.29 - 2021-08-08 - Bring up to date with minimp3. v0.6.28 - 2021-07-31 - Fix platform detection for ARM64. - Fix a compilation error with C89. v0.6.27 - 2021-02-21 - Fix a warning due to referencing _MSC_VER when it is undefined. v0.6.26 - 2021-01-31 - Bring up to date with minimp3. v0.6.25 - 2020-12-26 - Remove DRMP3_DEFAULT_CHANNELS and DRMP3_DEFAULT_SAMPLE_RATE which are leftovers from some removed APIs. v0.6.24 - 2020-12-07 - Fix a typo in version date for 0.6.23. v0.6.23 - 2020-12-03 - Fix an error where a file can be closed twice when initialization of the decoder fails. v0.6.22 - 2020-12-02 - Fix an error where it's possible for a file handle to be left open when initialization of the decoder fails. v0.6.21 - 2020-11-28 - Bring up to date with minimp3. v0.6.20 - 2020-11-21 - Fix compilation with OpenWatcom. v0.6.19 - 2020-11-13 - Minor code clean up. v0.6.18 - 2020-11-01 - Improve compiler support for older versions of GCC. v0.6.17 - 2020-09-28 - Bring up to date with minimp3. v0.6.16 - 2020-08-02 - Simplify sized types. v0.6.15 - 2020-07-25 - Fix a compilation warning. v0.6.14 - 2020-07-23 - Fix undefined behaviour with memmove(). v0.6.13 - 2020-07-06 - Fix a bug when converting from s16 to f32 in drmp3_read_pcm_frames_f32(). v0.6.12 - 2020-06-23 - Add include guard for the implementation section. v0.6.11 - 2020-05-26 - Fix use of uninitialized variable error. v0.6.10 - 2020-05-16 - Add compile-time and run-time version querying. - DRMP3_VERSION_MINOR - DRMP3_VERSION_MAJOR - DRMP3_VERSION_REVISION - DRMP3_VERSION_STRING - drmp3_version() - drmp3_version_string() v0.6.9 - 2020-04-30 - Change the `pcm` parameter of drmp3dec_decode_frame() to a `const drmp3_uint8*` for consistency with internal APIs. v0.6.8 - 2020-04-26 - Optimizations to decoding when initializing from memory. v0.6.7 - 2020-04-25 - Fix a compilation error with DR_MP3_NO_STDIO - Optimization to decoding by reducing some data movement. v0.6.6 - 2020-04-23 - Fix a minor bug with the running PCM frame counter. v0.6.5 - 2020-04-19 - Fix compilation error on ARM builds. v0.6.4 - 2020-04-19 - Bring up to date with changes to minimp3. v0.6.3 - 2020-04-13 - Fix some pedantic warnings. v0.6.2 - 2020-04-10 - Fix a crash in drmp3_open_*_and_read_pcm_frames_*() if the output config object is NULL. v0.6.1 - 2020-04-05 - Fix warnings. v0.6.0 - 2020-04-04 - API CHANGE: Remove the pConfig parameter from the following APIs: - drmp3_init() - drmp3_init_memory() - drmp3_init_file() - Add drmp3_init_file_w() for opening a file from a wchar_t encoded path. v0.5.6 - 2020-02-12 - Bring up to date with minimp3. v0.5.5 - 2020-01-29 - Fix a memory allocation bug in high level s16 decoding APIs. v0.5.4 - 2019-12-02 - Fix a possible null pointer dereference when using custom memory allocators for realloc(). v0.5.3 - 2019-11-14 - Fix typos in documentation. v0.5.2 - 2019-11-02 - Bring up to date with minimp3. v0.5.1 - 2019-10-08 - Fix a warning with GCC. v0.5.0 - 2019-10-07 - API CHANGE: Add support for user defined memory allocation routines. This system allows the program to specify their own memory allocation routines with a user data pointer for client-specific contextual data. This adds an extra parameter to the end of the following APIs: - drmp3_init() - drmp3_init_file() - drmp3_init_memory() - drmp3_open_and_read_pcm_frames_f32() - drmp3_open_and_read_pcm_frames_s16() - drmp3_open_memory_and_read_pcm_frames_f32() - drmp3_open_memory_and_read_pcm_frames_s16() - drmp3_open_file_and_read_pcm_frames_f32() - drmp3_open_file_and_read_pcm_frames_s16() - API CHANGE: Renamed the following APIs: - drmp3_open_and_read_f32() -> drmp3_open_and_read_pcm_frames_f32() - drmp3_open_and_read_s16() -> drmp3_open_and_read_pcm_frames_s16() - drmp3_open_memory_and_read_f32() -> drmp3_open_memory_and_read_pcm_frames_f32() - drmp3_open_memory_and_read_s16() -> drmp3_open_memory_and_read_pcm_frames_s16() - drmp3_open_file_and_read_f32() -> drmp3_open_file_and_read_pcm_frames_f32() - drmp3_open_file_and_read_s16() -> drmp3_open_file_and_read_pcm_frames_s16() v0.4.7 - 2019-07-28 - Fix a compiler error. v0.4.6 - 2019-06-14 - Fix a compiler error. v0.4.5 - 2019-06-06 - Bring up to date with minimp3. v0.4.4 - 2019-05-06 - Fixes to the VC6 build. v0.4.3 - 2019-05-05 - Use the channel count and/or sample rate of the first MP3 frame instead of DRMP3_DEFAULT_CHANNELS and DRMP3_DEFAULT_SAMPLE_RATE when they are set to 0. To use the old behaviour, just set the relevant property to DRMP3_DEFAULT_CHANNELS or DRMP3_DEFAULT_SAMPLE_RATE. - Add s16 reading APIs - drmp3_read_pcm_frames_s16 - drmp3_open_memory_and_read_pcm_frames_s16 - drmp3_open_and_read_pcm_frames_s16 - drmp3_open_file_and_read_pcm_frames_s16 - Add drmp3_get_mp3_and_pcm_frame_count() to the public header section. - Add support for C89. - Change license to choice of public domain or MIT-0. v0.4.2 - 2019-02-21 - Fix a warning. v0.4.1 - 2018-12-30 - Fix a warning. v0.4.0 - 2018-12-16 - API CHANGE: Rename some APIs: - drmp3_read_f32 -> to drmp3_read_pcm_frames_f32 - drmp3_seek_to_frame -> drmp3_seek_to_pcm_frame - drmp3_open_and_decode_f32 -> drmp3_open_and_read_pcm_frames_f32 - drmp3_open_and_decode_memory_f32 -> drmp3_open_memory_and_read_pcm_frames_f32 - drmp3_open_and_decode_file_f32 -> drmp3_open_file_and_read_pcm_frames_f32 - Add drmp3_get_pcm_frame_count(). - Add drmp3_get_mp3_frame_count(). - Improve seeking performance. v0.3.2 - 2018-09-11 - Fix a couple of memory leaks. - Bring up to date with minimp3. v0.3.1 - 2018-08-25 - Fix C++ build. v0.3.0 - 2018-08-25 - Bring up to date with minimp3. This has a minor API change: the "pcm" parameter of drmp3dec_decode_frame() has been changed from short* to void* because it can now output both s16 and f32 samples, depending on whether or not the DR_MP3_FLOAT_OUTPUT option is set. v0.2.11 - 2018-08-08 - Fix a bug where the last part of a file is not read. v0.2.10 - 2018-08-07 - Improve 64-bit detection. v0.2.9 - 2018-08-05 - Fix C++ build on older versions of GCC. - Bring up to date with minimp3. v0.2.8 - 2018-08-02 - Fix compilation errors with older versions of GCC. v0.2.7 - 2018-07-13 - Bring up to date with minimp3. v0.2.6 - 2018-07-12 - Bring up to date with minimp3. v0.2.5 - 2018-06-22 - Bring up to date with minimp3. v0.2.4 - 2018-05-12 - Bring up to date with minimp3. v0.2.3 - 2018-04-29 - Fix TCC build. v0.2.2 - 2018-04-28 - Fix bug when opening a decoder from memory. v0.2.1 - 2018-04-27 - Efficiency improvements when the decoder reaches the end of the stream. v0.2 - 2018-04-21 - Bring up to date with minimp3. - Start using major.minor.revision versioning. v0.1d - 2018-03-30 - Bring up to date with minimp3. v0.1c - 2018-03-11 - Fix C++ build error. v0.1b - 2018-03-07 - Bring up to date with minimp3. v0.1a - 2018-02-28 - Fix compilation error on GCC/Clang. - Fix some warnings. v0.1 - 2018-02-xx - Initial versioned release. */ /* This software is available as a choice of the following licenses. Choose whichever you prefer. =============================================================================== ALTERNATIVE 1 - Public Domain (www.unlicense.org) =============================================================================== This is free and unencumbered software released into the public domain. Anyone is free to copy, modify, publish, use, compile, sell, or distribute this software, either in source code form or as a compiled binary, for any purpose, commercial or non-commercial, and by any means. In jurisdictions that recognize copyright laws, the author or authors of this software dedicate any and all copyright interest in the software to the public domain. We make this dedication for the benefit of the public at large and to the detriment of our heirs and successors. We intend this dedication to be an overt act of relinquishment in perpetuity of all present and future rights to this software under copyright law. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. For more information, please refer to =============================================================================== ALTERNATIVE 2 - MIT No Attribution =============================================================================== Copyright 2023 David Reid Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. */ /* https://github.com/lieff/minimp3 To the extent possible under law, the author(s) have dedicated all copyright and related and neighboring rights to this software to the public domain worldwide. This software is distributed without any warranty. See . */ sdl12-compat-1.2.74/src/version.rc0000664000000000000000000000150715140471502013547 0ustar00#include LANGUAGE LANG_ENGLISH, SUBLANG_ENGLISH_US VS_VERSION_INFO VERSIONINFO FILEVERSION 1,2,74,0 PRODUCTVERSION 1,2,74,0 FILEFLAGSMASK 0x3fL FILEFLAGS 0x0L FILEOS 0x40004L FILETYPE 0x2L FILESUBTYPE 0x0L BEGIN BLOCK "StringFileInfo" BEGIN BLOCK "040904b0" BEGIN VALUE "CompanyName", "\0" VALUE "FileDescription", "SDL\0" VALUE "FileVersion", "1, 2, 74, 0\0" VALUE "InternalName", "SDL\0" VALUE "LegalCopyright", "Copyright (C) 2026 Sam Lantinga\0" VALUE "OriginalFilename", "SDL.dll\0" VALUE "ProductName", "Simple DirectMedia Layer 1.2 wrapper\0" VALUE "ProductVersion", "1, 2, 74, 0\0" END END BLOCK "VarFileInfo" BEGIN VALUE "Translation", 0x409, 1200 END END sdl12-compat-1.2.74/src/x86_msvc.h0000664000000000000000000004015015125533266013370 0ustar00/* Simple DirectMedia Layer Copyright (C) 1997-2026 Sam Lantinga This software is provided 'as-is', without any express or implied warranty. In no event will the authors be held liable for any damages arising from the use of this software. Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions: 1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required. 2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software. 3. This notice may not be removed or altered from any source distribution. */ /* taken from SDL_stdlib.c of SDL2 */ /* *INDENT-OFF* */ /* Float to long */ void __declspec(naked) _ftol() { __asm { push ebp mov ebp,esp sub esp,20h and esp,0FFFFFFF0h fld st(0) fst dword ptr [esp+18h] fistp qword ptr [esp+10h] fild qword ptr [esp+10h] mov edx,dword ptr [esp+18h] mov eax,dword ptr [esp+10h] test eax,eax je integer_QnaN_or_zero arg_is_not_integer_QnaN: fsubp st(1),st test edx,edx jns positive fstp dword ptr [esp] mov ecx,dword ptr [esp] xor ecx,80000000h add ecx,7FFFFFFFh adc eax,0 mov edx,dword ptr [esp+14h] adc edx,0 jmp localexit positive: fstp dword ptr [esp] mov ecx,dword ptr [esp] add ecx,7FFFFFFFh sbb eax,0 mov edx,dword ptr [esp+14h] sbb edx,0 jmp localexit integer_QnaN_or_zero: mov edx,dword ptr [esp+14h] test edx,7FFFFFFFh jne arg_is_not_integer_QnaN fstp dword ptr [esp+18h] fstp dword ptr [esp+18h] localexit: leave ret } } void _ftol2() { _ftol(); } void _ftol2_sse() { _ftol(); } /* 64-bit math operators for 32-bit systems */ void __declspec(naked) _allmul() { __asm { mov eax, dword ptr[esp+8] mov ecx, dword ptr[esp+10h] or ecx, eax mov ecx, dword ptr[esp+0Ch] jne hard mov eax, dword ptr[esp+4] mul ecx ret 10h hard: push ebx mul ecx mov ebx, eax mov eax, dword ptr[esp+8] mul dword ptr[esp+14h] add ebx, eax mov eax, dword ptr[esp+8] mul ecx add edx, ebx pop ebx ret 10h } } void __declspec(naked) _alldiv() { __asm { push edi push esi push ebx xor edi,edi mov eax,dword ptr [esp+14h] or eax,eax jge L1 inc edi mov edx,dword ptr [esp+10h] neg eax neg edx sbb eax,0 mov dword ptr [esp+14h],eax mov dword ptr [esp+10h],edx L1: mov eax,dword ptr [esp+1Ch] or eax,eax jge L2 inc edi mov edx,dword ptr [esp+18h] neg eax neg edx sbb eax,0 mov dword ptr [esp+1Ch],eax mov dword ptr [esp+18h],edx L2: or eax,eax jne L3 mov ecx,dword ptr [esp+18h] mov eax,dword ptr [esp+14h] xor edx,edx div ecx mov ebx,eax mov eax,dword ptr [esp+10h] div ecx mov edx,ebx jmp L4 L3: mov ebx,eax mov ecx,dword ptr [esp+18h] mov edx,dword ptr [esp+14h] mov eax,dword ptr [esp+10h] L5: shr ebx,1 rcr ecx,1 shr edx,1 rcr eax,1 or ebx,ebx jne L5 div ecx mov esi,eax mul dword ptr [esp+1Ch] mov ecx,eax mov eax,dword ptr [esp+18h] mul esi add edx,ecx jb L6 cmp edx,dword ptr [esp+14h] ja L6 jb L7 cmp eax,dword ptr [esp+10h] jbe L7 L6: dec esi L7: xor edx,edx mov eax,esi L4: dec edi jne L8 neg edx neg eax sbb edx,0 L8: pop ebx pop esi pop edi ret 10h } } void __declspec(naked) _aulldiv() { __asm { push ebx push esi mov eax,dword ptr [esp+18h] or eax,eax jne L1 mov ecx,dword ptr [esp+14h] mov eax,dword ptr [esp+10h] xor edx,edx div ecx mov ebx,eax mov eax,dword ptr [esp+0Ch] div ecx mov edx,ebx jmp L2 L1: mov ecx,eax mov ebx,dword ptr [esp+14h] mov edx,dword ptr [esp+10h] mov eax,dword ptr [esp+0Ch] L3: shr ecx,1 rcr ebx,1 shr edx,1 rcr eax,1 or ecx,ecx jne L3 div ebx mov esi,eax mul dword ptr [esp+18h] mov ecx,eax mov eax,dword ptr [esp+14h] mul esi add edx,ecx jb L4 cmp edx,dword ptr [esp+10h] ja L4 jb L5 cmp eax,dword ptr [esp+0Ch] jbe L5 L4: dec esi L5: xor edx,edx mov eax,esi L2: pop esi pop ebx ret 10h } } void __declspec(naked) _allrem() { __asm { push ebx push edi xor edi,edi mov eax,dword ptr [esp+10h] or eax,eax jge L1 inc edi mov edx,dword ptr [esp+0Ch] neg eax neg edx sbb eax,0 mov dword ptr [esp+10h],eax mov dword ptr [esp+0Ch],edx L1: mov eax,dword ptr [esp+18h] or eax,eax jge L2 mov edx,dword ptr [esp+14h] neg eax neg edx sbb eax,0 mov dword ptr [esp+18h],eax mov dword ptr [esp+14h],edx L2: or eax,eax jne L3 mov ecx,dword ptr [esp+14h] mov eax,dword ptr [esp+10h] xor edx,edx div ecx mov eax,dword ptr [esp+0Ch] div ecx mov eax,edx xor edx,edx dec edi jns L4 jmp L8 L3: mov ebx,eax mov ecx,dword ptr [esp+14h] mov edx,dword ptr [esp+10h] mov eax,dword ptr [esp+0Ch] L5: shr ebx,1 rcr ecx,1 shr edx,1 rcr eax,1 or ebx,ebx jne L5 div ecx mov ecx,eax mul dword ptr [esp+18h] xchg eax,ecx mul dword ptr [esp+14h] add edx,ecx jb L6 cmp edx,dword ptr [esp+10h] ja L6 jb L7 cmp eax,dword ptr [esp+0Ch] jbe L7 L6: sub eax,dword ptr [esp+14h] sbb edx,dword ptr [esp+18h] L7: sub eax,dword ptr [esp+0Ch] sbb edx,dword ptr [esp+10h] dec edi jns L8 L4: neg edx neg eax sbb edx,0 L8: pop edi pop ebx ret 10h } } void __declspec(naked) _aullrem() { __asm { push ebx mov eax,dword ptr [esp+14h] or eax,eax jne L1 mov ecx,dword ptr [esp+10h] mov eax,dword ptr [esp+0Ch] xor edx,edx div ecx mov eax,dword ptr [esp+8] div ecx mov eax,edx xor edx,edx jmp L2 L1: mov ecx,eax mov ebx,dword ptr [esp+10h] mov edx,dword ptr [esp+0Ch] mov eax,dword ptr [esp+8] L3: shr ecx,1 rcr ebx,1 shr edx,1 rcr eax,1 or ecx,ecx jne L3 div ebx mov ecx,eax mul dword ptr [esp+14h] xchg eax,ecx mul dword ptr [esp+10h] add edx,ecx jb L4 cmp edx,dword ptr [esp+0Ch] ja L4 jb L5 cmp eax,dword ptr [esp+8] jbe L5 L4: sub eax,dword ptr [esp+10h] sbb edx,dword ptr [esp+14h] L5: sub eax,dword ptr [esp+8] sbb edx,dword ptr [esp+0Ch] neg edx neg eax sbb edx,0 L2: pop ebx ret 10h } } void __declspec(naked) _alldvrm() { __asm { push edi push esi push ebp xor edi,edi xor ebp,ebp mov eax,dword ptr [esp+14h] or eax,eax jge L1 inc edi inc ebp mov edx,dword ptr [esp+10h] neg eax neg edx sbb eax,0 mov dword ptr [esp+14h],eax mov dword ptr [esp+10h],edx L1: mov eax,dword ptr [esp+1Ch] or eax,eax jge L2 inc edi mov edx,dword ptr [esp+18h] neg eax neg edx sbb eax,0 mov dword ptr [esp+1Ch],eax mov dword ptr [esp+18h],edx L2: or eax,eax jne L3 mov ecx,dword ptr [esp+18h] mov eax,dword ptr [esp+14h] xor edx,edx div ecx mov ebx,eax mov eax,dword ptr [esp+10h] div ecx mov esi,eax mov eax,ebx mul dword ptr [esp+18h] mov ecx,eax mov eax,esi mul dword ptr [esp+18h] add edx,ecx jmp L4 L3: mov ebx,eax mov ecx,dword ptr [esp+18h] mov edx,dword ptr [esp+14h] mov eax,dword ptr [esp+10h] L5: shr ebx,1 rcr ecx,1 shr edx,1 rcr eax,1 or ebx,ebx jne L5 div ecx mov esi,eax mul dword ptr [esp+1Ch] mov ecx,eax mov eax,dword ptr [esp+18h] mul esi add edx,ecx jb L6 cmp edx,dword ptr [esp+14h] ja L6 jb L7 cmp eax,dword ptr [esp+10h] jbe L7 L6: dec esi sub eax,dword ptr [esp+18h] sbb edx,dword ptr [esp+1Ch] L7: xor ebx,ebx L4: sub eax,dword ptr [esp+10h] sbb edx,dword ptr [esp+14h] dec ebp jns L9 neg edx neg eax sbb edx,0 L9: mov ecx,edx mov edx,ebx mov ebx,ecx mov ecx,eax mov eax,esi dec edi jne L8 neg edx neg eax sbb edx,0 L8: pop ebp pop esi pop edi ret 10h } } void __declspec(naked) _aulldvrm() { __asm { push esi mov eax,dword ptr [esp+14h] or eax,eax jne L1 mov ecx,dword ptr [esp+10h] mov eax,dword ptr [esp+0Ch] xor edx,edx div ecx mov ebx,eax mov eax,dword ptr [esp+8] div ecx mov esi,eax mov eax,ebx mul dword ptr [esp+10h] mov ecx,eax mov eax,esi mul dword ptr [esp+10h] add edx,ecx jmp L2 L1: mov ecx,eax mov ebx,dword ptr [esp+10h] mov edx,dword ptr [esp+0Ch] mov eax,dword ptr [esp+8] L3: shr ecx,1 rcr ebx,1 shr edx,1 rcr eax,1 or ecx,ecx jne L3 div ebx mov esi,eax mul dword ptr [esp+14h] mov ecx,eax mov eax,dword ptr [esp+10h] mul esi add edx,ecx jb L4 cmp edx,dword ptr [esp+0Ch] ja L4 jb L5 cmp eax,dword ptr [esp+8] jbe L5 L4: dec esi sub eax,dword ptr [esp+10h] sbb edx,dword ptr [esp+14h] L5: xor ebx,ebx L2: sub eax,dword ptr [esp+8] sbb edx,dword ptr [esp+0Ch] neg edx neg eax sbb edx,0 mov ecx,edx mov edx,ebx mov ebx,ecx mov ecx,eax mov eax,esi pop esi ret 10h } } void __declspec(naked) _allshl() { __asm { cmp cl,40h jae RETZERO cmp cl,20h jae MORE32 shld edx,eax,cl shl eax,cl ret MORE32: mov edx,eax xor eax,eax and cl,1Fh shl edx,cl ret RETZERO: xor eax,eax xor edx,edx ret } } void __declspec(naked) _allshr() { __asm { cmp cl,3Fh jae RETSIGN cmp cl,20h jae MORE32 shrd eax,edx,cl sar edx,cl ret MORE32: mov eax,edx sar edx,1Fh and cl,1Fh sar eax,cl ret RETSIGN: sar edx,1Fh mov eax,edx ret } } void __declspec(naked) _aullshr() { __asm { cmp cl,40h jae RETZERO cmp cl,20h jae MORE32 shrd eax,edx,cl shr edx,cl ret MORE32: mov eax,edx xor edx,edx and cl,1Fh shr eax,cl ret RETZERO: xor eax,eax xor edx,edx ret } } /* *INDENT-ON* */ /* vi: set ts=4 sw=4 expandtab: */ sdl12-compat-1.2.74/test/CMakeLists.txt0000664000000000000000000001055715100671041014465 0ustar00cmake_minimum_required(VERSION 3.0.0...4.0) project(sdl12_compat_tests C) if(NOT TARGET SDL::SDL) find_package(SDL REQUIRED) endif() if(NOT TARGET SDL::SDLmain) add_library(SDL::SDLmain STATIC IMPORTED) if(SDLMAIN_LIBRARY) message("SDLMAIN_LIBRARY=${SDLMAIN_LIBRARY}") set_property(TARGET SDL::SDLmain PROPERTY IMPORTED_LOCATION "${SDLMAIN_LIBRARY}") endif() if(MINGW OR CYGWIN) if(CMAKE_SIZEOF_VOID_P EQUAL 4) set_property(TARGET SDL::SDLmain APPEND INTERFACE_LINK_LIBRARIES "$<$,EXECUTABLE>:-Wl,--undefined=_WinMain@16>") else() set_property(TARGET SDL::SDLmain APPEND INTERFACE_LINK_LIBRARIES "$<$,EXECUTABLE>:-Wl,--undefined=WinMain>") endif() endif() endif() option(SDL12COMPAT_INSTALL_TESTS "Install manual tests into libexecdir" OFF) set(SDL12COMPAT_TEST_EXECUTABLES) set(SDL12COMPAT_TEST_RESOURCE_FILES) if(NOT (WIN32 OR APPLE OR CYGWIN OR HAIKU OR BEOS)) find_library(MATH_LIBRARY m) endif() find_package(OpenGL COMPONENTS OpenGL) if(OPENGL_FOUND) set(HAVE_OPENGL_DEFINE "HAVE_OPENGL") if(WIN32) set(OPENGL_gl_LIBRARY "opengl32") set(OPENGL_opengl_LIBRARY "opengl32") elseif(APPLE) set(OPENGL_gl_LIBRARY "-Wl,-framework,OpenGL") set(OPENGL_opengl_LIBRARY "-Wl,-framework,OpenGL") endif() endif() macro(test_program _NAME _SRCS) add_executable(${_NAME} ${_SRCS}) list(APPEND SDL12COMPAT_TEST_EXECUTABLES ${_NAME}) target_include_directories(${_NAME} PRIVATE "include/SDL") target_link_libraries(${_NAME} PRIVATE SDL::SDLmain SDL::SDL) # Turn off MSVC's aggressive C runtime warnings for the old test programs. if(MSVC) set_target_properties(${_NAME} PROPERTIES COMPILE_DEFINITIONS "${HAVE_OPENGL_DEFINE};_CRT_SECURE_NO_WARNINGS;_CRT_SECURE_NO_DEPRECATE;_CRT_NONSTDC_NO_DEPRECATE") elseif(APPLE) set_target_properties(${_NAME} PROPERTIES COMPILE_DEFINITIONS "${HAVE_OPENGL_DEFINE};GL_SILENCE_DEPRECATION=1") target_link_libraries(${_NAME} PRIVATE "-Wl,-framework,Cocoa") else() set_target_properties(${_NAME} PROPERTIES COMPILE_DEFINITIONS "${HAVE_OPENGL_DEFINE}") endif() if(MATH_LIBRARY) target_link_libraries(${_NAME} PRIVATE ${MATH_LIBRARY}) endif() endmacro() test_program(checkkeys "checkkeys.c") test_program(graywin "graywin.c") test_program(loopwave "loopwave.c") test_program(testalpha "testalpha.c") test_program(testbitmap "testbitmap.c") test_program(testblitspeed "testblitspeed.c") test_program(testcdrom "testcdrom.c") test_program(testcursor "testcursor.c") test_program(testerror "testerror.c") test_program(testfile "testfile.c") test_program(testgamma "testgamma.c") test_program(testthread "testthread.c") test_program(testiconv "testiconv.c") test_program(testjoystick "testjoystick.c") test_program(testkeys "testkeys.c") test_program(testloadso "testloadso.c") test_program(testlock "testlock.c") test_program(testoverlay "testoverlay.c") test_program(testoverlay2 "testoverlay2.c") test_program(testpalette "testpalette.c") test_program(testplatform "testplatform.c") test_program(testsem "testsem.c") test_program(testsprite "testsprite.c") test_program(testtimer "testtimer.c") test_program(testver "testver.c") test_program(testvidinfo "testvidinfo.c") test_program(testwin "testwin.c") test_program(testwm "testwm.c") test_program(threadwin "threadwin.c") test_program(torturethread "torturethread.c") test_program(testdyngl "testdyngl.c") test_program(testgl "testgl.c") if(OPENGL_FOUND) if(CMAKE_VERSION VERSION_LESS 3.10 OR NOT OPENGL_opengl_LIBRARY) target_link_libraries(testgl PRIVATE ${OPENGL_gl_LIBRARY}) else() target_link_libraries(testgl PRIVATE ${OPENGL_opengl_LIBRARY}) endif() endif() foreach(fname "icon.bmp" "moose.dat" "picture.xbm" "sail.bmp" "sample.bmp" "sample.wav" "utf8.txt") file(COPY "${CMAKE_CURRENT_SOURCE_DIR}/${fname}" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}") list(APPEND SDL12COMPAT_TEST_RESOURCE_FILES "${fname}") endforeach(fname) if(SDL12COMPAT_INSTALL_TESTS) install( TARGETS ${SDL12COMPAT_TEST_EXECUTABLES} DESTINATION ${CMAKE_INSTALL_LIBEXECDIR}/installed-tests/SDL12_compat ) install( FILES ${SDL12COMPAT_TEST_RESOURCE_FILES} DESTINATION ${CMAKE_INSTALL_LIBEXECDIR}/installed-tests/SDL12_compat ) endif() sdl12-compat-1.2.74/test/COPYING0000664000000000000000000000032212115006433012745 0ustar00 The test programs in this directory tree are for demonstrating and testing the functionality of the SDL library, and are placed in the public domain. October 28, 1997 -- Sam Lantinga (slouken@libsdl.org) sdl12-compat-1.2.74/test/Makefile.os20000664000000000000000000000214114313606634014070 0ustar00TARGETS = checkkeys.exe graywin.exe loopwave.exe testalpha.exe testbitmap.exe & testblitspeed.exe testcdrom.exe testcursor.exe testdyngl.exe & testerror.exe testfile.exe testgamma.exe testgl.exe testthread.exe & testiconv.exe testjoystick.exe testkeys.exe testlock.exe & testoverlay2.exe testoverlay.exe testpalette.exe testplatform.exe & testsem.exe testsprite.exe testtimer.exe testver.exe testvidinfo.exe & testwin.exe testwm.exe threadwin.exe torturethread.exe testloadso.exe OBJS = $(TARGETS:.exe=.obj) all: $(TARGETS) BINPATH = . INCPATH = -I"$(%WATCOM)/h/os2" -I"$(%WATCOM)/h" -I"../include/SDL" CFLAGS_DEF = $(INCPATH) -bt=os2 -d0 -q -bm -5s -fp5 -fpi87 -sg -oteanbmier CFLAGS_EXE = $(CFLAGS_DEF) CFLAGS = $(CFLAGS_EXE) -ei -5s LIBPATH = ../src LIBS = SDL12.lib .obj.exe: wlink SYS os2v2 libpath $(LIBPATH) lib {$(LIBS)} op q file {$<} name $* .c.obj: wcc386 $(CFLAGS) -fo=$^@ $< clean: .SYMBOLIC @echo * Clean tests in $(BINPATH) @if exist *.obj rm *.obj @if exist *.err rm *.err distclean: clean .SYMBOLIC @if exist *.exe rm *.exe sdl12-compat-1.2.74/test/Makefile.w320000664000000000000000000000217414313606634014006 0ustar00TARGETS = checkkeys.exe graywin.exe loopwave.exe testalpha.exe testbitmap.exe & testblitspeed.exe testcdrom.exe testcursor.exe testdyngl.exe & testerror.exe testfile.exe testgamma.exe testgl.exe testthread.exe & testiconv.exe testjoystick.exe testkeys.exe testlock.exe & testoverlay2.exe testoverlay.exe testpalette.exe testplatform.exe & testsem.exe testsprite.exe testtimer.exe testver.exe testvidinfo.exe & testwin.exe testwm.exe threadwin.exe torturethread.exe testloadso.exe OBJS = $(TARGETS:.exe=.obj) all: $(TARGETS) BINPATH = . INCPATH = -I"$(%WATCOM)/h/nt" -I"$(%WATCOM)/h" -I"../include/SDL" CFLAGS_DEF = $(INCPATH) -bt=nt -d0 -q -bm -5s -fp5 -fpi87 -sg -oteanbmier CFLAGS_EXE = $(CFLAGS_DEF) CFLAGS = $(CFLAGS_EXE) -ei -5s LIBPATH = ../src LIBS = SDL.lib LIBF = SDLmain.lib .obj.exe: wlink SYS nt libpath $(LIBPATH) libf {$(LIBF)} lib {$(LIBS)} op q file {$<} name $* .c.obj: wcc386 $(CFLAGS) -fo=$^@ $< clean: .SYMBOLIC @echo * Clean tests in $(BINPATH) @if exist *.obj rm *.obj @if exist *.err rm *.err distclean: clean .SYMBOLIC @if exist *.exe rm *.exe sdl12-compat-1.2.74/test/README0000664000000000000000000000324014306422044012600 0ustar00 These are test programs for the SDL library: checkkeys Watch the key events to check the keyboard graywin Display a gray gradient and center mouse on spacebar loopwave Audio test -- loop playing a WAV file testalpha Display an alpha faded icon -- paint with mouse testbitmap Test displaying 1-bit bitmaps testblitspeed Tests performance of SDL's blitters and converters. testcdrom Sample audio CD control program testcursor Tests custom mouse cursor testdyngl Tests dynamically loading OpenGL library testerror Tests multi-threaded error handling testfile Tests RWops layer testgamma Tests video device gamma ramp testgl A very simple example of using OpenGL with SDL testiconv Tests international string conversion testjoystick List joysticks and watch joystick events testkeys List the available keyboard keys testloadso Tests the loadable library layer testlock Hacked up test of multi-threading and locking testoverlay Tests the software/hardware overlay functionality. testoverlay2 Tests the overlay flickering/scaling during playback. testpalette Tests palette color cycling testplatform Tests types, endianness and cpu capabilities testsem Tests SDL's semaphore implementation testsprite Example of fast sprite movement on the screen testthread Hacked up test of multi-threading testtimer Test the timer facilities testver Check the version and dynamic loading and endianness testvidinfo Show the pixel format of the display and perfom the benchmark testwin Display a BMP image at various depths testwm Test window manager -- title, icon, events threadwin Test multi-threaded event handling torturethread Simple test for thread creation/destruction sdl12-compat-1.2.74/test/checkkeys.c0000664000000000000000000000713614313410104014035 0ustar00 /* Simple program: Loop, watching keystrokes Note that you need to call SDL_PollEvent() or SDL_WaitEvent() to pump the event loop and catch keystrokes. */ #include #include #include #include "SDL.h" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } static void print_modifiers(void) { int mod; printf(" modifiers:"); mod = SDL_GetModState(); if(!mod) { printf(" (none)"); return; } if(mod & KMOD_LSHIFT) printf(" LSHIFT"); if(mod & KMOD_RSHIFT) printf(" RSHIFT"); if(mod & KMOD_LCTRL) printf(" LCTRL"); if(mod & KMOD_RCTRL) printf(" RCTRL"); if(mod & KMOD_LALT) printf(" LALT"); if(mod & KMOD_RALT) printf(" RALT"); if(mod & KMOD_LMETA) printf(" LMETA"); if(mod & KMOD_RMETA) printf(" RMETA"); if(mod & KMOD_NUM) printf(" NUM"); if(mod & KMOD_CAPS) printf(" CAPS"); if(mod & KMOD_MODE) printf(" MODE"); } static void PrintKey(SDL_keysym *sym, int pressed) { /* Print the keycode, name and state */ if ( sym->sym ) { printf("Key %s: %d-%s (scancode = %d [0x%x])", pressed ? "pressed" : "released", sym->sym, SDL_GetKeyName(sym->sym), sym->scancode, sym->scancode); } else { printf("Unknown Key (scancode = %d [0x%x]) %s ", sym->scancode, sym->scancode, pressed ? "pressed" : "released"); } /* Print the translated character, if one exists */ if ( sym->unicode ) { /* Is it a control-character? */ if ( sym->unicode < ' ' ) { printf(" (^%c)", sym->unicode+'@'); } else { #ifdef UNICODE printf(" '%c' (0x%.4X)", sym->unicode, (int)sym->unicode); #elif defined(_WIN32) || defined(__OS2__) /* This is a Latin-1 program, so only show 8-bits */ if ( !(sym->unicode & 0xFF00) ) printf(" '%c' (0x%.4X)", sym->unicode, (int)sym->unicode); else printf(" (0x%.4X)", (int)sym->unicode); #else /* other platforms than Windows hopefully use UTF-8 for 8bit chars */ const char* utf32type = (SDL_BYTEORDER == SDL_LIL_ENDIAN) ? "UTF-32LE" : "UTF-32BE"; char* utf8str; Uint32 utf32str[2]; utf32str[0] = sym->unicode; utf32str[1] = 0; utf8str = SDL_iconv_string("UTF-8", utf32type, (const char*)utf32str, 2*4); printf(" '%s' (0x%.4X)", utf8str, (int)sym->unicode); SDL_free(utf8str); #endif } } print_modifiers(); printf("\n"); } int main(int argc, char *argv[]) { SDL_Event event; int done; Uint32 videoflags; /* Initialize SDL */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } videoflags = SDL_SWSURFACE; while( argc > 1 ) { --argc; if ( argv[argc] && !strcmp(argv[argc], "-fullscreen") ) { videoflags |= SDL_FULLSCREEN; } else { fprintf(stderr, "Usage: %s [-fullscreen]\n", argv[0]); quit(1); } } /* Set 640x480 video mode */ if ( SDL_SetVideoMode(640, 480, 0, videoflags) == NULL ) { fprintf(stderr, "Couldn't set 640x480 video mode: %s\n", SDL_GetError()); quit(2); } /* Enable UNICODE translation for keyboard input */ SDL_EnableUNICODE(1); /* Enable auto repeat for keyboard input */ SDL_EnableKeyRepeat(SDL_DEFAULT_REPEAT_DELAY, SDL_DEFAULT_REPEAT_INTERVAL); /* Watch keystrokes */ done = 0; while ( !done ) { /* Check for events */ SDL_WaitEvent(&event); switch (event.type) { case SDL_KEYDOWN: PrintKey(&event.key.keysym, 1); break; case SDL_KEYUP: PrintKey(&event.key.keysym, 0); break; case SDL_MOUSEBUTTONDOWN: /* Any button press quits the app... */ case SDL_QUIT: done = 1; break; default: break; } } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/graywin.c0000664000000000000000000001462314055566242013565 0ustar00 /* Simple program: Fill a colormap with gray and stripe it down the screen */ #include #include #include #include #include "SDL.h" #ifdef TEST_VGA16 /* Define this if you want to test VGA 16-color video modes */ #define NUM_COLORS 16 #else #define NUM_COLORS 256 #endif /* Draw a randomly sized and colored box centered about (X,Y) */ void DrawBox(SDL_Surface *screen, int X, int Y, int width, int height) { static unsigned int seeded = 0; SDL_Rect area; Uint32 color; Uint32 randc; /* Seed the random number generator */ if ( seeded == 0 ) { srand((unsigned int) time(NULL)); seeded = 1; } /* Get the bounds of the rectangle */ area.w = (rand()%width); area.h = (rand()%height); area.x = X-(area.w/2); area.y = Y-(area.h/2); randc = (rand()%NUM_COLORS); if (screen->format->BytesPerPixel==1) { color = randc; } else { color = SDL_MapRGB(screen->format, randc, randc, randc); } /* Do it! */ SDL_FillRect(screen, &area, color); if ( screen->flags & SDL_DOUBLEBUF ) { SDL_Flip(screen); } else { SDL_UpdateRects(screen, 1, &area); } } void DrawBackground(SDL_Surface *screen) { int i, j, k; Uint8 *buffer; Uint16 *buffer16; Uint16 color; Uint8 gradient; /* Set the surface pixels and refresh! */ /* Use two loops in case the surface is double-buffered (both sides) */ for ( j=0; j<2; ++j ) { if ( SDL_LockSurface(screen) < 0 ) { fprintf(stderr, "Couldn't lock display surface: %s\n", SDL_GetError()); return; } buffer = (Uint8 *)screen->pixels; if (screen->format->BytesPerPixel!=2) { for ( i=0; ih; ++i ) { memset(buffer,(i*(NUM_COLORS-1))/screen->h, screen->w * screen->format->BytesPerPixel); buffer += screen->pitch; } } else { for ( i=0; ih; ++i ) { gradient=((i*(NUM_COLORS-1))/screen->h); color = SDL_MapRGB(screen->format, gradient, gradient, gradient); buffer16=(Uint16*)buffer; for (k=0; kw; k++) { *(buffer16+k)=color; } buffer += screen->pitch; } } SDL_UnlockSurface(screen); if ( screen->flags & SDL_DOUBLEBUF ) { SDL_Flip(screen); } else { SDL_UpdateRect(screen, 0, 0, 0, 0); break; } } } SDL_Surface *CreateScreen(Uint16 w, Uint16 h, Uint8 bpp, Uint32 flags) { SDL_Surface *screen; int i; SDL_Color palette[NUM_COLORS]; /* Set the video mode */ screen = SDL_SetVideoMode(w, h, bpp, flags); if ( screen == NULL ) { fprintf(stderr, "Couldn't set display mode: %s\n", SDL_GetError()); return(NULL); } fprintf(stderr, "Screen is in %s mode\n", (screen->flags & SDL_FULLSCREEN) ? "fullscreen" : "windowed"); if (bpp==8) { /* Set a gray colormap, reverse order from white to black */ for ( i=0; i 1 ) { --argc; if ( argv[argc-1] && (strcmp(argv[argc-1], "-width") == 0) ) { width = atoi(argv[argc]); --argc; } else if ( argv[argc-1] && (strcmp(argv[argc-1], "-height") == 0) ) { height = atoi(argv[argc]); --argc; } else if ( argv[argc-1] && (strcmp(argv[argc-1], "-bpp") == 0) ) { bpp = atoi(argv[argc]); --argc; } else if ( argv[argc] && (strcmp(argv[argc], "-hw") == 0) ) { videoflags |= SDL_HWSURFACE; } else if ( argv[argc] && (strcmp(argv[argc], "-hwpalette") == 0) ) { videoflags |= SDL_HWPALETTE; } else if ( argv[argc] && (strcmp(argv[argc], "-flip") == 0) ) { videoflags |= SDL_DOUBLEBUF; } else if ( argv[argc] && (strcmp(argv[argc], "-noframe") == 0) ) { videoflags |= SDL_NOFRAME; } else if ( argv[argc] && (strcmp(argv[argc], "-resize") == 0) ) { videoflags |= SDL_RESIZABLE; } else if ( argv[argc] && (strcmp(argv[argc], "-fullscreen") == 0) ) { videoflags |= SDL_FULLSCREEN; } else { fprintf(stderr, "Usage: %s [-width] [-height] [-bpp] [-hw] [-hwpalette] [-flip] [-noframe] [-fullscreen] [-resize]\n", argv[0]); exit(1); } } /* Set a video mode */ screen = CreateScreen(width, height, bpp, videoflags); if ( screen == NULL ) { exit(2); } DrawBackground(screen); /* Wait for a keystroke */ done = 0; while ( !done && SDL_WaitEvent(&event) ) { switch (event.type) { case SDL_MOUSEBUTTONDOWN: DrawBox(screen, event.button.x, event.button.y, width, height); break; case SDL_KEYDOWN: /* Ignore ALT-TAB for windows */ if ( (event.key.keysym.sym == SDLK_LALT) || (event.key.keysym.sym == SDLK_TAB) ) { break; } /* Center the mouse on */ if ( event.key.keysym.sym == SDLK_SPACE ) { SDL_WarpMouse(width/2, height/2); break; } /* Toggle fullscreen mode on */ if ( event.key.keysym.sym == SDLK_RETURN ) { videoflags ^= SDL_FULLSCREEN; screen = CreateScreen( screen->w, screen->h, screen->format->BitsPerPixel, videoflags); if ( screen == NULL ) { fprintf(stderr, "Couldn't toggle fullscreen mode\n"); done = 1; } DrawBackground(screen); break; } /* Any other key quits the application... */ case SDL_QUIT: done = 1; break; case SDL_VIDEOEXPOSE: DrawBackground(screen); break; case SDL_VIDEORESIZE: screen = CreateScreen( event.resize.w, event.resize.h, screen->format->BitsPerPixel, videoflags); if ( screen == NULL ) { fprintf(stderr, "Couldn't resize video mode\n"); done = 1; } DrawBackground(screen); break; default: break; } } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/icon.bmp0000664000000000000000000000110212115006433013337 0ustar00BMBB( m m """""!"!!""!""""!""""""""!""""""""""""""!""""""""!""""""""""""""""""""""""""""""""""""""""!""""""""!""""""""""""""!""""""""""sdl12-compat-1.2.74/test/loopwave.c0000664000000000000000000000445614146017246013740 0ustar00 /* Program to load a wave file and loop playing it using SDL sound */ /* loopwaves.c is much more robust in handling WAVE files -- This is only for simple WAVEs */ #include "SDL_config.h" #include #include #if HAVE_SIGNAL_H #include #endif #include "SDL.h" #include "SDL_audio.h" struct { SDL_AudioSpec spec; Uint8 *sound; /* Pointer to wave data */ Uint32 soundlen; /* Length of wave data */ int soundpos; /* Current play position */ } wave; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } void SDLCALL fillerup(void *unused, Uint8 *stream, int len) { Uint8 *waveptr; int waveleft; /* Set up the pointers */ waveptr = wave.sound + wave.soundpos; waveleft = wave.soundlen - wave.soundpos; /* Go! */ while ( waveleft <= len ) { SDL_memcpy(stream, waveptr, waveleft); stream += waveleft; len -= waveleft; waveptr = wave.sound; waveleft = wave.soundlen; wave.soundpos = 0; } SDL_memcpy(stream, waveptr, len); wave.soundpos += len; } static int done = 0; void poked(int sig) { done = 1; } int main(int argc, char *argv[]) { char name[32]; const char *file; /* Load the SDL library */ if ( SDL_Init(SDL_INIT_AUDIO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } file = (argc < 2) ? "sample.wav" : argv[1]; /* Load the wave file into memory */ if ( SDL_LoadWAV(file, &wave.spec, &wave.sound, &wave.soundlen) == NULL ) { fprintf(stderr, "Couldn't load %s: %s\n", file, SDL_GetError()); quit(1); } wave.spec.callback = fillerup; #if HAVE_SIGNAL_H /* Set the signals */ #ifdef SIGHUP signal(SIGHUP, poked); #endif signal(SIGINT, poked); #ifdef SIGQUIT signal(SIGQUIT, poked); #endif signal(SIGTERM, poked); #endif /* HAVE_SIGNAL_H */ /* Initialize fillerup() variables */ if ( SDL_OpenAudio(&wave.spec, NULL) < 0 ) { fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError()); SDL_FreeWAV(wave.sound); quit(2); } SDL_PauseAudio(0); /* Let the audio run */ printf("Using audio driver: %s\n", SDL_AudioDriverName(name, 32)); while ( ! done && (SDL_GetAudioStatus() == SDL_AUDIO_PLAYING) ) SDL_Delay(1000); /* Clean up on signal */ SDL_CloseAudio(); SDL_FreeWAV(wave.sound); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/moose.dat0000664000000000000000000015600012115006433013533 0ustar00  0&<&*6&#0*"00&6<*#*6<0 0<*<0&0A0&*6<*#6A<0<0&&CB98HQ%F=## 1OQQQL=B@9BHMLL=$ # =IQQQL=BCLMQL8, # EMQQQMMQLMQOI@1 # 8QQQQOQQQQQOB8$$LQQQQQQQQOF8)  1LOOQQQQLH8)  8IIOQQLB+ $   8ELOQOE1  0#-FMQQH=+   0# 2LQQMI=+  *& @OQOOE7 +1 *<7EOMLE+ 7=,6=HOE71711=H7!$+8825!%.8IEB!%17+7@I-55$%%+7=87+1=B=$$%17+=IF-553(,%8@.$-2FB8+188%!)78=IF-5555,,(%57%$:52BF@=78%)8=HF-5555--,,%55)%::52=HB=7%%7=F=555555--,5:5):::5-=781$$)8=255::552-%,::5::::52=1%,7855:::52-,55::::::52%!)15:::552,%,55:::::5-2!,-5:5552,%,55:::552(!$-55552,(2555552-($255-,,2552--(%,2-,,%,,,,%$(,%,%%"&&00*6<& 06*6A<&6A0#006A6*0A0&0A06A* *6A6*&0A0#&<0&0A060&6#*6A<0+  7C-D7>C:/(-  .+   GDJ = J;5  '   9RR+ PJ+  7+7DRJ;B;JPD%5C!   CJ9+HJ;CHC;DB-:D5#7;D:=HIHIIICH:;%#  %B;9B:9IIH99H-:* '95HHB:I9=IE:  #!->CIIFIHIE=:% #0 HM9GHCIIIIH==:-=7##7CQBBHHIII==:2==-&HO'M@@HHI=@:-B%H%0 +H@%M9=@HI@95+H%C90 'HQSH:@@@=<-HMH@ &# 7CMOC795.-=IM= ##IMSOOIMQMIMQMH#7HOSQMQOSOOSM9'=OOQOSOQOSMH' 9HQSMSOOIMC: +@MQSOSM979+-MMSOOI$++GSOSOM: #9OSMSMC+&-MOSOSH.*COSOMM+  7IOMOB   .HMC'   7% =.  %'=='%.7%7H=7!%.79)7HE9'+:E7(++:=9+.EC7+7 7=E=+9: +:H97+ +7% +:@=7. '+9+ +7:E7++:+%+7B.%'- +7+79B7'+: +%+7%  7C: %:++ !:+% ++G@9)) 79:7%  '+BB7''97+%  '+7B.+ 6*06026*0<0#<6&0<0#020&<00<6*02006A<06&&&666&0A<0&)+@CC979G9.7GH@9'9?BC9) 7=C=:9-'99BG>5. +-+'+7'!')97+ '+( 1977+' !%! )%'+79(+= %9+'!  !+- .9(. 9+% '7=7.+  )+%!''.C') '% ''7:!  !0<0060#0<0660<0&A<&0<006A0S-OC%((   +:+   9C;>C-;7- +=7.%-++=7% 7HJ)D9:# #%79( (5-+ +97  +GR1PH-# +-'79-2+ -2-+2 +:  &+ @JP;:;RJB%%H  #7%7@27- (-(-5--+:+72P@+HI;=C=;I9%-J2 7.=2--. %275%555--9:+-;R=@HIIIIIH@5;/-  ':---:-%5%(5555.5-+:'-;EH99IIF99H7/- %+-55-56.-%+55-<555-+%  -@HIH5I9IIC:- # -2:-:5--%%-2:-55-:%% +GHCI@HBCG@92 --255.2-%%-7-55-:--'  7979=EHHCCH@95-=2 +555-<--(%--:.5-5<'!-HH79=HCCC=9<-9=2 -7-5---%%%-7-<555-2%# HQ%I79=HH=7--9(I.#%-57--%(%--:-:-:-  -HH%QN7>C=95-IO%H'#%(---(%%---5-5-2 & .MQOOIG>99HMOOM=%%-%%%--555-(# -CSOOMOQMIOQO7' #%+65-+!&9HOOSMOQQQOOO9%%%(# CMSOQQQQOSMH.##9HMOQQOQMMI7 9HQQQQLCH7  9MQOI.9+  .MQQM:  7OSOOM% 9QOQQI'  #+MOQOH% *HMOO9  &9IH9'  #&''' ' &6 7'''+ 97('+7'@9.('+7:+H@7'+799+9HG9.% 799G9 7H==7''79H=7.@B9:.% +9GC9.)99:7% +:997)'.97''+797((').' %+7+7'(77++1.%+-+' '=+-7+%++(+% '. 79%+%!% '+7'%    60026<&06&62&660<0<<06A<&<0#0<0&A<0&&6A<066&6<B:'*06CHHIHHBB9-(%  #*2LC:9CHHHBB9-%7C:-##*&HO%H99CHCB9-%7M99<##* -HH%MI79BB95-HIH%H9##&-=QQMM9CCC9COQH'H@%#& -HOOOMOSOOMOQIB@' 9QOSOOQOSOOQIC7 +CSOSOQQOQQIH> 7OOSOSOSMIIG) .7=2.  =HSOQOOOH=7%%%'79BH9-7!# 9HOSOQOOI' %9.%'7@@H929+'!&#+9HOSOQO=%'+9.'%7EHC997('$#&+:MQOQOC'7CH..'7=HHH@9''#&+MQQQM7 '7GC@.(%9BNMIHC:+&=QOOH+ '9C=9('7BHHHI=@:$*&+NMH7 +9:'%!9=NHHH@+#&+H=++.%79BHB=:+ # !99B=7+  +-''!7:99' % 2E97)!% '+'+'' -==79(' '.77.+!! ' +:+.% !.=B(.+'!%(. 9+!! ))9).+!'.7($ '.(.+792%'%79B=.--+' 79=C9%5(-'+++ 9CCG9' 555++:++ @C@9+' - 55--- +7:+'9G>9@7+.55-55-- +77+9=7G+-2% %-.5555555'+7=179E2-5-%(-%<5.5-5-52919-+7---55-%2-!-5555555-29=+.+5-5-55(-5%%<5.5-5-5+79%'--75555.5-!!-5555555-77 %-55-<5-<--%<5.5-5-5++ -:-55-5--%!-<555555.+:-55.55-%%%-25.5-<.(--:-<--%%!(-<5555-%(5-5--%%!(-25.2% !-5-((!!(-<-%%!((!!%-%%0000#00<0&60#00<0&6A<06&<0&0697++%%*06OOI99BC@9-MOM+   HOSMMHCBGCOOM7  7OOQQOOOSOOSOM7'HOSOSOSOSOOMI7-- '+ 9OQOSOSOSOOM=. ---.2- '7+! 'COSOQOQOOOH9!--<(-5-2('+! &9MMOSOQOMH9(!' --5:-+-:5:-<- &*#>HMOSOOH+7 %(+.--75-5--55-555.-0#&7HSOQOI@+  '.(-:-5:55-':5.-:5-:-5' 0#*#HOOSOOH7%'-5-5:-5-'-(-.<5:5-55:5(#*9MOSOQO=%.5-5:-55:--6%55-:5-5:-5-<%&#-HMOQOH.'(5:5555:-5-+'-::-5:555:5+#9MOOM= ':-55555.5--+'--25:-:-:5--%9IN9+--:5-:<555-+(--::.5-:-55:+!  79+-:.5:-:-<--%'-:-<5:555:-- ! %  -5<955---'(%--:.:-5-:-:- % !.9% ----2-2-+6''--<555:55--%'! '999(''+-5.--+(%'5--:<.525-%('!(=H@9.%!-+6'--'('-55-5:--+%! '.CG@7)%!--+(+%'--5:--%(% !' 779B7-$!'%('-5---%'  '+79.%'%-%%%' %+(' !.+ '+7'+'  '++% ! 77 77'  -+  !!7'.+ '  ( '  0<006<0&2600<0&6606600<0*0<066606600;PJ-%-%  +%'+$'''&#-RB :C;HHF;E7%-J'+9' (''' *#  ';P7CHFHIFBB=:D;%## 9+%+'' 0%;9HB9BHB?B=:;+ ##9+'7971'0 '9HCBBC9BHB=- ##'797-' *#9HIICHBFFCB- ##97+' #*'MB=@CICICHHB9< # 9-' && @'HM9GCIIICB9:%9'# ' #77%OM=HCICC9:':27 =EHOM=@CC79':-E # +=QSMICG@H.CMI-# 9HOSMMOOOMOMC+  ESOSOOSOOMH7  .HOOQQOQOH7  7MOSOQQM7'#)OMOSOM=&#BHQOOI9'0#7OOSOOI9 &COOQQOH+'!##7MMSOMI7'(9''#=OOONH''7+6:@7) 9HI=':7+-- 79G97'%% 77'--- 7-+7BE=1 .'' :7'--5575--C977I=7B=7'77'77+--7-5-5--. 7-H929C=HB:77-+7--(7555557(-5 5--H929HE@9.C'77+-<.5-5-5-%+5-575-CB29==7777:+--7555557('%-75-:-5-C=.7:7+77C-57-55-5-<''-2555-:7-C(77+'+77--555-55.-%%-27-:-5.57+++')+--555-557-('---:-:-<5='+'''-:5.55555(('--25-:-7-7' ''-7-<5-57((%((-55-7-+B' ---5575(-'(+6.7--%: %-7-7--+'(-----%+'%----%'%---%%'%'+!%'%%sdl12-compat-1.2.74/test/picture.xbm0000664000000000000000000000156412115006433014106 0ustar00#define picture_width 32 #define picture_height 32 static char picture_bits[] = { 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x18, 0x80, 0x01, 0x18, 0x64, 0x6f, 0xf6, 0x26, 0x0a, 0x00, 0x00, 0x50, 0xf2, 0xff, 0xff, 0x4f, 0x14, 0x04, 0x00, 0x28, 0x14, 0x0e, 0x00, 0x28, 0x10, 0x32, 0x00, 0x08, 0x94, 0x03, 0x00, 0x08, 0xf4, 0x04, 0x00, 0x08, 0xb0, 0x08, 0x00, 0x08, 0x34, 0x01, 0x00, 0x28, 0x34, 0x01, 0x00, 0x28, 0x12, 0x00, 0x40, 0x48, 0x12, 0x20, 0xa6, 0x48, 0x14, 0x50, 0x11, 0x29, 0x14, 0x50, 0x48, 0x2a, 0x10, 0x27, 0xac, 0x0e, 0xd4, 0x71, 0xe8, 0x0a, 0x74, 0x20, 0xa8, 0x0a, 0x14, 0x20, 0x00, 0x08, 0x10, 0x50, 0x00, 0x08, 0x14, 0x00, 0x00, 0x28, 0x14, 0x00, 0x00, 0x28, 0xf2, 0xff, 0xff, 0x4f, 0x0a, 0x00, 0x00, 0x50, 0x64, 0x6f, 0xf6, 0x26, 0x18, 0x80, 0x01, 0x18, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00}; sdl12-compat-1.2.74/test/sail.bmp0000664000000000000000000003676212115006433013363 0ustar00BM=>(i<  BBb&PFC$F#B~&Az.Av>FrZvGDlO;[8\w{~vFR`cɬ{rmKhh`~zz^6N>U`^иHZivv%L}w{AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA**16 16(=====# AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6=//$/=//$$##7777$=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA56===$#77##77777777$77$(=#$$$77=$/6AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA16$///$/=7#$==#7##777#77#==7##77$=6=##7#11AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7(==$#777##77/((((/#7777/$# 5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6/#$$77#7##77##77###7######77#7715*AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6(7#=7777777777#$= AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA/#77#777777##77##77#7$$=/$61#= ==1AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#$/7#$777#=$/=$==/==(=###77#7;;=///$#66=//1 5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=#$#=###/////===/(=7##7###77777###AAAAAAAAAAAAAAAAAAAAAAAAAAAAA=#( ##;;;616;;633;;;6;6;66=;;;;;=$77=#7AAAAAAAAAAAAAAAAAAAAAAA$#$#$7==9 &--&&&&<%'- <<&?"""?&"??"""4444444$/7#AAAAAAAAAAAAAAAAAAAAAA###/691=;?&?8 ??+>>%' <4+> """?&&&&&&&&&4&2--+"$$$$6;7/AAAAAAAAAAAAA$7$;)?&&"<&%&+?)($$#//= &&+ =#73&&-44"=$$$71$AAAAAAAAAA6$&<2.--86=$#7#.4619(3334<< %)"1AAAAAAAAAAAAAA16#&< AA0?";#& =$77#?  <& =AAAAAAAAAAA /4<-%567"- ";777<<"6$AAAAAAAAAAAAAAA67 <>1/#=  &7#7& <-)67AAAAAAAAAAAAAAA(7=AA28$  ?77$$$7<&= 5AAAAAAAAAAAAAAAAAA1#7(A 1##5 )#$<  <&?") AAAAAAAAAAAAAAAAAAAAA =6A <+=#8 ""7? -4)618AAAAAAAAAAAAAAAAAAAAAAAAAA0-<%8 #?3 &4""99196 AAAAAAAAAAAAAAAAAAAAAAAAAAAAA=887-7"3#<   <%"(65AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA(#7#7?7?.)<<<49=( AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#378177"<&4"1 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1/7/< &)( :AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA ##7) ,06;66 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=77177-+1 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA # <<A6#;"; AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6577?"3";#/6==6 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=767//$$=A55AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA##AAAAAAAAAAAAA(7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#AAAAAAAAAAAAA/##/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 77AAAAAAAAAAAA5###AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA67AAAAAAAAAAAA=77AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#$###AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA77771AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA777771AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA177=7AAAAAAAAAAAAA7/$7(AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA #/AAAAAAAAAAAAA$7$=/=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA67#/AAAAAAAAAAAAA#/=7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=##=AAAAAAAAAAAAA/#7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA//7=7AAAAAAAAAAAAA=7##6AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA//#AAAAAAAAAAAAA777#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7$AAAAAAAAAAAAA7#71AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7#7771AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA777AAAAAAAAAAAA$##AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7#77AAAAAAAAAAAA/7$AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6###AAAAAAAAAAAA#76AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA #7#AAAAAAAAAAAA777#1AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA$AAAAAAAAAAAA777777$7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA##AAAAAAAAAAAA###7/5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5AAAAAAAAAAAA#77#7###6AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA/AAAAAAAAAAAA7/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1#7AAAAAAAAAAAA7####7 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 7AAAAAAAAAAAA7#7/7=*AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#AAAAAAAAAAAA$#76 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=77AAAAAAAAAA#777/$1AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1##7AAAAAAAAAA#/#$AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 77AAAAAAAAAA77/ AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=7#7AAAAAAAAAA77#7#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA77AAAAAAAAA=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5#AAAAAAAAA$71AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA$#7AAAAAAAAA77$AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=##AAAAAAAAA77 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1AAAAAAAA/AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5$7AAAAAAAA1AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=#7AAAAAAAA#5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1AAAAAAA#7=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA$#7AAAAAAA$$7 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA #AAAAAAA#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 7AAAAAA$$71AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=#AAAAAA$AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5#7AAAAA##7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA(#77#AAAAA77 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7#AAAA$#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA #AAAA7==AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5=#7AAAA7$6AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5#7AAA5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA(7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA57AA1AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1AAA$AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA7 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA A=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA776AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA$75AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA/7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 7##7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA77#AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA 7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA $7AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA=##$777AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA#7777AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA6#$77AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA5/##AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA =#@@7= AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA1@@@@5AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@@@@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAsdl12-compat-1.2.74/test/sample.bmp0000664000000000000000000020712212115006433013702 0ustar00BMR*(( m m <"P2F"<:xjb"`D@0 pj@VHV`F2HB08`nh < r0  .P ,&<*6j\tlL@xfp*@4<\&,NR@4.0@ "(,.$6< rBX*.T8"H bBL:42jRNb40 .">>  jVb & ,bjx@$(^^`4.0X&xN24z\6 >,$BDj@jNl\Xr\6 vt>L|j2 (XZ8(08.0\LN >"RL(*@$<P` >42dLB<:jXXJ 0<">$hRV2<j6<Z V80<@> 0T$*X~*JN>PD2|Rnv" (F\$FfJ>JX^B,@V H&p``>^\4nj8 F00<h X. b0"TZh~.pl:".22:. b.Vd$D>@ n|j^^|``H<.HVZl>LDLjFjXH\"  n TB0JvP> ("~VT8 6@ x>>&6TDzL(" F<Nn>*<6rLL&("FFO 555 OOFFFO 5.%%Ґ%.'u5 OFFFFz ġ١١١'5 FFFE5<.ٝ١.''Đ١ć O rrrr zFFF 555 55 vvvvvvvvv s s =====ss O 5u.ِٝ'55UEEEEEEEnn5555١%. 7҄҄҄7%%%77u zF.7777777%%%%%%%%%%%%%%7777777777%7%7%%%%%77777777777%7%7%777%7777777%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%t O 5u.١.55nCCCCEEUUEUUEU5555.Đٗ% O١ҡ҄7777777777777777777777777҄7.u 5 Outttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttqqqqq%%%%%%7q  u.%١55UUUCCCCCCCCnnnUUUUUCU55>555555== tqf5uġu5nCCCnn]l>>>lB]]nnCnnnnnnn>JBBD>>>>>>>>>>>>>>oo/ć ҡ 55<<<n>>>>>@JDDll>>>>>>>>@J>>>o>>>>>>oo>oo//<5ġ555<<<<<<<<<<nln]>>>>>>>>>>>ooo>@@>>+>ooo;׺'5 ..5 <<<<<<<<<<<<<<<<>>K>>>l>>>@@>JJJCUUE ='%R 'nB]l>>lllllBJ>>>>ooĐ>++++++++::oo/>>>nDD>>llllll>וo+>++::׺*lnnUUn=''O .u5>>nn>>]Jl>>>@@AAAAAAA@>oo++++:׺/<5Ez5<*/;׺|-̧̫,,,̧,{{ y yyysyyvvvvv.7.u PPPeYY2˜[[[ΏΏ[[[[ΏQ[[[[QQQQQQQ4444444GGGGG>>JnnUnh' F5.١.5555>>>lK@@GAAAAAAAAAꙙ+>l55Unnܢ=5'١'55U>>>CDGGGGGAAAAAƛ+o<zr<<} |*-̫,,,熆,,秧,Ǹ,,,,,,떖,7{yyyyyyyyyvssvv.77 FPPeeeeeYYYYYYYYYYYY22YYSS\\\ΏQQQ44ZZZ4VGGƛKllU5nnU=OF .١5EC55>>B>++GGGmmGGGGGAAAGGAAA+}o< Fr<<<̧,,,熆,Ǩ,,{{{{{{{{{{{{{{뉬"뮖"yyyyyyyyyyysvvvvy77.u FPPPeeeeeeeYYYYYYYYYYYYY2МSSΏ\\\\\QQQQZZZZZZZZZZVVVVVVVVVZ44ƛK>>CUUUER' u'n>>>lBB>>>+GmmmmmmGGGGGGGGGA:Ț}o<r<<<,,,3熆,dž{{{{{{{{{{{{{{{{{뉉"""""""yyyyyyyyyyyyyyyvy 77vPPPeeeeeeeYYYYYYYYYоNN\\ÏЎQQQQQQZZZZZZZZZZZZZVVVVVVmmmVV44>>>CnEEUU='Ģ= >>n]>l>l>>mmmmmGGGGGGGGGGGGGGGƛ:::Ȼo z~<ϡ̨,,3,dž333{{{{{{{{{{떖"(ج""yyyyyyyvyvv ttPPeeeeeeeeYYYYYYYYSSSSΏΏ\\\\QÎQQZQQZZZZZZZZZZZVZVVVVVVVmmmmGGV44Kl>>lB5nUnUnOO '>>]]>>>>mmmmmmmmmmGGGGGGGGGGGGGƛA+:+Ȉ}l>>>ll55U 5'' O ٢>>n>>>>>>>mmmmmmmmGmGGGGGGGGGGGGƛ:ȻӃ}<Fzudž3333ب33333{{{떖(((((""" vvv7vPPeeeeeeeeeeeYYYSSSSSNSSN^N\\Ş\\\\Z\ZZZZZZZZZZZZZZVVVVVVmmmVmGGGmGGGG4K>>>>>>nnUUE uĢ5OO'=55>=>>>>>>>+ꕕmmmmmmmmGGGGGGƛƛ+::ӔӃӯ}>>>>>>U '=OOOu=>llDl>>mmmmmmmmGGGGGGGGGGƛƛ++ӚӔӯֈ}r 㺁ކ333333333{{{떖(((((((("(((((""""""" v t7tu PeeeeeeeeeeeeYYbbSSSSSNNNN^NNЎ^^__X!!_MM!HMM\\\\ÎZZZZZZZZZZZZZZVVVVVKGGGGKGKGGGGGG>>>>lnn5555'' ِ5=>>l>>mmmmmmmGGGGGGGƛ+++oӔӔӯ}>>>>=55=' 5'=5=>l>mmmmmmmGGmGGmƛƛ+++  0߯}KK>>=55='= u555n>>>AAmmmmGGmmmmƛ+++++++:ו:++Ӕ  000߯}}< /ϫǪު$ް$䰰$$$䰰333떖(ɀ(""""""sssttPPeeeeeeeeeeeeeebbbbbSSSS``LLWWIiIIiIT_Taaaaa!Xk!k_M!4ZZZZZZZZZVVVVVVVKKKKKAAAAAAAA4K>l>>==55=OF5% U5n>>>>Ammmmmmmmmmƛ++++++++++  000000߯1}-rz*ϫ,$䰰$$$$䰰3333떖(""""""PPssttsPeeeeeeeeeeebbbbbbb`````LLWWWiijjjjj!aaX!aa!!!!!Ş\\\\\\\Ü44ZZZZZZZZVVVVVVVKKKKKKKAAAAAAAA@@A@4Kll>===' F ĵ'5555==@@@mmmmmmmmmmƛ++++++++::o::: 0000000߯}=''  .'>Kmmmmmmmmmmmmmmmmm++++++++++::oo  0000000000߯1}GmGmmmmmmmmmmmmmmmmmmmmmmmmmmmm++++++++++ȔӔӯ 0000000000000011-rF<<~--$p$䪪$&$$&&&$&$$&$$$䰰(((92 2ebbbbbbbbb````LLLLLLWiiijjaaaaaaaaaaa!_TXX_d!!d!!c!!!!ÏÏVVVVVKKKKKKKKKKKKlllllJl@@@@@@@@@@@@@@@@@4===55u= %'''uu=l>ll>>GGGGGmmmmmmmmmGGmGmGmGmmmmmmmmmmm+++++++++׽ȔӔӃӃ 0000000000000߯1wr<7rwww-̆$$$$$$$&&&&&$&&$&&$$䰰((("""""9"2 2bbbbbbb````LLLLLLWiiijjjaaaaaaaaaaa!XXXX!!!!!!!!!Ï[KVVKVKKKKKKKKKKKllllllJl@@@JJJ@@@@@@@@@@@@4K==555='O %''''u>l>l>ġGGGGGmGGmmmGGGGGGGGGGGGGGGGGGmmm++++++ȔӔȚӔ 00000000000߯11,wwrw-,Ǫ$$$$$$$&&&$$&$&&&$$䰰((("""""9 eebbbbbb````LLLLLLWiijjjjaaaaaaaaaaa!Td__!!!!!!!!ÎÏKKVKKKKKKKKKKKlllllllJJJJJJJJ@@@@@@@@@@@44=55=  ĵ'''>KAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG+++++++׽ӻ000000000߯111̧-$$$$$$&$$&&&$&$&$&&&$$䰰떖(("2eebbbbb```LLLLLLWiiijjjjaaaaaaaaaaaŞ!!!!ŞÎÏKKKKKKKKKKKKKlllllllJJJJJJJJJJJJJJJJ@@@@@@K4'== O.u''n=KGAGGGGGGGGGGGGGGGGƛ+++++++׽փ߭00011ި̸も$$$$$&&p&$&&&$$&&&&&&&$$3{{{{{떖(""""˾2ebbbbb```LLLLLLWiiijjjjjjjaaaaaaaX!!!!!!ţ!!Ş\ÏÜKKKKKKKKKKKKKlllllllllDJJJDDJJJJJJJJJJ@@JJ@@J4'''''>>AGAGAGAAAAAAAAGGƛ++++++++׷ȿȚֈӯ߭,;3$$$p$$&&$$$&$&&&&&&$$3{{{{((((("9tebbb`````LLLLLWiiiiijjjjjjjjaaaaTţ!!!KKhKKKKhllllllllllllllBBDDDDDJJJJJDDDD@JJD@@lJ''utO%'u5>=AAAAGAAAAAAAAAAAAAAAAGƛ+++++++:ȚȻ|߭,|㉉333&&$&&$&&&$$3{~~~~~~~{(((9"92ebbbb````LLLLLLWiiiiiiiiiijIjjTTT^ţ!!!!Ў4hKhKKKKhllllllllllllllBBDBDDDJJJJJDDDDJJJ@@JDJl>Ģ''% %%'=='4AAAAAAAAAAAAA@@@AAAAAAAAAAAAAAA+++++++ȔȚȔȻȚȚ| ߭ .も,,,Ǩ3&&&&$&&&$$3w~zzr~yyy{((2ebbbb```LLLLLLLWWWWWWIII^IIITTT^!!!!!!Ў4hhhhKhhhhlllll]]]BB]BlBBBBBBBBBBBBDDDDJJJJJJJJll'==''7t  Ң55=''AAAAA@A@A@AA@@@@AAAAAAAAAAAAAAAAAAA+++++++:ȔȚȚ֚ ㉉$$&&&$&&&&&$$rz~yyy((2bbbb````LLLLLLLLWWLL^^^^^^^TT^^Уţ!!!!Ï'hhhhKKhhllllll]]BBBBBBBBBBBBBBBBBBDDDDJJJJJJJJlBl'u'''7uO t'=5'''AAA@@@@@@@@@@@@@AAAAAAAAAAAAAAAAA@AA>>++++++::o:Ȉ|֚| ި 扉7$$$&&$&&$&&&&&&$䰖wryyy(Ѡ22bbbbb```LLLLLLLLLLLI^^^^NN^^^^^NУОÜhhhhKhlnnnnn]]]]BB]CCCBBBBBBBBBBBBBBBBBBBBDDDDDBBK''''''tO t==5'''ġ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AA@@@@>>+++׽:Ț|||||Ȼ lj7Ǒǰ$$$$&&&$&&$&&$&&&${Or~y((292bbbb```LLLLLLLLLLLI^^^^N^^^^^^NОУЎhRhhhhlnnnnn]]]]BBCCCCBBBBBBBBBBBBBBBBBBBBDDDDDBBl''''''t  =5=u@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@>>>++׽:Ț| | Ȼȃި Ǒ䰰$$$$&&&&$&&&&$&&&$${~y()9929bb````LLLLLLLLWWIIIII^^^^^^^^^!!Ŏ['=Rhhhhllnn]]]]]]]CCCCCCCCCCCBBBBBBBBBBBBBBBBBBBBBB>'Ģ''' u=5u@@@@@@@@@@@@@@@@@J@@@@@@@@@@@@@@@@@@>>>+://׷:;||Ȼ111111ި Ǒ$$&$$$$$$&&&&&&$-rFzyy(92bb````LLLLLLLWWWIIIIII^^^^^^^^У!'''%'hhhKhllln]]]]]UCCCCCCCCCCCCBBBBBBBBBBBBBBBBBBBBBBB''''OO%u'4K@JJJJJJJJ@@@@@@@@JJJJJJJJJJJJJJ@@@@@@@>>>>>>>o///׿}Ⱥ/**;|||||11111 欉ǰ$$$$$&&$&&&&&&$rFFFzyy()999292b````LLLLLLWLIIIIIIII^^^^^^^^ЎУ''''=nhhhnnnn]]]]]]CCCCCCCCCCCCCCBBBBBBBB]]BBBBBBBDBBBlĢtt=O%t''KDJJJJJJJJ@@@@@@JJDDDDDBDBDBBBDDDDJ@@@@@>>>>>>>>o/Đ///;;//*|||1111 游Ǩ3$&&&$$&$&&&&&&${wFFFFFzvy(9999222b````LLLLLLLLIIIIIIII^^^^^^_^Уq=nnhhnnn]]UUU]]CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCn'u 5tu'Đ@@@@JDDJJDDJJJJJJJDDBBBBBBBDBBBBBBDJJJ@@@@>@>>>>>oo../*;ȿ;;;*|11 ؑ䰰䑑&&&&$$&&&&&&$${wFFFsy"()992b````LLLLLWWWWIIIIII^^^^^^^^NУЎЎÎ=hUh]nn]]]]UU]]CCCCCCCCCCCCCCCUCUEEEEEEEEEEEEO OOO O ''uJ@@JJDDJJDDJJJJJDDDBBBBBBBBBBCCCBBDDDJJ@@>@>>>>>>o/.Đ;///;;׿};;;||11 Ǒ$pp$$&$&&&&&&&&&&${FPy())22e299b````LLLLLWWWWWIIII^^^^^^^^__ЎЎУЎ''''hnnn]]]UUUUUUUCCCUUUCCCCEEEEEEEEEEE 7''u5>J@DJJJJJJJJJJJJJJDDBBBBBBBBBBBBCBBBDDJ@>J>>>>>o.////׿};׺ ||11 ǬǑp$&$$&$&&&&$zFsy()999922222bb```LLLLLWWWWWIIII^^^^^^^___УУЎЎЎЎ''''hnnU]UUUUUUUEEEEEEEEEEEEE 7''>lDDJJJJJJJJJJJJJJDDBBBBBBBBBBBBCBBBJ>>>o///./ĐĐ;/׺}| | 11 ,Ǒ$$$&&&&&&&rFsy))))9299222222Sb```LLLLWWWWWWIIIII^^TIIT___УÎ'''hhUUUUUUUUUUUEEEEEEEEEEEEEuuuBBJJJJJJ@JJJJJJJJJDBBBBBBBBBBBBCBBBD><..///Đġ;֚| ||111 ǸǑ$$$$$$&&&&&&&${~sy")))))99999e2222b```LLLWWWWWWWIIIIIIITTTT___УЎ'RnUUUUUUEEEEEEEEEEEuuu'%'nnBDJJDJJJJJDDDJDDDDBBBBBBBBBBBBCBBBC5//////׿Ț֚|Ȼ1ǬǬؑ䑑pp$$$$&&&&&&&&${Fzv"))))999992```LLLLWWWWWIIIIIIIITTTT___У'ܢ=UEEEEOEO u77un]CBBBBBDBBBBBBBBBBBCCCCCCCCCCCCBBCCCC5ġ../////;|  ǬǑ$$&&&&&&&&&&&$zy))))))))92222222b``LLLLWWWWWIIIIIIITTTTTT___УЎÎ''' OOOOvtҵ.EEUCCCCCCBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC./Đِ///ס׿}}}||| ̸ǬǑ&&$$$&$$&&&&$zs")))22222e22269b``LLLWWWWWWIIIIIIIITTTT____ЎОЎÎ====  .... EEUUCCCCCCCCCCCCCCCCCCġ.Đ/*/׿׺׺|}}|֚| -ǬǑ$$$$$$$&챱&&&~s"))9922e29922S```LLWWWWWWIIIIIIIITTT_____ЎЎ=Rff= tO EEEEEEEEEEEEEEEEEEEEEEEEEEECCCU5...׈/;׺ȿȻ ̉Ǭǰ$$$$&&$$&&&&&{FFs")))922覦2222262S``LLWWWWWWIIIIIIIIT_______ЎЎ'RffR=t EEEEEEEEEEEEEEEEUUUU.ĐĐ:ȚȺ||| ,Ǩ33333$$&&&&&&&&& zFFv)92222226S``LLLWiWWWIIIIIIIIT________У[[RRRfR= vEEUEEEEE5.ِĐȚ|Ⱥ -----,{{3333$&&&&$&&&& rsy")92292222S`LLLWiWiiIIIIIIII_________QQQ[[[[[[[=E.Đ١/o:ȿȺ| Ȼ߯---,,,$$$&&&&&$&& ~v)Ѡ2222222299222S``LWWiWiWIIIIIIII_________ŞΏ[Q'''''tF5.ĐĐġ//Ⱥ|| Ǹϫも,,,&&$&&&&&$&&&&&{~Fs))Ѡ299222929S``LWWiWiWIIIITIIIT_T_______Ў˜'tO ..'''''ooo///;|Ȼ߭Ǭ,,Ǩ&&$$$&&&& y)))Ѡ9922222299N``LWWiiiiIIIITIIIT_dTT__dd_Ў˜'' F t....''5<5??#??#?#?#ġӔӯӯֈ}}}}<+++++++++oo:::::}}}}}}}}}}}}}}}};———¶,,-wrzFrww-̉7 77788(((288ʒʒ#xq%ٝO fRR[[[[[QQQQQQQQQQQQQQZZ\\\\q%''%??xO O җ—%ʒ?.ooo++++++oooo::::::::}}}}}}}}}}};——Թ¶,̧-wrFrww-77777788("9xxxx ʒtxx7 OO fRRR[[[[QQQQQQQQQQQQQQZZZZZZ\%6q%'ۗ??=OOҗ—7tʗ'o>oo+++++oo:::oo::::}}}}}}}}}};—Թ¬Զ樆wrzFrww-777777 ("28 tt ˾xx%ٗ„ OOfRRR[[[[QQQQQQQQQQQQZZZZZZZ۵%%٢'x%ٗ'җ—ԗ¹ʹ'ooo+++ooo::::o::::}}}}}}}}}}}*ԗ…¬—¬…¹Ը,,-wzFFz~w-77777¥77788t sPss v 7%77%OOffRRR[[[[QQQQQQQQQQVZZZZZQ%q%%%%ٵ󵵵%''t?= E ٝҝq#'o>o+oooo:::::::}}}}}}}}}}}*;;—¹x8x̫-wzFrw-7777777777""྾7q v ss qttttt OO RRhh[[[[QQQQQQQQQVVVZQVQ%%%%%%%t''##?EEEE %…—%#ooooooo:::::::}}}}}}}}};*.7…Թ-wrzzr~-̉777777tt77„Զ༼988 tt ssxx87 v vOOfRRhh[[[[[QQQVVKVVVQQٵ%%%%%qqq%qqqqq%%##uUE OOtٗԊxćooooooo::::}}}}}}}}*/ć Ԃ$#$$"6w"/-= Р .0 P 0 2'A"20472347 #"/ .@+   P07 >$ . 7!%#D43c!` ³олЏа*m 50AT3D#! ^ а ݾ. $5#$4$$ BE . ́ߠݠ #ұNP@0$@00= -2G/M- B!P />oQ?ATa?Bt/,r0J>@ @AR" !1_D:p?2T'.B!6# aq߿"@ B4!$a%Ct(>1+p / %? ;!@q""#"4`1> 3؁11Ѭ AO %!@3.3P%$B$Q. !>D1 3ERB 0 3%"C BAr202`q1"p?q2 5#!μRC #@R C !& AR2%pS & ,a/R "B4A 'G~5 N3$P 20$b as !"&  C4Ct#'3.d rB"'74 ! %4ްB߲`0" 3"204 S0α3P !?Q1&$4  6A!D b@'A0M1@0܏$0"B02! 7" *FC"R"2e0!& $?A '"B#3t 0 # %r 44,'w bE2 C,4#p434ݲC#а%  ??# R4 ܟ& "2 0rBA!D " R$ A s04 S/b?0b PG!C u%!1 BV$ܠd0 "41ߴ4 %5P '2 F5 "6 aqB 5A!/>c3"B,aS+" #ܠ!"0ΞCA 0 "ղ4!$ !%3F 02P"A ? B-D@>aA1= ۠ G'0 "!4 01`7PA0b % @P.2 pB:=b0$8P'^ = Os "!O"1"%`!  P#@" %0/0S!%""2!"  #!>4C!" ࿒5  1! BU !D4ҭ2T! " R/!rD #6#`!0&E&0A S56"6 1%  "%Cް7 "# 6>$ 0q/7!5P5""P !U0%$a DP 43 !%%05 2 7! 44"$B "CQ32-6%$%`0A_݀4" 0 %#E"ͯ3 %`" "2F73@,#6 E15@B0.0!"4 4R 1$$ #_/ 1ϐ5$$4#2Q  @1"341!/#a!Aq !a'. 3 T /?a !S! bCGR 3#޽4 tc/#P `'##a A'! 6/AE3d4"a%@B 4"Q߾$ A1#a7s? C7ҲDP0 @?₰A"; T ` . %p/F5ӓAР"  ߷3 A/ , "ﱳ !'D@5r €0?#'15#R/ .~¢"ҡ Ѥ  _A  >"!)P# !  E௠33B%!Ѐ&*W3 #12 !p"4$142163Qް!7C$!GA3"ݍ5"" ݮ"p'5a"!'ޭ$1 ̽!/7tG'r %4,Aa-Pt 0r"  !A3 Q"c1@ a "'?U R? #@B"  # BDB?Q&>-C @ ;? ba"Bs2 &$@`@t%"TbD a!"!TQ 3sQ +3P   %/"O?0P rq&4P &11#32` $> 0Q@@>r5 "sBr3 60%5Ea#B!sD%!/B4r#O >̰J.ۿO?0c@  /ͻ,"2'O/ ArD"2@7q10U>A#, "!3 @n0 @2R @ ""0   0n   Br O2 &@ $A!/ "+C >@#1  \0 AP $$ ?@"< # r$<?! //p 0o /04 >/@> C ' 1 E% Rd  0 MD.aQq;þ  /,! Na"O0ϣ"QAO3@q"#@@00#? 0nߒ?/m5Ф%; @0Д.`"t]& "=|Э#=#Һ %<. O> q3.&N!P' ^4  Խ~Α ς0O14/1o!m0q @"!'0  "A1=Q"Ӏ*O E O ]Гp "4  >7 @0`$R/G!о@!!߀ P /Ђ1 !  3c2ޟ C##F7!F$1@1!!ϐ1$3 sD  P6 6?!a q0B 0  t"NA@2a`0t@4Bb%2D/C,b%pA+#&"P% A`    3g/q ?! A Q@":P A o " #x>,4 2 0/#615!05Dr#   !a!V0 ۠3 E A"-p/2$&c00@,6F% E@PD#1& w ξ1# P@C3s C.0Q1LP B3!1@b"3q %3"ݞNN7!7,B"q4 4"$bE01C4% 6# $A q5!'2 " `2"b# B 7 cPB"?  P%@ '>psAr1q4%D#1u075"5 0"O"7A Р#? 3 ݡS4A G0A R07_" A#o' 1"!!.  60OӢ "" AQq 0^A >2/-p%!A&@2!t$ `10r0O ѠТ -(./A$Sp5%$E2_; <@ $$@2O = ߕ.4"4 !CЀ @ P P7C`3 ?G!=3 +"P^214 @@!0p^#!"A !Oo >!@N> ]Ѐ#0q' ^1Q"o" " ^q B!~No"'@݀J0?Ќ@0 /$">CN0` CР/ R,._E!2"РP 3Ќ#PqO@=# p ##O?40:У &O`-@'1&"" $aPw 'B$ ? . w"4#e_' BA#T / q 7P0 0 P ?MSMp% 0Tr7Pp ?޲" S"4E $ '# @",#-A" 0R""  ?$& !. 11 Cq1RqE S <p NF" 7 rP  0"#!c 0.!0^t #!%" /!  #t C/?P @Eq @ N3Q$p0ޱ6MA@-௼   #%$/5 ' '!@ a0'rP"#7D !3U$>@#Su";2#A!O  %-?_"c?2 72!C40 ǀ!ް@5@51"!!"$4=P" Ѐ" R7B10%q$#Ў ѡб3  P6B'. ?0>8-#04 Аq Ѣ0@.%Ϡ "4P @p#۠ *m2. =0C# C/%"r"-4" M/3E 43P$=  1@ &"#N C:Ӱп00o^ @sۢ "04>е>@/0 Ԡ -q  P 0 605A#44p O @ܰ ] 3 M] <4/ @]Ӏ ݁ `#*.0S 0Џ0A!/p?33b"0 Ђ % , / 0O!! 7P `:pp@P/^0O<" A -0a !0  ;*"$27?`G o +# $ #5NӀ 4"@p37"Bװ" .M1$P4  #>!'` "N _" .߼ DD43ߴm  0 0ER1AR3 Ӑ3#3' ྰ /rr"Aа0- p/7Q>N~ =a41!!(/#C$%9 @ӀB$!$A"")Р [,N0.01! $Ԡߐp!д@MÐ_ ' ^-#SPЂ+^0G0.. в3 ;/  N ӑ 0N0 P. PР 500  =I=CF@0  ` ã.@ B6  а Ҁ  0]0 =. 3ӓ0Рн0D%0p Ñ P 0`.͐ *TӁ1@1sP+040N=! 0 =1 ^@а ӓ 0 n=L0P#3Ӂ . в!.=1 P а]/# 5а4_30` ң Ñߠ^-20=#0Ԓ@Ñӂ>0  = Zрİ@0p><Q@ SG3A<#3p"37E Ѣ )퀰Ϋ ߿а0 0 đ ! x.?M  N/ , /O Ӱ- *@- ?;#@C$ >oP~^Cq>_P0,/o,  ?$&21`#a@# P2q 7:pDP0`Pa"$#12>$@.@  o.sr.2!>&V0!&3#uB!51 q/"5 "q 0B pP~BR 4@61@Qq2474ARݐ `ݏ Ϲ !B 2. 0$-r#d24"uG0 04qR# 5 0%#!B#T% rF aQ/EOO 8'!S  Bo0 6$ܐϏЏ  3UǏ?Cp"0p"O% "'_ 60#Q#O?Bs#r%6  +#N0 $ `#C.>=0 @$u!@@/PӐ>#_rM#p o3d B% ;ѐ " # "@0^_1.=O)>--0@P# >Q% P"30%,3W$ ӑ.ДN'C`-@!#!/ V? àЎ @"΀ 9 ><4`0Q% N _ӟ@#*% "5P##/"a#`%1!=7İߑ/O@> Cӕ-8 А   1B $#`?6^C`.Ҡ   .Ґ.  ӂ0Ӂ N!p @0@$ Cp.9N/  >  N1 ] * ߿ҡ а "ж0SA Bӡ_ 4C"&"A Q"%""30 # PO ?_M -/ ` }0: 0N @0 P>!P".@?1` 'o:  2/_@;`" (! "A`L  % $5.m 1q # /1_/ .2 $=qСO  ]`1 .0(`O>p!DL@0 (/KA  NA1/^!  O1& $ !  N_"0ppL 0 @ "@0@!/_L,:=3]pO= / !0@N"#p*K  /PS!@?# `10-/= C A. B,_ ?CN o L !, Op/>A/I7 ?-KOBа@0=@- pP>M! 0 ]P@\!R >! 7p !#`R ?= ?."",0! (1@ m $p ?(n :1 PAL+ ?`$N "6!/ >,  A3/Q=A.  !#  <D!0_O 1E/P3@ 3AO&! $0"2! 'C,oq+!.Q;'q"!0P[> = " `33O?  $2>``p@ $P `.m B "0Q`oK=P@!0,  . ?n$,$* M 1 o06 `0 @p_!0}2 !+$ p=0&1Np/ 0  ޿ϳ Ϡþݰ !>"(! " n-Რ Ҁ"!A` D`2"  ް _O .p.S"q$06AP30P13$!b%#q12"5P5B'@@0q"AA3Q4a043#@$`# _072#@#0Cn \?O 0M,o?! P2=q#!2p !   A  02$  @/v@ @ S:D"`0q?3M /^(  "!1`44BNQp".."@/c33!@r@.".s5/ 0P .19>  !  -N%@ #_P =W V0 Q0%@>$><AR 421``$0"> "S/"&`3RAS!DqA05>Ara% 30  ݯ a q".  a ; 103 $P01$# 1D!270A q# 0P%"% B PB7Q'-PQ/R"C.ܐR--2 PW/T #  C'A0 !QS0QB`R .!A `!A " /! 1t 0`B&"0C!DS QQ)qZ qBN 07`!q #:$7a /""0!0"NP);O/ $0%?N"0!B<ޱ0Б#  _/_!5,-$AO  =!'D @;5"?Ӄo^  P% 3#3= C/~' @,# ӂw?Ӏ./%ހ ^0%#  4A@ /  *ܤ"=/ϰQ/r O2 $6s>1sQQ s`0 ݀ E% 2O/SA D1@ "߼102 0V.Яo# /oo0@ 7ϡE 7PR Qb // q 2A"0$' >4 L" 1  ' 4BӠ+#"޿T 4 `!@'r'qB "%%"!3P!2P"&! !4D 2,C m3 Ѡ6&@301?7 = " =A0͠%޿"& G = B@/`t$@ N 0!#  3 /#"A,OW/3 BR$P`#= =4/`//0_$C2 .PP /P !_А'0?P@p4! B 0 $1 !Bn bP O0&P/0p+a/ 7p1M%p! @q!B S "ұr0"N2 P s# b!А%a !/2ீ&1/.܀B "˰01 F! A"ߠ0 2 @6$ Fݠo.  `" d)-qа?> =P% $4N` ?@$5.C>4 Џ-$L 0/ P:1ް#'0 #% 4O =v'64'D>. -0B ӵ&23B0&G#1!s2, ЏA/ߏ 11$ ЀҀ 4L^  Pq/ >@ᅠѰ"π@Fp.#0 7ޠ' rݡ0$&0t$ 40NҀ040A4 @0в =q!! QБ23/ `Т@/ O "P?Ҡ".@4Ա&>ӣ o?0300q@ "%"# 4C 90. 63} o."1 ~E = & =!? # * 1O 0!,-?/N(*P @02 ޱ 0_0a11p!"C(PCPM@#a1#$S#.', R># ݏ2-0/2B7.p0 b!r$.3Q#=D2A '!" #S-# .@0 $F $C#2`!a-`2".t$CB44!A4B#"$R$b"$ "%!4  ,  Пݰ  ݏ Я/O@b"2,C1a#A<P.t# $+! 71+  ҡ@3`\2"`@$2#6%% &  0#47#0s0 ߾Q>#7@(..Q 0@C p3'@03.$3p237P 0KЏ"4.   /0 ?  н ߲г _*0@%. 3 ް4{#0p / $AsB73 $ 3"W4$ҳ;.$S/`R@M Ѡ.&q..`t 3ۀ@ .pM = "  4 P нп⿠3p0D>uQ#/R >0p "0.p @0#B в  @2% o3j AaP ' 0"Q=7РޡܯܢDP^0oP3.oP@0 ѡ" /Co!0O@.߂2" $ / /B@ '%rr?2Q!>0 .#s0DA@ r.62/!F @ @/:D+"B3"  "/" $- AQ#( *0!Apm'?p 3\C  'P A' ,0a" ?.C!?S!1##3t3<A 0-!6APpr0 q'! A(?B"-?4@  0#4N D@#)q=A b$3+! @" a P A'1-T0p!rDAN.p0  `$ C1p 0A !L0 ?/ΰE>0E6|pqq/CaR ! Q ۰R D ν1".0 71qEq$ #%0݌ _!" Ab   0 T `2 01#Q%!0RAA%?#A!7#B$ 3#R@!"'T2P#RB!"#A BQ%q2= ޠc!7W%! B0 .B1  )/? C4 3 P O@$Oβ3   . s 1!'+є _ ! @%#! a 2 1-^0%10 CK"! -2#@! .$.@0'  "5 p@!<7O$79 . 'ՠ@!C N !$ ! "" Ӏ"N/ "S# L"<>#S=*p35Q 2!t$Эe2Ϯ"'!R"a4Q@Q̐'$3" R]$?#&!2tC?b0E2rP3B 721$Cޟ2B- %222QD`M 3а3 & #4 2 Pr 6E 7#$ޏ B@40"Ԡ$!ܿݱB7# BUc"#Q/b!#3  B  2sr"ӥA$-ΐ' ## 7 P0P1OY >* NӢn. p@? "r>PD /  p .@P#P60"07A 6B@ݿ@ C`$C Q'dE@ 3c"q@7  / $7"bB@2 #0ϾН"$#6";޵A%Sս7 2c!0%C0=tҀ> !3Q26#$"T'AF0&0.0Ӂ !"c"& 8  6?"QC 0Cb%&!ӏ=rU"/%b@'$##4 07& .ݠ Ͽ  >#!aE"5! R $D" } @ 6$ / # ͿЂ7B$A#PvҢ ""!- KC2C<^=2(0  ; @ .,.P & + .o.~ Cҷ0 `b .mP!! !20ֿ>Ё  !0_O [Ա@O!M/?  3+#Q4_0/òӐ  .ԁ ,P 20 .@>lM/^/U3B$A@R7 0_P 30sBR_N ` !3"!$_-ݰ +qK#3OR0.AR ! 21`#223Dpю, Ђ .22ВB?'. Q '!"0VQ#Ѱ_   !А!2%&2A 0Bb+ݠ"!@ 0QV 2#G6#$4U?;; ~ "=Ա >*,1 A$ ON!C* 0 I$.P ӃPM!"LL 2 $;n /H ~=8ó ^M 1P1]NP "O=.;/ԣӣ=./ P-.? -Õ=!L .|  >0. r! 8@҃0U =.=#ԤM?-.0^]@L ^L =??" .<= .= ;%Ұ P@ 1LO.M/./]=< ҆ @?B/#ӡҳ0Ó;= .NL= PѤ2 !/ f͐ܰ А ЁO.3=0c"35S4&#$35$$336#3"3C#ϠΰϾ̾߰  b3RBA2$#&BpP "!n!P- m(.P0=_  >Dnm-'A A0*>;0  [$@O"@?3' b$02#E`s.C  M02 "`!5$C ! ݿΡ@L5W>Uq'#-"`"5%/@ 43/  4@43E2r#DU!OCR1-& 1Pb %$޿ T  VA4 D@'5 "T241PRBDNQ4%%4' 7$"/"@  2DCq%3 #0A!4 6T CQ0 @ -$A ;SS+a߿  R1rSA A1# 'P0 & 0S!1.'!qp%"p0%"  %ހ /u A/+^&ߢ>!2ӣ@A ?ϐ!#>C 'p0$P2A /߂Г'1>ҠE` >$/1 '!R0< 2 !`PNбr$6C/7'/ $6  31r5$0EР3O"ҏ1pb @Բ> ð$30=, ο%'0 0!!P.` 0,!2\ Bu +28!N% ""ѷA o '$! B=BA" P`@?1&B@/ 0-L/Ѡ2 sѰ72<ڑ1Kn&500@б ޯ R7R#/#5 @@`1ČРT°Q #04p ?Q ?#N";N> O05_/C!Q S0_ M4A(@ .7N#o% -p3"#/  // /.! '5 !& R 233 " C$#Q466T2! /0 C4_%1R  - 4A s  $ / #2o    q8 =͞0q@q P. $P! 1a/!?B P p0#.0. ; ! P '3 / P!0 /$4 #<"b =P #/"=?W 4 nA`QpB 0P"2P!ݴq3"!q7#0".! 7"}H -C߼7@O a r& q" Ua0 /#!" /C74$%Pr < %"@0n Ap@ C!@40c .ϿC.>O? #Br#b L" -7`#  0? 34'   ?N2&a.=#ձ#? C -=2 0P##@ 7APG 50p0/A. R10p2%14 # +0^020@ @7RR;%R ;/<0 p:  Ѣ 2K/ `" $/~-' / @.@Ҥ@#  =0$@ L%O/p-h " R&  >!5AB1^O 0`>102734q$42@G R \Rp@ q1 !0%5 `  A 4S '0.7 /.`-%r7 B`= @-=3 00"0<8p32,p.2@@@q / !"#3%#43C44$$#435#42C$ @p4 PO 0  ޿p,!0.#0&.2r s #. ' u@ % A3q"E@QA %$ "P" $"%As Epq S/QP0>2o 0 -Џ 0 Pb3p!@B 4 qr+bPD#Bq *.0 5 Os2bR1 4"4C.P5$1SG Rc1!6!!S1@t2#! Ќ"0AB"!0 /6?B!P5 "3!6T/TQta pPOs4s2B&$G ' D`d 7O/^!!@@4`$C%B4R$ް1 #!c #5!b%07#" 70 C$< @ pB%3S"!73sR ݮ sBA"`B33 c5 10#%= 1D/c &.N P3!C!!`B 0$12. =! `a  2;/$P>0;" >OC!p@ҽб*0."0?_Ӂ6 6! >U!>?1`p ,0. ߯2N#`0 1`-?p!//!#` A1q0R1,-.Ԁ 0a"@`p."??/ QO r8!K. ~0 >.0#?_+"$'O ??o0P/B@ 1Ӽ@, O=! =;-&@0Ӏnt " 2!/ ^/ `">@pT. ' R 0 .b-4-!P04p1&ߏ!3>r"6 'p "2P7#/22 t2 3!` 07?3A!#НB %1E5!@ rR 0 00" r S % #1p32ݠ&0B!7=!`!- q$3 # AB"#P@a^1 A/w     P52%""@ΰVP0- 1$a "!  $0G`0a 10@C &'"۰! a@#"#@ C 141>/ϰ0$ @!߰'P@/q ">u &_A#0C0%$ U@120 %r$/" T R4C# 4%@A >#P 51#3BD!$!p 600?%032S/@2ϐ.# '` 3A"1 $!T!?  A>r/+4 00  ##۠!@6!25F"!O"/2@1  #   2 0 $063##0bu`@!16/0.G5&  S'2 "A4  !A2#@02  $ !qQs#6B 2' 7Q30 '`30tb10B%q $6! Q '$R/ $? =v!"b$B#2 !ΰ' @ 0#%"TAb%! r D F4 5 D/S46ݲ$ Q ݀ΰA ݰ$" 5 "!B б#$ݮ(?=.4a,0=$}Pn&D.!4p  _$0M  P @ -Q00Cr01' R R 4B" B1233CC43CC  q>   L/  @R""PaD//s"! -?  4A)   :7,O$.6P3s!  -? #B^AaS۰C ! ` A) ϳ* P1=ϯ$@"!""3r!-H4/IB- #4  #8D@##'-U#!!P?R4#0#s& Q+a a"@p#7#03S1'2D%CA2ߎ1 Q$2uE26# 2`&504"^2!0Q/ A#2 !D 3POs1EW/3!C_P".N&#7P3A%2C$0' 534'M"#aB"*1`##. #\cܿ=05'ް12"%B `6  &  S$=:F?QA&.'Q$& 4O#С$CAO%Ӎ#ސ!- ' %C5! *  C6'1#"ޮ#R ܽ? n6A5Q/ S @ 2!1౰D" P!D2p=6a?sݐ$CB3" %P B 1) w5&D " ' Q"0 G  G3%#Aހ#5ю4T4$$%#$!12B3 a "D!"CD$3BR34%$5$#B6"3$""4%!3% %" /ݾ͟t#5#2Sr"D 0ܾrWP!ް* 461s%F?E%"R1"##ܰ cbAB #b E2SI!  ' / 2!r0B@p0BBM . &@<L " taQ ' < -19o?" /pp 01 =OP?7<0!340A ! Q$!0E"/!BC! '0@p00/!*295B/P?/@ ?G"  # s4@.C# 2 0 T0'Cݎ!#q@`30t 0& 0 P! R0P  !! "]5@ 3!/T$O S!S ppA1O߾ /@"A@5_1! /p "$53" 'a 10E!!2 bA7`>d/" !6""! "'a ` 7 %qU&!" t0! "  $$0@@ p.0U ! & .& 2 D 7P 4Pݠ7`!d@/1GA 1u22`6U PbP" 13 S@ 21@ %P "aB0!%0qB R /T/+$>2" ?7" aB@!p0"  G?!"q%. '-Р1M 1E ` .΀!/22 S .O @ Q Rѿp"pc"0 G!p0" . &A@! !5]@p 4P% ;P#`##$% 2PR. & 1Uo . 2@Ѐ 4 2S5/3/Q߂30>"%=%/>% ߑ.!!ߢ 0ޏ P0,â. Ѥ a!7.14 .#// 1@0'E1`B?.# n.03߀;D$@ F!߱!600/L' ZM0/I~  "/ ?"?&> ?^'q 'w27p!C+$`!2$"%O $@QRQ@  ts <ܡ0 " '#r%$@b$B @@#0E 2о@s  " "Cs7r1!S!&"1"V!&17 '@ %71'0 026 ߾Ͽ ܎߮3 @ ARCs$% A#$#51T"o/4 `$O@!#b$q>$" K#1!!a0;!<C N32$O0/7.r`N6  +28/ '$ O ;//2L @Ġ1C#/%5 P$ SB!1#q!- /O#P %P Q3ҰpL0.!P e  ?,D  @#ѳ2́/ @4Q ° /@ ^/"0!P1 C% C1"0, C0% / &sϲP@ T-M./o pð M=- ¤$! P 9 2$@!_"*3q >RM EQ> 7 ?RcԲ>.<  P ?2?/s“2Œ@Pߕ/1   ? AР/  ݠ!' Q5 'B !Q@! q R@  ͯ! 07A-@#ދBA?sU@ C12 0 dB @21Q'a >"1!pO.ACP 'Ce4q R"D$P !@33>7"41p1͏ 0G$$ t%" ' d2?'24 `@ `&-7#2O 2$S0pA/   Q$!7 3@޾$ްQ6?1D""&CC@PP!v1ECb"!4?rR4 w"2cp B#/_'!!޾0RrpqWa"!"w2"2@ t0PB` '`! # t"#S "D #! !u!Ab #@0"w!!#s#3А"PA!Rt#$.1rQ3s  aF15,c7AD!!!$RG# &!"#s2 0aھ#ͯNA!s!` @6"D"$޿A7$"/ODBSr$ް$%@0>2@SB&C03s/A 3%"#q%ޠa2 A!R0$72$7#F@!R!! " 5"#@!&"ϯ#'!ޯCQ@B"4 QͰT"%4 "Bݐ $ B޾@ #E"#36  Н"#E1  `1  d!W3BS"523ܾt1'1ͯB4%4̿D1%A$2 752D#!1f#4R &352#4C$2$17#uC##$.ݳ63"ΐ! R ݾ0 ܲQ%D"0N# 4 4۾"ݎ4c2 ' 3%!А3"QD حB!!sBC?D!!#Q%q!%DFF4" @ή  ?O p p:A!r1@0@=?15P0 B R0= 0@  `/a p @?pr2Oޠ?o! 5 ?"*BCE#R1$ ,q' 0/R1 0 0! 6"6 p1 'р0" Q'@1 . 1 0!c0# % M0Ԡ0!>P28Q/!$ "0t#!qE0?@ P A&㠴3b@!@N/ ܡ !ҁ+p>#ހ$ 077.& A# ! A%$!0 ?Ѱ3 4 "@0 *  /!?s@ޱ /R2U^#  3" S#O  D %u7P@ 2ТSw/!s0$2 s"7D2 %R"c S205!3"'D 2QA%0 a/ PR P` ~!1. r/PG B""Q$$/r A 4%p S!#T%R0 AP1 p!$"/63P!0171%2/0>Тώ1C'20! 3pQ/ 2!@B$! ^ݾ BTP5!41A13ApACC!QA% 0Ό1BQ !N݋Ў3 6&#!A̟3$@  %"Q2 %B#00175 1! 75$"!"&%! %w!#43"51'%CC&6!C4#10 ̌"A@ BB"7! /72P݌# t!C2Ў2"Џ"u1!"2̟3%'@!eA%2 B "$c"t# 32B ޽a#36"F ޾D7@$aP1  F&1 E 6 ?7NGQ &!" 5 "'16  ' !p ASCU@/0C1!3T/%2#@- $ϱ#q".D ܿ'! B4Q-Τ 77@PG/a%Ҳ /.Ӓ@ 2?^ !~@)31`  ~  4 !  0#N  =Ӣÿ./ H' Ѣ/=4$ѡϢ0"C 03..3D/+7C?O"p?&$oS@N¡`~M  Aóp #  !3 ,/N `-Ē@-.PIJ!oL!8 ı@ >=Á/'ӑ PÓ=У^-N4װ  t$& # Ԡ pnTQMv #A! =0OR r B2 11`0/` @!B p#v! &!p!= 3D#.? p a2?sR"S4$qC-B<`.Ю -6-2a @7 Q0$r2P4r%7 @`1@sP@6#@ E #&Pf23tS0C!S0 !u2& R3R2S5 'q"FO  !P5 % ?/q'$1A_#t!/0-2QPA r+ # # #V ЀB-P 46 @!.A  rbC!/ '0\!ذ$! 3* E$a &1!A"E "/6@'0 4sP ! ,!4=",3?C!/3b@ 2%# 5 =%' T!&Cr10 $!/C3!  '1/q 1 '10 #dO@! #$рq0q/$ 0/P 04Rp !  ;P 2A"Т!@0/3 7./""q 5'@&%Q \01"_>%!a!! /@  0.^P3_r OO  @  #0  "1Ѡ2M4 (a$%%a %>>!Lr6"3ޢ2 0ӑ4 $/' n031M!"#@*/]10 @/''R,DA 0%P=0 '?+ $Q!M2 1P""E԰./+ @ @#1!* !ų.`@0&#o _  "!`2 1m=P.?$ݰ,/8P q  & pp !o 2Ġ3!#p# P $7/ѠQ$Бp!@ "Я ?'#6G@o0_Ѓ в 5,05u Q2"] M/A 0=142#  CM0q D/%p.oL* r0,: -3P" #=Q`"&# +0ھ3731 O(#'3@/ 1Կ /'  $@/s4q"1r2BPR34'" >`/1 ܳP0AE $0P10BC5C#C#A1a"20b#.@'  =D`  B!W1$3A޻#?$33oOD"0 4`  Qo1`+72$)71   @2 .2 !27 0Ӣ- p>P=0۰"?"1/ #O$r2Ҳ,¡Т² 9=? P0p  ѳ27 #p'>?!+!9% Kq0=U11 A00 /NO1#3 #߰ 9  02@"'AL.qC! ],q 5.@p#@.p O ,@M!>B}AB-1$ 0?0O 0/p@N   01A  &   >O/-[ O+ cq  EP 0 PDaQ.0!Q@p !7A Qp #ѿ D `! L & RN0 p n31 !BaP 0p_.  )N/,30/O#N 1H$>N P0ѽ`  p 3.  !./  =@_ ,  ?7 >^ .? C"@P a ?2"5 Q 0p A_6!n  1A M mA3 -?!23@ -M}1  a#,1.01` @0Q)! '@ ._ O! >?.!OPФ3qO'm "/@ Q!@> !( 2!.%"B0%01?! 0.-/>@/PR ?B-00!N/^2 P>"v@ =LM@PA.4[/ 8/P-@  0!%~J#1:-?+/@qAr$NR2ԡ@ v "'  / ?OE >Q0"$,:+! 0"qq`pM@.!#B1P07o @,N 7""s9+@O-/1 }!-6?}#ܰ-B "  OP1@!1v'0cO E ' ?^%/>/1AB 0+ =@+QNM3!"A A !Q=_A! /e 'P.& /N.A p@= &r @+ ,56m" @)  t Q @0N+/ P  >=0t 1Ta 1p!#  @@"/(,1M4 >В[R A2P  /M  BpQ>1@3! ?0` ,B0Qc%OЀ0dqAqM# \!A>.O FN ݞ!'! 0#37$C '1B#$$#4$#C3CC43CC44$#BB2` ? ݜ ݰ 'B!?0  -s""ED0&A#.B?  0AA W?!0a!'<"pR$& 3Rc@C#@344#a#PDp  п/ ; ݌  о "O65,!51&r2q0ߠ`#< !0q 0@R$ 0/.1@\0q '.',#!"3p-4@  $B QP0 CPrr D$"q@! "~0a< a ,  "[ m@p-#/Ѐ0 ! $# $!Q1^P6B A2 G 5!3W `> p!p17  "0!01.  Ap #47  Jް >`@Q"FC. %7@ P"?R7A= D1/   - P 202G`C!c@C!  #А  P/# @!3S5##60 ?П;C .#aP#  %- #%2. oQO $FA1&oPݜ `A Po"4 <!=p A@ R#Bb'62PB0A$P ް? D5"$2Qp05A.D@ 1, 1`'$@2sO1   ӢrW!!3o0 "4M O` F0 @  @.   ( /1@ . pOA0S"_ p? Q C6/ . T"'7@@ @4C04 07A$, %4.3<2'1!A. 3 ? 03. 7CТq Q"@T b! "A 2`@-_=#B0% p&   @G/sb041>GҰЁD/0O @" b!@R! ^ a S @ 0Eq#P  q 3F/40 To.2 $ r<B BO>`߿ ܰ?$ " !b T 0$! ,#. ?&"/'  0"@@c-"3"Ѡ#ðR-%2.p B$"b!R6N  .޿#p` %# r% / $RQ@/# G7 6 @ ӽܐ"A0b1r!<R7 UR ' $ S _4F``1' ,~> ѐ : "p#a" 4Ё%p2P'1_"B/Ar "o1a$ #=4E!@0C 0Q@#  Q07   $u44#a 0B o2А3 Q t!#.' " ,  dRPcp@?>!1o$CB" $Nq01 _$3 3 LO !/A-L> Q%/!0 $ # "p&Q4RSC- A!3 0R? $ 1S>4p"2  0 C %-$!% @#Pq?04@- &0,@PLA.o@-./ 0 $ @ 4 B P /+1@O. 0@8 5 "#50=+,@Q / s` 10QGpOrC ,O0ދ#   ^s R 4@ TS!6(q ЀA.. Aac$!?P 0C"C" Эb!//T0A"0 "PR!!!A!1 /?Cp Pޏ.P/P/ӰP $< & wR 2 #P2 ! @7# @5@@,p%!"ݠ3>9b p"?0ApB3#/s'A !S 0B3rٞa3" @P  9 0e05CR`,<@"2-2$#SI0F"A F1!   Q+/#' ݭtB739 S0 2@/ #r!/F  sC B+ AC/6" s!+pB P3&/M1A72PыA1 /!`00? 5 P #N@P0" #2 .q@`/& 13ẠR@4:  /49 c&!0\`8/Dq" C+!N Q' A01//RA@s"@. "$NީB! 1ý0$1`!6:@!M݀JϿ E0ґ >GB@/s^C4.6! ""@@^/A@7  2@1A?2`A! # C#"=2@=04N #> !C0"T ! -R? 43A  @;@ r `Q2.s- oP/1 ~!R"^}/o# ,12!R";#ؿ "5$Q ?A! " <<O A @)!% #@pp70p.,NC 03&8 ! w/%/M`  !^.&"~?,P`20q/;/7?&    2`QA SC  A '"O!1 B0/2 @ `# |%PP0;P"14. %5p51N>Ң!OD6 D#B"7  @0s$ s0܀C3 R32 03r02q P4  " G"0"RS qݰ 3q ! wA`QS./2spsr12! / 0"&/D"25 "7  ӞS  t0 G & *& !.T /qBP@#QT2r`?8 4 0 $&01' # B@ !!#/"a ;_!@ &1q}B"TOA@A@ <M7Q% P3!22 27@`#P b EBbt?B"**& ߀ 1 4 1a0b0 5L͟ >A  4/%0Bc6#r ,T,4?"1D4<&3B  ,0 g# !$a! ` !7'0Q1S" *$!! 4RAR?A ܿq&Aa?3@? ߎ U4 ##E% a'"݀ݽR!3R&#!13 cnAr#C4 6!47C"sB"4/ 045 RS@57! = ήޑ!%/"D1C A  "/ta$#$#r0# 2?cCQA!%r""ߎ  'C 6Q#C"@#̰0sTBPdB$40r"1 /B2Da$R261Pߜ v% b"UA  \ )-5T"!5".  20"p/5"B -a!,1߮!7.+Q D <5 \G/% rD@q "7' .0p@! <4 N370;4< 01$tB`%P61@ c]4 @$#2:/#1 R 2(2 !!+0%03G"=/C <0 B42u $ ! 0 @߽K!!"/.s"-E 3/ 0>!M%0pN "-   A 1H!^ 0M @ ""NN'SM "4 2  ~,@&2 !-]=! P0O?M @/@/O 0#P" ?B#]   1I $ 1B!2r$0@D   ?<$0 M/339O n $P/1MM!ϥ!0" * PQ*p2> ?+#pNR1">w!=5."(@ ], "p01 0-? L;$pn! E P, (00 `;."+n2.?7{P@ "/(  -/_p=0>!]["% $--[ 0%! >Q ,Pв>O$#~/`LL(N A 0"'!3BR0N?  ^?_@02@a=',"!C4Ba&  0?Q2 2/u0  ar !S' /`a1P P0qb!2p(101rܯЯ @ @ @CB$7E$B qa0p0E  #Ϳ70``5 A".&. ""W/>Q$!Aa/$P" ##P*p`"#1#@@ ߑ ?D+?P05"? #v P4&0 п >@ #"s"0"$ +Ѿ 0/!B  #"p3BP/ / & #P!7V0C"Q !U / ?a" @p $!  s71p%"A`1^_ -`௯    #B60A&T 2 s@##JO%>$ 3cѠ_:ߟ    DS "'/2p4 7.+a@M`ݳ0BP  "ca#44!3V1 <"@76-   }V"2*0'D0"%@&." #a 061 %Бް" /C%/'@$&"A%P#B10 S3>u '"20޿0  ZP  BA% #P  DQ2!\/`$O1 3~Σ @ ~Ӏ N08T0 ?5 @O @?.."1΀ N. !E "1!p/s( >A?Q>B^< >|0' $B#7/30 " / - NK @<2$@A#^ //&? "6b?" Mÿߒ* 0?=Sӂ>@$AM?p3!_. !? ᱰ * 0<^ L`@ O  ;Ҷ?-EҲ}1%2~1N  ?p@>;?tϪ /2p!/1r55&ATp012b'AQ1"A0S0J: J | ?/.# /p? -O0"40E%@p G%30?/ ,а / / A04 Pq!P"" !"##5343CB!!50p-"ݽ ў  /O"Q A#Q@=`%B30$#a.5p"L$/a,1P@t!!4D4"PSR352Uww /9  Юӭ- 0 d,O qdN.3r1 3A!Cq 0Q!P  07Ma #K T/A@0D+"&#_^P0 ~"o ܁ /!@n00! @^ P-; :P1P&%1' s ?"T r P ѭ !300? .#0L0 G e$Ѐ r#'22"?p%07Qq3яCqA"63QD!$/6A/ DD4?%G0!tE3P 5"56!$A7B/  3@t'&2n_ 17C E#P5&q4p"'$P%#ޮC O M4( BR 031 CGR!/6#bCAA/ ݐ3?2 Q P06B#4R"Q#'=ʿў 4 #: 0CC9EB  @"7M# 03p!"2 #!$-Sހ$#0ӓ@@O/ 5%7#`0r412$>'R1?!1"/.(    C@.P` С#b$ ^'R0 "04@ߑ2/f0`0"// !! . 0u#"$3 &$#Q!00"#@O dB%"#?B3 3 6ڮݿ!UEO4`10!% As 3  '/0 /!.#B11A<"D" d4BR d'!! P1R 7AQ>%1/@/BON0   !000 `#B`-Ϻޟa 242DR"-/ 2.0bq.QDq PZ({,!.)@!~=M ,) 0B*"Q!m!"pO M UBPK0# 0N? N 0=Fp   .@4#}:/ ]= `<0  P& o  /@ 8.PA0  D-rD м`@ @^?2 .  O@ 0+^N`*&  =]`.` `#S"?5@C _ OoP@  p.   ^s"Aq 1 '.t 05>?2 `r _   70-ÿ>Mq=O7!p"34@u"` ,?1/) (԰!  >p; D"%N >. 1r ='/$-/ЯLޠ .@.p?MO?¡  Q`-&/ ' ^ 370r@8 Ю,,@p@.# ,  ,.@С`OP^2a"#r '!`О?" _0Nn_ ݵN! p/6 ??H7?5PO'5P/!%0M0AM  9 "βс?2"# /)#0{#ӑ=`҃jp3ap B`# ݰ##07C&pΞ#%!a" P@1P1#2 1O$"" $ !@5"0-(< 'ݿ "H ݰ  PT%?-RwA"BS o.1]п 0 "Q0$OCE` ! ' vr 04{/" $_ 7!01 w-!PS Orto2s# >A0 P#%O1 p?" @`7  O0! !1R/ 702#3R3443CC%"B$Oqn@#"/"!   G:ӳ 0 ) " /_ 03 P 4;!b  A?^PP&- p21 ?#~ ? .\1 p@-2 c&3?O 7 0. K0! ]C ,Б 0a 0!-s@! f =&=# ^.P>3("= "/ o F?@A /_ 0_S )NA 6@0Q%%90p"O  MpA";.7@ " -9- #' @CP_Qs!.1! 1@1/P/B28@B$  _o/5B0b- EP )"O-+1d"#/@<1 ~ $/)L_]C!6T`A'> \=* P_1~ DP/Դ.# ,P-Ģ,0?,N `@#n* ]"N Q N!@ >=.  P :.p^>@C@"E 0A!. `>="/0.@/15&/1  ` I2!4.p0İKp/`%a#@Ҁ@=jF/ ݁۾""ԟq!#!2@S3"A0q4!D#$ `!  ߮V#!BC!!'!!d0!1AFCR44@?B'PR@q'" '3aA&r */ : >  .0a0'!=? $  0*   $!"2!5#1$$-d. - ПЯW!2=' q?j#t!  ~ @33@ /@_q T 5/,MѠ  =0/ @ґ2T#@_! /r! б "1@ 02#q3C" ),>>11="+?$&O$$0bT pA"0>@%!0p2 . 3@0#. , OP1p4 I0Dp#@C>4q ;P "0'&#^.0m""=~0- O-// #"1-|"m" Ѳ#KL  n>@?'N'M/!-& "ё?4  Ѐ:! ^0l1Bp__π uO!, ^.G!O1-Nӣ<1ղ/ pO`3 ŵ>"G#G"!AU-o\.<0p/ #DU@ͱl1    ?P04m0*/QѰ$jrӀBN2p" А ̰d41 S2rPᠾ #% A"_ @ݠ  T"  !D48 ϟ ݿѱA@a!d/%"Ѐ !r   `& P ߱ #&.@`  ܿ2/ P1='#P22'3s>ޯ= @P BN'///U>04pޱK..>_> ;b-?,.=p !#- ! \ =1 p /.7 00.]M԰8?pMc?D./qQ5"#3C43R35"B3y/B?0!'O  / @p/  TM/. A b.`1=N A, Q/07T MA ]a# 4 & 0v/ 10B5>p #^2L.//m ?ޒ, A"  8 - 0 ? !pp #@ 0p /.!B2o AT"@Q1b.EP^ 1% c A%!+S3(ގM -R"7!"" 3c̰#s 2P#&00"" $0! 2 4 ϟ!͎p3  !C%$13$ !B5'!0"  .!R$0ӍBB!b/"@P $m0a%"!##!a!B_ _% 4/?j# ^ /O-O-1P 0=@O>2 71#@!?Ӿ1J1#/#p.~>4#?bR/## #s0 -3R #\4N&! !@,>P0rO -0O !0A "4 A/ ?'. a#=51 0< # P_P @P3^/ !D@.Qb Ѳр0@?3V$ @DT##Ao+jq#<%A '.KP@.P!qP.C.O@/" ]%22Sa!@<Ѐ1O s52! @B?C#36#!" ߰P/вP@0  " #/Н R04 B '!4^ 0-. ߯ "00SϯBR%1D#rA@!N`Mc7-Aq%>!cPВ/JqQ_AP >pp?!10G?O@.0 ! P Э1*"`Q 3 : =!2/7/1@_43COO?=A . )  "'P0 P 'r + |#> //=4<P+*!!1._#p<   ;p1~0 7? "H ұ 9/=n@ 0_. ~/ @ o \!?S p @aM=,   ` _"?+00   Ӑ",L M> M' "0!O%: ?  /# _ӑ*'@ ^< #2A< # /O]0~@L(3*1.PN&@< 'L>rұK>P( Ա0/ Aҕ/> Pl10N]m  @ 3<<(M< ?o  Ӎ0= #Ԡo!.SM M O; /NO#C072" +а _$/> .P0 + >O >"'0QN.,   ò . &BNM,N-=0$L_?1&"0'!#P$ 9  âŰ0-P/  1m.m1!p5r ? |^= ? ,"@ s _@ ,} */ _!- .(! Mp0;.O!0m=O"3S >@R/@Pp/0qN#0@.O30N@81= Q1Q.pC<G$ .14>?N$12C3D#CMK"]0 H+(`]!o(0?A / L??1oC `20?' =A1`/0Q.(oa%!3=!' 7 C/5#"#P5# @$"Aq7R%5`H  @   $FObB35 1"b4"P$A$bE !0 #`"a7pe4B"#srQ32 p" ' BAr #0+D>6"#r %! ,0  F" A$7?5? .6" 1 O> "" . 0'!Bܿ2a0 34<B" _%1Dq-N! ί q$2#3 1$0as"+ a0!P /N1_"502/ #G * 1-+ !!R? !B2p Gq (2/% M, p"70P G@2N !a 2P K !BDB#sB ME2 rD!Ѡ 1%&$!U#" Es0 H r O4BoA3r!"`>`ϟ!O"<0 s?~,"`75!RQ1"01/)/# J/ta! " B!( Sp`4 %$ ]Q/ !4 ,`?,#Q Cb$A?BO  P1q-0P0D b1r@0 ZJ .$-QƟ2 !B/p&C0@2 $1^ "ь0iqp? _0o 0`R54q'mM"/ O?. 02 P@"@PAн@&o1  .b@C? ( !CO@B,p #." 06$10n A3< 6ޠ  s ##¿SQ-1 "S R OR N u! &rP p4@ S0 %2Sr P!0OPp/ & t0_ p2 0EQ#'A >p @#0PaQ30 ޹<   @ /$" p'#C2o'4R%rD?D@'@ @ Qr3O3!0`\ "2&'!362sS2QP$LBߐQ! t /"43BRz4 P3E DPNQ"@ "% .3 da 773@!0!23#"M'@a_A$2; S"$#0B,%`ݿ">Ou # ο"C !/a % !O'" 0D!!@/ a=A,!߲4 % 10Q@ 0 a M. <@= 4ߎ_@ R!n! ^"O 15N7N  / У- 30D 4@-^<0 @Dѿ o l @ ,p$ =âQ p 0 ]~.c+##,"q!$ ~0?_?#"+B= _) 1P o A @!PQ"B_?*#`#=! 1=m ^  !0 %P/, M"=! ALr;2 "nP ./R#?p/03.;!+0C.  'b K00s F"0/`0R EBΐ 3  "!6!ݮ0%˿Tp*5!  ^?7?   0A]~þq2Ѳ. % Aqн@} q /022  3w+0Na0@!!!#$$"4#C3CCBB3C>O    O0^8"- 5 1] O@"aP%,0?'1ݳ1%_0ߎ@1p0@? !+@.N 5$/#,~9#""K @,  @" ;$+; SA Ѐ. ;#;[NN#]Ң _1 ]1 q"N70p@>N1 >. >1!q` 3 PqP/<\5 ,^" ! Ҳ '>= /O//0o# p1>A R;@,`-ޱQ!MB@ $ /n@."-_K~01=B/M`  @H 30o/&%=0l-> P 11"10?9?<4 P0p/0oA " ;! *!"R0! @ " Ѐ0_?Ѐ"?p@"PP@ !;p  ? ! E_/+@ӱ? GP  (! O'N @@r= !#p4`O!#, >02+ 0E4"4 B C-$< 1 5 R#1 ?!.?2c0"!S " =&1P Q273' qPA *"q P- / @ " sCа 1'3 ٠2A   $!QbFP@#EC "@?!@4\@R?+00q ?pހ `@!# An/ΰ 944!٠, /40% @!1%<%0] ̏A& ,#O # Nހ_!@Br-A41p3p_0#  "ў!DS.r # 1P0P6 2P  @ BD@*?D$%"߀-AQ @0a&1!>ݢ0s>o1! qA R,"@!Aϐ ! +`P' 30E3s!'12 125.0 S]%P/$ 0p N/CA#  ;0P# 'Oc"pBQ6$U'2)r` C@".$# 2 ,"0/!/7 52#p " P/"0'2!  P!pAB2.2t2~IBU rNA$o!@B~4" @ޏ!) %" 1CTހp ! 0ݍP"#24!P3Q0 EE pC"3$C 42$#Э" "ޞ0A"ᾟ 27Q6S##rа %1c" f!BE! 7!%& a3 # C #=Q! #ޠ3  0p "So#B s/cD$A! : Q`D  A6 B  5%r7B"K$ 4%"d# DB "0R& P"1 A O!6% R171@#3 Q !#0o7-  BPb &!& !?=M] O" pP^.3R^./2 :1 aԱ0<$v#P"!  P =30&?=M  dS0s߰ ^ QP E  0 4 AB2 P/ -.(6/6A  > !B$"=*c B@3 $R"P#%#A %A7%PA@ '501`3.͠Mͮ ߞ έ" FR!$01pp1+##r3A#@R!%4 4# 2P 4 }21@a!D12'` = 1  P.p +o10A    R $q2` D03 " S3O"` s  4?bTsvq q- p3",Bo^/߰ "0- '.B>? n OP%0#^԰@><=$'! ,f0]M1 .n@#.O16o 1 = !/ʏ"1  0 ]/X$/ps!"  />,rA $!"/u %p2  6o.'O  @/ .#//ӈ  0` P j&4  1C2a0p 1@1'0p#EnR#10 /( a1 /7q!%  @q!($Ra`!2 ޮ!R$27 5!"R- ?a ?P#&1P--#* P 00 RB 7A>ӎq ^ "Or1o@*$! 5?1@%/#/   !$B/ "  S3 7. ~O&!A  5 1!P! p,sU؋ LAC  p K _" ^/@O!AB_/@$!\-   pO .b!a=Q5!  #'  >5F' "?0`E5˰ޠ!2$ ϯba, ݯ0r6##wT$ A66@" #& CF' к0 3ذS35Q14!Cޏ0q0> u%5A#"#750"&$&"22DAp4 ߰Q ހݯ!ܟt#%25!Ra5!Q#%2c#$1 $#6#65#$  Я ܿA 'B#r#QbA=R"b'3S'?$# ;/ "? /$G@ +@@0 P0'.122,10AO 1. ^pK!p ! 2@!> 0p@ /?߁ 0_N 01A;w48 SP    &q$@@J G4 ۯ0 Ѱ/ 1.@%#0!R  P@A`..!0p= `!#P2(0 > / 21! S/e"@Q й @@7@!/ & &!1>1 P1/% P3ĉ"*D#7p3Q""7 4 2'C³r$ !B4nn      . ~o%  -Ұ? A%3Bq$r."ݏH ,$O!(2!9 =P=A ? 18">- 21  ν%Р,С 1~@0@ o=/@P/' >& _ @1L#ߓ ߠ  wP#@$"`?  pP-5]=!% 0l0./.=N < Q2LQ0 < π /0=@0=1-C-# #PТM ^/    ѱ 3 # %BO_;M==+"01@`/~O;+   k0. ?-@ o"P ?    0P2P/%.3B] NA j% Q3a"&BA41C@3пӡ ? q PSApD.2܊ݯݽ &"Q""%"T4 @rA"P@0%Gq!#18 R6"05 "'0x;ݠ"#&!`R!'_M`.! 7#q>" / %UL#M + /1# pt.5   Q v#`0 @    =$#n"p0R!#%J2  r3= o A# @@"  ߲  / $Q$  ~N$ EOC  Br% !DB4R $ R,.40͍PB0 q#3 #,2B D6!306! U%$RA1>"1P 0ޒ n P^21>`0& b32 !3p2Cpa #"  .0p@N.0Bo,;!Q`@ 2?TCQ(ѡ).4#p.?> 2# ¿ё  0!@="`( ;-@0@!!B?23s2@ ( > 1#  А-a@%<.>1 q#3 t== O $nҀ/ .$A3A(`( ? 3P%.? 6a@5.0 =!/023@ @>N0b 2.`/  Nn#OЎݏ `P/ Ӱ Р  OP -A#.@. +;#p0'5"!"q@2 ز, + } #- - .C"O_?!$a0a0a*1_,%_ !! Q#/++ /NNB$k "p ! bp1a$02Q/3@D$0@^ + !: -=>  30^A PI P /"2n&!#!@. 20~  İ=>-N_"/`^ /3p#!2 O'"3P5!&B" !)2] 0 8=Č9 /o.? P@(= >AO"P%nn"`Ӏ ѱ _>@ 2^Q@.z$/25p p!.@#a2= ?.,L@< B0 ? / A@3@>BO6!"C/H , $!p1#0O 0a_8 > =1>NO3%%_K1  qN 2_.B02#0 / C p o1$ Qb )  p0//r=q 43  ޠ @ݧ$/P.%O 0ހ 1?P 2p  -ߐSS&@A=q"0` #/ AA?Ё#2s # Hѐ2 Cp! ߀/c 11j `  " B᳢u2"00=0p""R  O$԰<ʹޠ $"03 c2 _B _" 03P2> #747~"  ЏPa.0Ӏ2 A3/ `1BӁ F"   !B ""A*rЂ=В &a37-@. 0 .-5#M0 V>" Тܐ2#4@A B# 0̑10q 0 3343F"/ +./0 Ѐ5¡@0_  Ѐ .qp00NSN_ 0ӎ5Pҳ/@?@ @// АѱҐa@c7!0ё3u5$###CRA!  D71&$4445#4C434#"̭&5CD44444333 v %20P6!25@ A"E5@4P#"#q1&@@P=p0/ . /+! nB@Q2._& 0#bp!6/1_#?C|#J P} @2-Ų    /J OQ; +PL0"2M.$_^?P*/NH  " ? - `3#"1S ?`<,/*!M>@0-;_! OP0>^K  .9" .E` PN` K$_ D  7F-q00P Qp F0C@. O_.@O$;~ ~O#"}F$Q+. $B@ 6A7Q!  + 2@??u.gAG0'@3D" 75c!C=P0 . 1 *.roC1!33&!% m c<^#@ 2<@Q4 -П!oA/@!/0A2AQ>!3'qpѰPݠ!2 /0.0_0@?o -݀1 pO   qaЂ+@ 0!@&^U ,] 1! @ /A 8` N ,'Q Bp`#ܠ@0<N;/b @0rpq!QCFC00 "&"? .0  "#3 @#`1! 3%D!& Oހ  U7a4Ip!  @7sR$?p 5/@^ S.1/ P/p! D P !s= ~! ?>P- P-.P  0ޢq $ 6[p'2/8ҐK7@2 ! PPgU.p 0p "/>#-ϲ!@/$NOo#%p :# %@Q1 #' 1`>#; 26O&Rp.! P ><pC/ $m.s @ ?N !+A#@"P !!2n6# 1 .4?/-2O0!MQ0 ' ~2!#63OA<M/  M31?1t@2~   p 6Q$@"7#"D3#0FR 5N 0 2SP"A% у LP#TC0q$r0@!;,  45,7A OЀ  @P4 /m "1P 4/! /?"   Q  > 1s Б //#CR $#4%@%B#"p#"b.-,Ѡ q#^π2 p_- ܰ ra$P0S#71%B50 * " 1B*^@Q=b0Q" 3 1D P?&$kqA R#` "/NA0/R  > 2/AP O5`?BOPБ$ @ 0Ec/,~#n8 P12R #27>-'@B@r .3= a2! 5-E!6"n./@"p3?3A<GA~= /p!`N#`BaPomA5a0S P  #8>3 QQ 39OPp @@ 42 0P >@-6 2 2 10%0:@/\@]4q ^4$ ./7 `=o-A-$p0-q0& 2@ 1Ӣ> ##o!?+3 .K O>0^-,m"NO!^ H!L;~' @@B0zN(:O. ? 1@:4^<`8 m <L ^ MC+ -> '  D#A @PN/@/J`nmP=~ 9/!+@: \ N 'P>>N 3` @  @3+-/-m_ } #MLL~> @~.MM O 0.>AN-00/ 2/ =0 ,>- @nMnK <'p 0'0N`  8M@ҷOKӿ@ + p!04/+_->(o!?%0 0a2 A "01 UJ/  'p9/<   ?F?A 8% 0 4 ? `7B=6 ?` @N.-O3qAp @.-%0pp""N0&@0DN0A 7 @" ݻ>0^7P/ 6@%-n= \/ D! + н  1 &"P!O1 @$ O.O,P -@  "No0*+ +@T.v _R!-#O""6 9#'@G!.$2>Pb @:߰" w04!'" <O 4[0'. 1 0' $p? ްп !^/435 ";> T#'$B'0?0 q@0D" 1&o!?#"`0" s"%A`R!&$#,P$U 1   ݀  -.?q 0PD> "a*P.?%@#`0'50 Oа )!" 4#&aq Q 2a1#C0հ+120+"@S< ?>'b@`qQ. CPB0ARQ@ Ѐϰ/!! # C3Б'q"#c4t%/  .ހ/"`_ 2 0$) 2@4"b05 !5"R R#"0  A@Qp / 0c u C ' @.!  s$, 11 07  1O *w/p@  .4".!$ 1 # B" #4N"r@sP'#/72P C`0'2%BQA0`?P   "- A. @; 1 @;3 qpM72_$1Dq@> @ .Э@#/0  .T0- PTp"0 #0"7!C`$! 8 3&7`5 !. PА 0"< #p4!R@4 20'# D4 "1 D  P9 D 40A/4!3% 3gA'36$dQ!Bp!1 `9P p/1.w@O?P|0/|}00 ("@;#"07*!p##0t  L1]?&   sN  5#-=_0F.0b@ C [/^$  0? /г OrM * =)1o/1 @/p N>.=N ._=r0!0/A +<0  `!p/A>P@ 0 0! ? /<> POo@^NN&Mp0)O,,>1.!5'^?N/"+o00") <Հ @L# v?5O"SO>B   .0 6J ;" 2/ .r т_ À;n..3M0$ >? zF8@ p4 S251 R C4 p$!RB @&b s"  3@0"Q2P=  / 46!q `"C"C@ Tp q ͟ @#b F# 1w"#D`T0>%-^ ,_ > P030 JR _%/b !.0t?-2 @" (  A . PD+! @Lp 3;R%E2 ? + #EqP#p!#PD B  !A&c=T4>.( !p=5  ߲ а  ,. W0`$/5.B!a1 "ݐB.1?Bތ" 2002V Q2 #E1!q-$ ^2oo$ 3C $0ѿ$4, S !=_  p ݠ L!'4q$ 7&33t3C#"24#!b0 /  ! S G 1+ <p"m/?`!@& ?5N2._/0``  0CM?o-M? _-} >  /M  N?L=+0}  00 \9M?p0+0p"O.#"Qp~,=0  /L @-(  ? 04 ./*; N >ó*` 8J/;(/<,N;}.0o/* :/ O`8   m$/lJ ? oM#4 =]/+-<;1 /<#)8  0%!Op6,#^$M_AO_ L(/0Pm50 &> !- _" @ N?"/B3O 3D K, "!`/p@b! >> -$P/' Cݣ:Q #. N a"> ='a 3';7<P0 qo2-$L !~ p0H/Pp ' ?2~ O?N`!2 ?"  61ѣS ,. 0ҀB/n`./0 p 0o] -"]0>`/ @lC?pӲO/!@3+ .ͱӳ-".>@п@= ߰ "q '2*аb21"4T@2SD#" >6_RD"20@P22`1C2.  PPPܰ 45%#u$CCЎ Ob&. ϰ %02b$ /!2Cr @ S0$2C3&$5%#2M!/ u&6%QB0c/  753/$6߼@ A2Pܞ"?0s10 !U 50 #' 722` Ο!ߠ "QA @ O=/?0##&" a Q'/! ь"$7%p=M!P !;(#a@ a  sP,+`p3%? .Ͽo1C ^O.#0s0#0 "@!  n! %4@oQ 㲿BARSC` 0q4P-p1q!>& @/oR &  O ppѰ!   ! BAD ."O0Sݱ;` ` $Ob qP" `#Pѿ#& ]Ӏ Ҿ/r с. QР.0,"0&r/.@ :#OO$ 7#Ԟ",. Oҟ.]ގ B =s#q$25 !`!a P0U `4 10 ^@ #xv  .',K0 #p.&  &f @w % <! ! o  #3 %а O!B  '> !2a1R72@A SBO1r M1O#A0  5 ޾!q 004/" 5"#76D! 2/ΟQA  R/U6!07`""1 $''  /$  SC3'2Qt0-000U),= %=0À)~#A7!!Ap!&!/6?"OӠP+.ϰ/͐".@ Q5r/<ЀNq0C!%r!SC"!//`A/'0! 4Q#-O= 0PϠ/p." /= A `͏]7!#!` /:ΰ-   "243r%j6  ?I#7G= #Cq0146P   #7""# ߏ ? 1A4t!?AT"3170ѐߑ݀͞ AqSR23!/F'Qp/ a$Rr""!> >!  ߰O` 51`?1  p>ώ./P#"65 Q&#CҠ 5π$DD4$443D34353C3S#334"$"!'b55434C$4D3R#444443CCC444443D43CC4443CCC3C343C33C333#ݮ޽*!!" pQ A!C'"0BU 0__O0@1P0D C%N# O#2ND/m?-3 |*$.3!%0Np0!0s3?'.RR@SD q 2@ mL / $   p` \1 W !` ~!-B 3.  1!0#ON/ B R =/@C0 1 . , ^^M 2?O}Ѱ. ° `n1P!]T=//P#+5=< I<C G0q`M/0/ #<2@AP5T!  ~O <Ԑ  `B""'Oq"!t!D 1` `1B0#A 0 OA $" q 2 RN N "`*:0-O"#a,4PPO ?/7 ڰ ' o_`Q!*@ 07#a #Z00. Tߐ0#O?1_G1$`%> ?- A@S@0% "#.?t`N ,26 ]2` b/W  $D2ݏO> 2#`O$"0BCr 3P"O / @0' "?B7!@t/P  2t 0p#66P3/ N 3  / 3ssdl12-compat-1.2.74/test/testalpha.c0000664000000000000000000003305714145137266014074 0ustar00 /* Simple program: Fill a colormap with gray and stripe it down the screen, Then move an alpha valued sprite around the screen. */ #include #include #include #include #include "SDL.h" #define FRAME_TICKS (1000/30) /* 30 frames/second */ /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } /* Fill the screen with a gradient */ static void FillBackground(SDL_Surface *screen) { Uint8 *buffer; Uint16 *buffer16; Uint16 color; Uint8 gradient; int i, k; /* Set the surface pixels and refresh! */ if ( SDL_LockSurface(screen) < 0 ) { fprintf(stderr, "Couldn't lock the display surface: %s\n", SDL_GetError()); quit(2); } buffer=(Uint8 *)screen->pixels; if (screen->format->BytesPerPixel!=2) { for ( i=0; ih; ++i ) { memset(buffer,(i*255)/screen->h, screen->w*screen->format->BytesPerPixel); buffer += screen->pitch; } } else { for ( i=0; ih; ++i ) { gradient=((i*255)/screen->h); color = (Uint16)SDL_MapRGB(screen->format, gradient, gradient, gradient); buffer16=(Uint16*)buffer; for (k=0; kw; k++) { *(buffer16+k)=color; } buffer += screen->pitch; } } SDL_UnlockSurface(screen); SDL_UpdateRect(screen, 0, 0, 0, 0); } /* Create a "light" -- a yellowish surface with variable alpha */ SDL_Surface *CreateLight(int radius) { Uint8 trans, alphamask; int range, addition; int xdist, ydist; Uint16 x, y; Uint16 skip; Uint32 pixel; SDL_Surface *light; #ifdef LIGHT_16BIT Uint16 *buf; /* Create a 16 (4/4/4/4) bpp square with a full 4-bit alpha channel */ /* Note: this isn't any faster than a 32 bit alpha surface */ alphamask = 0x0000000F; light = SDL_CreateRGBSurface(SDL_SWSURFACE, 2*radius, 2*radius, 16, 0x0000F000, 0x00000F00, 0x000000F0, alphamask); #else Uint32 *buf; /* Create a 32 (8/8/8/8) bpp square with a full 8-bit alpha channel */ alphamask = 0x000000FF; light = SDL_CreateRGBSurface(SDL_SWSURFACE, 2*radius, 2*radius, 32, 0xFF000000, 0x00FF0000, 0x0000FF00, alphamask); if ( light == NULL ) { fprintf(stderr, "Couldn't create light: %s\n", SDL_GetError()); return(NULL); } #endif /* Fill with a light yellow-orange color */ skip = light->pitch-(light->w*light->format->BytesPerPixel); #ifdef LIGHT_16BIT buf = (Uint16 *)light->pixels; #else buf = (Uint32 *)light->pixels; #endif /* Get a tranparent pixel value - we'll add alpha later */ pixel = SDL_MapRGBA(light->format, 0xFF, 0xDD, 0x88, 0); for ( y=0; yh; ++y ) { for ( x=0; xw; ++x ) { *buf++ = pixel; } buf += skip; /* Almost always 0, but just in case... */ } /* Calculate alpha values for the surface. */ #ifdef LIGHT_16BIT buf = (Uint16 *)light->pixels; #else buf = (Uint32 *)light->pixels; #endif for ( y=0; yh; ++y ) { for ( x=0; xw; ++x ) { /* Slow distance formula (from center of light) */ xdist = x-(light->w/2); ydist = y-(light->h/2); range = (int)sqrt(xdist*xdist+ydist*ydist); /* Scale distance to range of transparency (0-255) */ if ( range > radius ) { trans = alphamask; } else { /* Increasing transparency with distance */ trans = (Uint8)((range*alphamask)/radius); /* Lights are very transparent */ addition = (alphamask+1)/8; if ( (int)trans+addition > alphamask ) { trans = alphamask; } else { trans += addition; } } /* We set the alpha component as the right N bits */ *buf++ |= (255-trans); } buf += skip; /* Almost always 0, but just in case... */ } /* Enable RLE acceleration of this alpha surface */ SDL_SetAlpha(light, SDL_SRCALPHA|SDL_RLEACCEL, 0); /* We're done! */ return(light); } static Uint32 flashes = 0; static Uint32 flashtime = 0; void FlashLight(SDL_Surface *screen, SDL_Surface *light, int x, int y) { SDL_Rect position; Uint32 ticks1; Uint32 ticks2; /* Easy, center light */ position.x = x-(light->w/2); position.y = y-(light->h/2); position.w = light->w; position.h = light->h; ticks1 = SDL_GetTicks(); SDL_BlitSurface(light, NULL, screen, &position); ticks2 = SDL_GetTicks(); SDL_UpdateRects(screen, 1, &position); ++flashes; /* Update time spend doing alpha blitting */ flashtime += (ticks2-ticks1); } static int sprite_visible = 0; static SDL_Surface *sprite; static SDL_Surface *backing; static SDL_Rect position; static int x_vel, y_vel; static int alpha_vel; int LoadSprite(SDL_Surface *screen, const char *file) { SDL_Surface *converted; /* Load the sprite image */ sprite = SDL_LoadBMP(file); if ( sprite == NULL ) { fprintf(stderr, "Couldn't load %s: %s", file, SDL_GetError()); return(-1); } /* Set transparent pixel as the pixel at (0,0) */ if ( sprite->format->palette ) { SDL_SetColorKey(sprite, SDL_SRCCOLORKEY, *(Uint8 *)sprite->pixels); } /* Convert sprite to video format */ converted = SDL_DisplayFormat(sprite); SDL_FreeSurface(sprite); if ( converted == NULL ) { fprintf(stderr, "Couldn't convert background: %s\n", SDL_GetError()); return(-1); } sprite = converted; /* Create the background */ backing = SDL_CreateRGBSurface(SDL_SWSURFACE, sprite->w, sprite->h, 8, 0, 0, 0, 0); if ( backing == NULL ) { fprintf(stderr, "Couldn't create background: %s\n", SDL_GetError()); SDL_FreeSurface(sprite); return(-1); } /* Convert background to video format */ converted = SDL_DisplayFormat(backing); SDL_FreeSurface(backing); if ( converted == NULL ) { fprintf(stderr, "Couldn't convert background: %s\n", SDL_GetError()); SDL_FreeSurface(sprite); return(-1); } backing = converted; /* Set the initial position of the sprite */ position.x = (screen->w-sprite->w)/2; position.y = (screen->h-sprite->h)/2; position.w = sprite->w; position.h = sprite->h; x_vel = 0; y_vel = 0; alpha_vel = 1; /* We're ready to roll. :) */ return(0); } void AttractSprite(Uint16 x, Uint16 y) { x_vel = ((int)x-position.x)/10; y_vel = ((int)y-position.y)/10; } void MoveSprite(SDL_Surface *screen, SDL_Surface *light) { SDL_Rect updates[2]; int alpha; /* Erase the sprite if it was visible */ if ( sprite_visible ) { updates[0] = position; SDL_BlitSurface(backing, NULL, screen, &updates[0]); } else { updates[0].x = 0; updates[0].y = 0; updates[0].w = 0; updates[0].h = 0; sprite_visible = 1; } /* Since the sprite is off the screen, we can do other drawing without being overwritten by the saved area behind the sprite. */ if ( light != NULL ) { int x, y; SDL_GetMouseState(&x, &y); FlashLight(screen, light, x, y); } /* Move the sprite, bounce at the wall */ position.x += x_vel; if ( (position.x < 0) || (position.x >= screen->w) ) { x_vel = -x_vel; position.x += x_vel; } position.y += y_vel; if ( (position.y < 0) || (position.y >= screen->h) ) { y_vel = -y_vel; position.y += y_vel; } /* Update transparency (fade in and out) */ alpha = sprite->format->alpha; if ( (alpha+alpha_vel) < 0 ) { alpha_vel = -alpha_vel; } else if ( (alpha+alpha_vel) > 255 ) { alpha_vel = -alpha_vel; } SDL_SetAlpha(sprite, SDL_SRCALPHA, (Uint8)(alpha+alpha_vel)); /* Save the area behind the sprite */ updates[1] = position; SDL_BlitSurface(screen, &updates[1], backing, NULL); /* Blit the sprite onto the screen */ updates[1] = position; SDL_BlitSurface(sprite, NULL, screen, &updates[1]); /* Make it so! */ SDL_UpdateRects(screen, 2, updates); } void WarpSprite(SDL_Surface *screen, int x, int y) { SDL_Rect updates[2]; /* Erase, move, Draw, update */ updates[0] = position; SDL_BlitSurface(backing, NULL, screen, &updates[0]); position.x = x-sprite->w/2; /* Center about X */ position.y = y-sprite->h/2; /* Center about Y */ updates[1] = position; SDL_BlitSurface(screen, &updates[1], backing, NULL); updates[1] = position; SDL_BlitSurface(sprite, NULL, screen, &updates[1]); SDL_UpdateRects(screen, 2, updates); } int main(int argc, char *argv[]) { const SDL_VideoInfo *info; SDL_Surface *screen; int w, h; Uint8 video_bpp; Uint32 videoflags; int i, done; SDL_Event event; SDL_Surface *light; int mouse_pressed; Uint32 ticks, lastticks; /* Initialize SDL */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } /* Alpha blending doesn't work well at 8-bit color */ #ifdef _WIN32_WCE /* Pocket PC */ w = 240; h = 320; #else w = 640; h = 480; #endif info = SDL_GetVideoInfo(); if ( info->vfmt->BitsPerPixel > 8 ) { video_bpp = info->vfmt->BitsPerPixel; } else { video_bpp = 16; fprintf(stderr, "forced 16 bpp mode\n"); } videoflags = SDL_SWSURFACE; for ( i = 1; argv[i]; ++i ) { if ( strcmp(argv[i], "-bpp") == 0 ) { video_bpp = atoi(argv[++i]); if (video_bpp<=8) { video_bpp=16; fprintf(stderr, "forced 16 bpp mode\n"); } } else if ( strcmp(argv[i], "-hw") == 0 ) { videoflags |= SDL_HWSURFACE; } else if ( strcmp(argv[i], "-warp") == 0 ) { videoflags |= SDL_HWPALETTE; } else if ( strcmp(argv[i], "-width") == 0 && argv[i+1] ) { w = atoi(argv[++i]); } else if ( strcmp(argv[i], "-height") == 0 && argv[i+1] ) { h = atoi(argv[++i]); } else if ( strcmp(argv[i], "-resize") == 0 ) { videoflags |= SDL_RESIZABLE; } else if ( strcmp(argv[i], "-noframe") == 0 ) { videoflags |= SDL_NOFRAME; } else if ( strcmp(argv[i], "-fullscreen") == 0 ) { videoflags |= SDL_FULLSCREEN; } else { fprintf(stderr, "Usage: %s [-width N] [-height N] [-bpp N] [-warp] [-hw] [-fullscreen]\n", argv[0]); quit(1); } } /* Set video mode */ if ( (screen=SDL_SetVideoMode(w,h,video_bpp,videoflags)) == NULL ) { fprintf(stderr, "Couldn't set %dx%dx%d video mode: %s\n", w, h, video_bpp, SDL_GetError()); quit(2); } FillBackground(screen); /* Create the light */ light = CreateLight(82); if ( light == NULL ) { quit(1); } /* Load the sprite */ if ( LoadSprite(screen, "icon.bmp") < 0 ) { SDL_FreeSurface(light); quit(1); } /* Print out information about our surfaces */ printf("Screen is at %d bits per pixel\n",screen->format->BitsPerPixel); if ( (screen->flags & SDL_HWSURFACE) == SDL_HWSURFACE ) { printf("Screen is in video memory\n"); } else { printf("Screen is in system memory\n"); } if ( (screen->flags & SDL_DOUBLEBUF) == SDL_DOUBLEBUF ) { printf("Screen has double-buffering enabled\n"); } if ( (sprite->flags & SDL_HWSURFACE) == SDL_HWSURFACE ) { printf("Sprite is in video memory\n"); } else { printf("Sprite is in system memory\n"); } /* Run a sample blit to trigger blit acceleration */ MoveSprite(screen, NULL); if ( (sprite->flags & SDL_HWACCEL) == SDL_HWACCEL ) { printf("Sprite blit uses hardware alpha acceleration\n"); } else { printf("Sprite blit dosn't uses hardware alpha acceleration\n"); } /* Set a clipping rectangle to clip the outside edge of the screen */ { SDL_Rect clip; clip.x = 32; clip.y = 32; clip.w = screen->w-(2*32); clip.h = screen->h-(2*32); SDL_SetClipRect(screen, &clip); } /* Wait for a keystroke */ lastticks = SDL_GetTicks(); done = 0; mouse_pressed = 0; while ( !done ) { /* Update the frame -- move the sprite */ if ( mouse_pressed ) { MoveSprite(screen, light); mouse_pressed = 0; } else { MoveSprite(screen, NULL); } /* Slow down the loop to 30 frames/second */ ticks = SDL_GetTicks(); if ( (ticks-lastticks) < FRAME_TICKS ) { #ifdef CHECK_SLEEP_GRANULARITY fprintf(stderr, "Sleeping %d ticks\n", FRAME_TICKS-(ticks-lastticks)); #endif SDL_Delay(FRAME_TICKS-(ticks-lastticks)); #ifdef CHECK_SLEEP_GRANULARITY fprintf(stderr, "Slept %d ticks\n", (SDL_GetTicks()-ticks)); #endif } lastticks = ticks; /* Check for events */ while ( SDL_PollEvent(&event) ) { switch (event.type) { case SDL_VIDEORESIZE: screen = SDL_SetVideoMode(event.resize.w, event.resize.h, video_bpp, videoflags); if ( screen ) { FillBackground(screen); } break; /* Attract sprite while mouse is held down */ case SDL_MOUSEMOTION: if (event.motion.state != 0) { AttractSprite(event.motion.x, event.motion.y); mouse_pressed = 1; } break; case SDL_MOUSEBUTTONDOWN: if ( event.button.button == 1 ) { AttractSprite(event.button.x, event.button.y); mouse_pressed = 1; } else { SDL_Rect area; area.x = event.button.x-16; area.y = event.button.y-16; area.w = 32; area.h = 32; SDL_FillRect(screen, &area, 0); SDL_UpdateRects(screen,1,&area); } break; case SDL_KEYDOWN: #ifdef _WIN32_WCE // there is no ESC key at all done = 1; #else if ( event.key.keysym.sym == SDLK_ESCAPE ) { done = 1; } else if (event.key.keysym.sym == SDLK_t) { videoflags ^= SDL_FULLSCREEN; screen = SDL_SetVideoMode(w, h, video_bpp, videoflags); if ( screen == NULL ) { fprintf(stderr, "Couldn't toggle video mode: %s\n", SDL_GetError()); quit(2); } FillBackground(screen); } #endif break; case SDL_QUIT: done = 1; break; default: break; } } } SDL_FreeSurface(light); SDL_FreeSurface(sprite); SDL_FreeSurface(backing); /* Print out some timing information */ if ( flashes > 0 ) { printf("%d alpha blits, ~%4.4f ms per blit\n", flashes, (float)flashtime/flashes); } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testbitmap.c0000664000000000000000000001006212115006433014234 0ustar00 /* Simple program: Test bitmap blits */ #include #include #include #include "SDL.h" #include "picture.xbm" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } SDL_Surface *LoadXBM(SDL_Surface *screen, int w, int h, Uint8 *bits) { SDL_Surface *bitmap; Uint8 *line; /* Allocate the bitmap */ bitmap = SDL_CreateRGBSurface(SDL_SWSURFACE, w, h, 1, 0, 0, 0, 0); if ( bitmap == NULL ) { fprintf(stderr, "Couldn't allocate bitmap: %s\n", SDL_GetError()); return(NULL); } /* Copy the pixels */ line = (Uint8 *)bitmap->pixels; w = (w+7)/8; while ( h-- ) { memcpy(line, bits, w); /* X11 Bitmap images have the bits reversed */ { int i, j; Uint8 *buf, byte; for ( buf=line, i=0; i=0; --j ) { *buf |= (byte&0x01)<>= 1; } } } line += bitmap->pitch; bits += w; } return(bitmap); } int main(int argc, char *argv[]) { SDL_Surface *screen; SDL_Surface *bitmap; Uint8 video_bpp; Uint32 videoflags; Uint8 *buffer; int i, k, done; SDL_Event event; Uint16 *buffer16; Uint16 color; Uint8 gradient; SDL_Color palette[256]; /* Initialize SDL */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } video_bpp = 0; videoflags = SDL_SWSURFACE; while ( argc > 1 ) { --argc; if ( strcmp(argv[argc-1], "-bpp") == 0 ) { video_bpp = atoi(argv[argc]); --argc; } else if ( strcmp(argv[argc], "-warp") == 0 ) { videoflags |= SDL_HWPALETTE; } else if ( strcmp(argv[argc], "-hw") == 0 ) { videoflags |= SDL_HWSURFACE; } else if ( strcmp(argv[argc], "-fullscreen") == 0 ) { videoflags |= SDL_FULLSCREEN; } else { fprintf(stderr, "Usage: %s [-bpp N] [-warp] [-hw] [-fullscreen]\n", argv[0]); quit(1); } } /* Set 640x480 video mode */ if ( (screen=SDL_SetVideoMode(640,480,video_bpp,videoflags)) == NULL ) { fprintf(stderr, "Couldn't set 640x480x%d video mode: %s\n", video_bpp, SDL_GetError()); quit(2); } if (video_bpp==8) { /* Set a gray colormap, reverse order from white to black */ for ( i=0; i<256; ++i ) { palette[i].r = 255-i; palette[i].g = 255-i; palette[i].b = 255-i; } SDL_SetColors(screen, palette, 0, 256); } /* Set the surface pixels and refresh! */ if ( SDL_LockSurface(screen) < 0 ) { fprintf(stderr, "Couldn't lock the display surface: %s\n", SDL_GetError()); quit(2); } buffer=(Uint8 *)screen->pixels; if (screen->format->BytesPerPixel!=2) { for ( i=0; ih; ++i ) { memset(buffer,(i*255)/screen->h, screen->pitch); buffer += screen->pitch; } } else { for ( i=0; ih; ++i ) { gradient=((i*255)/screen->h); color = SDL_MapRGB(screen->format, gradient, gradient, gradient); buffer16=(Uint16*)buffer; for (k=0; kw; k++) { *(buffer16+k)=color; } buffer += screen->pitch; } } SDL_UnlockSurface(screen); SDL_UpdateRect(screen, 0, 0, 0, 0); /* Load the bitmap */ bitmap = LoadXBM(screen, picture_width, picture_height, (Uint8 *)picture_bits); if ( bitmap == NULL ) { quit(1); } /* Wait for a keystroke */ done = 0; while ( !done ) { /* Check for events */ while ( SDL_PollEvent(&event) ) { switch (event.type) { case SDL_MOUSEBUTTONDOWN: { SDL_Rect dst; dst.x = event.button.x - bitmap->w/2; dst.y = event.button.y - bitmap->h/2; dst.w = bitmap->w; dst.h = bitmap->h; SDL_BlitSurface(bitmap, NULL, screen, &dst); SDL_UpdateRects(screen,1,&dst); } break; case SDL_KEYDOWN: /* Any key press quits the app... */ done = 1; break; case SDL_QUIT: done = 1; break; default: break; } } } SDL_FreeSurface(bitmap); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testblitspeed.c0000664000000000000000000003277112115006433014746 0ustar00/* * Benchmarks surface-to-surface blits in various formats. * * Written by Ryan C. Gordon. */ #include #include #include #include "SDL.h" static SDL_Surface *dest = NULL; static SDL_Surface *src = NULL; static int testSeconds = 10; static int percent(int val, int total) { return((int) ((((float) val) / ((float) total)) * 100.0f)); } static int randRange(int lo, int hi) { return(lo + (int) (((double) hi)*rand()/(RAND_MAX+1.0))); } static void copy_trunc_str(char *str, size_t strsize, const char *flagstr) { if ( (strlen(str) + strlen(flagstr)) >= (strsize - 1) ) strcpy(str + (strsize - 5), " ..."); else strcat(str, flagstr); } static void __append_sdl_surface_flag(SDL_Surface *_surface, char *str, size_t strsize, Uint32 flag, const char *flagstr) { if (_surface->flags & flag) copy_trunc_str(str, strsize, flagstr); } #define append_sdl_surface_flag(a, b, c, fl) __append_sdl_surface_flag(a, b, c, fl, " " #fl) #define print_tf_state(str, val) printf("%s: {%s}\n", str, (val) ? "true" : "false" ) static void output_videoinfo_details(void) { const SDL_VideoInfo *info = SDL_GetVideoInfo(); printf("SDL_GetVideoInfo():\n"); if (info == NULL) printf(" (null.)\n"); else { print_tf_state(" hardware surface available", info->hw_available); print_tf_state(" window manager available", info->wm_available); print_tf_state(" accelerated hardware->hardware blits", info->blit_hw); print_tf_state(" accelerated hardware->hardware colorkey blits", info->blit_hw_CC); print_tf_state(" accelerated hardware->hardware alpha blits", info->blit_hw_A); print_tf_state(" accelerated software->hardware blits", info->blit_sw); print_tf_state(" accelerated software->hardware colorkey blits", info->blit_sw_CC); print_tf_state(" accelerated software->hardware alpha blits", info->blit_sw_A); print_tf_state(" accelerated color fills", info->blit_fill); printf(" video memory: (%d)\n", info->video_mem); } printf("\n"); } static void output_surface_details(const char *name, SDL_Surface *surface) { printf("Details for %s:\n", name); if (surface == NULL) { printf("-WARNING- You've got a NULL surface!"); } else { char f[256]; printf(" width : %d\n", surface->w); printf(" height : %d\n", surface->h); printf(" depth : %d bits per pixel\n", surface->format->BitsPerPixel); printf(" pitch : %d\n", (int) surface->pitch); printf(" alpha : %d\n", (int) surface->format->alpha); printf(" colorkey : 0x%X\n", (unsigned int) surface->format->colorkey); printf(" red bits : 0x%08X mask, %d shift, %d loss\n", (int) surface->format->Rmask, (int) surface->format->Rshift, (int) surface->format->Rloss); printf(" green bits : 0x%08X mask, %d shift, %d loss\n", (int) surface->format->Gmask, (int) surface->format->Gshift, (int) surface->format->Gloss); printf(" blue bits : 0x%08X mask, %d shift, %d loss\n", (int) surface->format->Bmask, (int) surface->format->Bshift, (int) surface->format->Bloss); printf(" alpha bits : 0x%08X mask, %d shift, %d loss\n", (int) surface->format->Amask, (int) surface->format->Ashift, (int) surface->format->Aloss); f[0] = '\0'; /*append_sdl_surface_flag(surface, f, sizeof (f), SDL_SWSURFACE);*/ if ((surface->flags & SDL_HWSURFACE) == 0) copy_trunc_str(f, sizeof (f), " SDL_SWSURFACE"); append_sdl_surface_flag(surface, f, sizeof (f), SDL_HWSURFACE); append_sdl_surface_flag(surface, f, sizeof (f), SDL_ASYNCBLIT); append_sdl_surface_flag(surface, f, sizeof (f), SDL_ANYFORMAT); append_sdl_surface_flag(surface, f, sizeof (f), SDL_HWPALETTE); append_sdl_surface_flag(surface, f, sizeof (f), SDL_DOUBLEBUF); append_sdl_surface_flag(surface, f, sizeof (f), SDL_FULLSCREEN); append_sdl_surface_flag(surface, f, sizeof (f), SDL_OPENGL); append_sdl_surface_flag(surface, f, sizeof (f), SDL_OPENGLBLIT); append_sdl_surface_flag(surface, f, sizeof (f), SDL_RESIZABLE); append_sdl_surface_flag(surface, f, sizeof (f), SDL_NOFRAME); append_sdl_surface_flag(surface, f, sizeof (f), SDL_HWACCEL); append_sdl_surface_flag(surface, f, sizeof (f), SDL_SRCCOLORKEY); append_sdl_surface_flag(surface, f, sizeof (f), SDL_RLEACCELOK); append_sdl_surface_flag(surface, f, sizeof (f), SDL_RLEACCEL); append_sdl_surface_flag(surface, f, sizeof (f), SDL_SRCALPHA); append_sdl_surface_flag(surface, f, sizeof (f), SDL_PREALLOC); if (f[0] == '\0') strcpy(f, " (none)"); printf(" flags :%s\n", f); } printf("\n"); } static void output_details(void) { output_videoinfo_details(); output_surface_details("Source Surface", src); output_surface_details("Destination Surface", dest); } static Uint32 blit(SDL_Surface *dst, SDL_Surface *src, int x, int y) { Uint32 start = 0; SDL_Rect srcRect; SDL_Rect dstRect; srcRect.x = 0; srcRect.y = 0; dstRect.x = x; dstRect.y = y; dstRect.w = srcRect.w = src->w; /* SDL will clip as appropriate. */ dstRect.h = srcRect.h = src->h; start = SDL_GetTicks(); SDL_BlitSurface(src, &srcRect, dst, &dstRect); return(SDL_GetTicks() - start); } static void blitCentered(SDL_Surface *dst, SDL_Surface *src) { int x = (dst->w - src->w) / 2; int y = (dst->h - src->h) / 2; blit(dst, src, x, y); } static int atoi_hex(const char *str) { if (str == NULL) return 0; if (strlen(str) > 2) { int retval = 0; if ((str[0] == '0') && (str[1] == 'x')) sscanf(str + 2, "%X", &retval); return(retval); } return(atoi(str)); } static int setup_test(int argc, char **argv) { const char *dumpfile = NULL; SDL_Surface *bmp = NULL; Uint32 dstbpp = 32; Uint32 dstrmask = 0x00FF0000; Uint32 dstgmask = 0x0000FF00; Uint32 dstbmask = 0x000000FF; Uint32 dstamask = 0x00000000; Uint32 dstflags = 0; int dstw = 640; int dsth = 480; Uint32 srcbpp = 32; Uint32 srcrmask = 0x00FF0000; Uint32 srcgmask = 0x0000FF00; Uint32 srcbmask = 0x000000FF; Uint32 srcamask = 0x00000000; Uint32 srcflags = 0; int srcw = 640; int srch = 480; Uint32 origsrcalphaflags = 0; Uint32 origdstalphaflags = 0; Uint32 srcalphaflags = 0; Uint32 dstalphaflags = 0; int srcalpha = 255; int dstalpha = 255; int screenSurface = 0; int i = 0; for (i = 1; i < argc; i++) { const char *arg = argv[i]; if (strcmp(arg, "--dstbpp") == 0) dstbpp = atoi(argv[++i]); else if (strcmp(arg, "--dstrmask") == 0) dstrmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--dstgmask") == 0) dstgmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--dstbmask") == 0) dstbmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--dstamask") == 0) dstamask = atoi_hex(argv[++i]); else if (strcmp(arg, "--dstwidth") == 0) dstw = atoi(argv[++i]); else if (strcmp(arg, "--dstheight") == 0) dsth = atoi(argv[++i]); else if (strcmp(arg, "--dsthwsurface") == 0) dstflags |= SDL_HWSURFACE; else if (strcmp(arg, "--srcbpp") == 0) srcbpp = atoi(argv[++i]); else if (strcmp(arg, "--srcrmask") == 0) srcrmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--srcgmask") == 0) srcgmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--srcbmask") == 0) srcbmask = atoi_hex(argv[++i]); else if (strcmp(arg, "--srcamask") == 0) srcamask = atoi_hex(argv[++i]); else if (strcmp(arg, "--srcwidth") == 0) srcw = atoi(argv[++i]); else if (strcmp(arg, "--srcheight") == 0) srch = atoi(argv[++i]); else if (strcmp(arg, "--srchwsurface") == 0) srcflags |= SDL_HWSURFACE; else if (strcmp(arg, "--seconds") == 0) testSeconds = atoi(argv[++i]); else if (strcmp(arg, "--screen") == 0) screenSurface = 1; else if (strcmp(arg, "--dumpfile") == 0) dumpfile = argv[++i]; /* !!! FIXME: set colorkey. */ else if (0) /* !!! FIXME: we handle some commandlines elsewhere now */ { fprintf(stderr, "Unknown commandline option: %s\n", arg); return(0); } } if (SDL_Init(SDL_INIT_VIDEO) == -1) { fprintf(stderr, "SDL_Init failed: %s\n", SDL_GetError()); return(0); } bmp = SDL_LoadBMP("sample.bmp"); if (bmp == NULL) { fprintf(stderr, "SDL_LoadBMP failed: %s\n", SDL_GetError()); SDL_Quit(); return(0); } if ((dstflags & SDL_HWSURFACE) == 0) dstflags |= SDL_SWSURFACE; if ((srcflags & SDL_HWSURFACE) == 0) srcflags |= SDL_SWSURFACE; if (screenSurface) dest = SDL_SetVideoMode(dstw, dsth, dstbpp, dstflags); else { dest = SDL_CreateRGBSurface(dstflags, dstw, dsth, dstbpp, dstrmask, dstgmask, dstbmask, dstamask); } if (dest == NULL) { fprintf(stderr, "dest surface creation failed: %s\n", SDL_GetError()); SDL_Quit(); return(0); } src = SDL_CreateRGBSurface(srcflags, srcw, srch, srcbpp, srcrmask, srcgmask, srcbmask, srcamask); if (src == NULL) { fprintf(stderr, "src surface creation failed: %s\n", SDL_GetError()); SDL_Quit(); return(0); } /* handle alpha settings... */ srcalphaflags = (src->flags&SDL_SRCALPHA) | (src->flags&SDL_RLEACCEL); dstalphaflags = (dest->flags&SDL_SRCALPHA) | (dest->flags&SDL_RLEACCEL); origsrcalphaflags = srcalphaflags; origdstalphaflags = dstalphaflags; srcalpha = src->format->alpha; dstalpha = dest->format->alpha; for (i = 1; i < argc; i++) { const char *arg = argv[i]; if (strcmp(arg, "--srcalpha") == 0) srcalpha = atoi(argv[++i]); else if (strcmp(arg, "--dstalpha") == 0) dstalpha = atoi(argv[++i]); else if (strcmp(arg, "--srcsrcalpha") == 0) srcalphaflags |= SDL_SRCALPHA; else if (strcmp(arg, "--srcnosrcalpha") == 0) srcalphaflags &= ~SDL_SRCALPHA; else if (strcmp(arg, "--srcrleaccel") == 0) srcalphaflags |= SDL_RLEACCEL; else if (strcmp(arg, "--srcnorleaccel") == 0) srcalphaflags &= ~SDL_RLEACCEL; else if (strcmp(arg, "--dstsrcalpha") == 0) dstalphaflags |= SDL_SRCALPHA; else if (strcmp(arg, "--dstnosrcalpha") == 0) dstalphaflags &= ~SDL_SRCALPHA; else if (strcmp(arg, "--dstrleaccel") == 0) dstalphaflags |= SDL_RLEACCEL; else if (strcmp(arg, "--dstnorleaccel") == 0) dstalphaflags &= ~SDL_RLEACCEL; } if ((dstalphaflags != origdstalphaflags) || (dstalpha != dest->format->alpha)) SDL_SetAlpha(dest, dstalphaflags, (Uint8) dstalpha); if ((srcalphaflags != origsrcalphaflags) || (srcalpha != src->format->alpha)) SDL_SetAlpha(src, srcalphaflags, (Uint8) srcalpha); /* set some sane defaults so we can see if the blit code is broken... */ SDL_FillRect(dest, NULL, SDL_MapRGB(dest->format, 0, 0, 0)); SDL_FillRect(src, NULL, SDL_MapRGB(src->format, 0, 0, 0)); blitCentered(src, bmp); SDL_FreeSurface(bmp); if (dumpfile) SDL_SaveBMP(src, dumpfile); /* make sure initial convert is sane. */ output_details(); return(1); } static void test_blit_speed(void) { Uint32 clearColor = SDL_MapRGB(dest->format, 0, 0, 0); Uint32 iterations = 0; Uint32 elasped = 0; Uint32 end = 0; Uint32 now = 0; Uint32 last = 0; int testms = testSeconds * 1000; int wmax = (dest->w - src->w); int hmax = (dest->h - src->h); int isScreen = (SDL_GetVideoSurface() == dest); SDL_Event event; printf("Testing blit speed for %d seconds...\n", testSeconds); now = SDL_GetTicks(); end = now + testms; do { /* pump the event queue occasionally to keep OS happy... */ if (now - last > 1000) { last = now; while (SDL_PollEvent(&event)) { /* no-op. */ } } iterations++; elasped += blit(dest, src, randRange(0, wmax), randRange(0, hmax)); if (isScreen) { SDL_Flip(dest); /* show it! */ SDL_FillRect(dest, NULL, clearColor); /* blank it for next time! */ } now = SDL_GetTicks(); } while (now < end); printf("Non-blitting crap accounted for %d percent of this run.\n", percent(testms - elasped, testms)); printf("%d blits took %d ms (%d fps).\n", (int) iterations, (int) elasped, (int) (((float)iterations) / (((float)elasped) / 1000.0f))); } int main(int argc, char **argv) { int initialized = setup_test(argc, argv); if (initialized) { test_blit_speed(); SDL_Quit(); } return(!initialized); } /* end of testblitspeed.c ... */ sdl12-compat-1.2.74/test/testcdrom.c0000664000000000000000000001144014145137266014103 0ustar00 /* Test the SDL CD-ROM audio functions */ #include #include #include #include #include "SDL.h" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } static void PrintStatus(int driveindex, SDL_CD *cdrom) { const char *status_str = "unknown"; CDstatus status; status = SDL_CDStatus(cdrom); switch (status) { case CD_TRAYEMPTY: status_str = "tray empty"; break; case CD_STOPPED: status_str = "stopped"; break; case CD_PLAYING: status_str = "playing"; break; case CD_PAUSED: status_str = "paused"; break; case CD_ERROR: status_str = "error state"; break; } printf("Drive %d status: %s\n", driveindex, status_str); if ( status >= CD_PLAYING ) { int m, s, f; FRAMES_TO_MSF(cdrom->cur_frame, &m, &s, &f); printf("Currently playing track %d, %d:%2.2d\n", cdrom->track[cdrom->cur_track].id, m, s); } } static void ListTracks(SDL_CD *cdrom) { int i; int m, s, f; const char *trtype; SDL_CDStatus(cdrom); printf("Drive tracks: %d\n", cdrom->numtracks); for ( i=0; inumtracks; ++i ) { FRAMES_TO_MSF(cdrom->track[i].length, &m, &s, &f); if ( f > 0 ) ++s; switch(cdrom->track[i].type) { case SDL_AUDIO_TRACK: trtype="audio"; break; case SDL_DATA_TRACK: trtype="data"; break; default: trtype="unknown"; break; } printf("\tTrack (index %d) %d: %d:%2.2d / %d [%s track]\n", i, cdrom->track[i].id, m, s, cdrom->track[i].length, trtype); } } static void PrintUsage(char *argv0) { fprintf(stderr, "Usage: %s [drive#] [command] [command] ...\n", argv0); fprintf(stderr, "Where 'command' is one of:\n"); fprintf(stderr, " -status\n"); fprintf(stderr, " -list\n"); fprintf(stderr, " -play [first_track] [first_frame] [num_tracks] [num_frames]\n"); fprintf(stderr, " -pause\n"); fprintf(stderr, " -resume\n"); fprintf(stderr, " -stop\n"); fprintf(stderr, " -eject\n"); fprintf(stderr, " -sleep \n"); } int main(int argc, char *argv[]) { int drive; int i; SDL_CD *cdrom; /* Initialize SDL first */ if ( SDL_Init(SDL_INIT_CDROM) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } /* Find out how many CD-ROM drives are connected to the system */ if ( SDL_CDNumDrives() == 0 ) { printf("No CD-ROM devices detected\n"); quit(0); } printf("Drives available: %d\n", SDL_CDNumDrives()); for ( i=0; i #include #include "SDL.h" /* This is an example 16x16 cursor top left : black top right : inverted color or black bottom left: white bottom right: transparent (swap left and right for different endianness) */ Uint16 cursor_data[16]={ 0xffff, 0xffff, 0xffff, 0xffff, 0xffff, 0xffff, 0xffff, 0xffff, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000 }; Uint16 cursor_mask[16]={ 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00, 0xff00 }; /* another test cursor: smaller than 16x16, and with an odd height */ Uint8 small_cursor_data[11] = { 0x00, 0x18, 0x08, 0x38, 0x44, 0x54, 0x44, 0x38, 0x20, 0x20, 0x00 }; Uint8 small_cursor_mask[11] = { 0x3C, 0x3C, 0x3C, 0x7C, 0xC6, 0xC6, 0xC6, 0x7C, 0x78, 0x70, 0x70 }; /* XPM */ static const char *arrow[] = { /* width height num_colors chars_per_pixel */ " 32 32 3 1", /* colors */ "X c #000000", ". c #ffffff", " c None", /* pixels */ "X ", "XX ", "X.X ", "X..X ", "X...X ", "X....X ", "X.....X ", "X......X ", "X.......X ", "X........X ", "X.....XXXXX ", "X..X..X ", "X.X X..X ", "XX X..X ", "X X..X ", " X..X ", " X..X ", " X..X ", " XX ", " ", " ", " ", " ", " ", " ", " ", " ", " ", " ", " ", " ", " ", "0,0" }; static SDL_Cursor *create_arrow_cursor() { int i, row, col; Uint8 data[4*32]; Uint8 mask[4*32]; int hot_x, hot_y; i = -1; for ( row=0; row<32; ++row ) { for ( col=0; col<32; ++col ) { if ( col % 8 ) { data[i] <<= 1; mask[i] <<= 1; } else { ++i; data[i] = mask[i] = 0; } switch (arrow[4+row][col]) { case 'X': data[i] |= 0x01; mask[i] |= 0x01; break; case '.': mask[i] |= 0x01; break; case ' ': break; } } } sscanf(arrow[4+row], "%d,%d", &hot_x, &hot_y); return SDL_CreateCursor(data, mask, 32, 32, hot_x, hot_y); } int main(int argc, char *argv[]) { SDL_Surface *screen; SDL_bool quit = SDL_FALSE; SDL_Cursor *cursor[3]; int current; /* Load the SDL library */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } screen = SDL_SetVideoMode(320,200,8,SDL_ANYFORMAT); if (screen==NULL) { fprintf(stderr, "Couldn't initialize video mode: %s\n",SDL_GetError()); return(1); } SDL_FillRect(screen, NULL, 0x664422); cursor[0] = SDL_CreateCursor((Uint8 *)cursor_data, (Uint8 *)cursor_mask, 16, 16, 8, 8); if (cursor[0]==NULL) { fprintf(stderr, "Couldn't initialize test cursor: %s\n",SDL_GetError()); SDL_Quit(); return(1); } cursor[1] = create_arrow_cursor(); if (cursor[1]==NULL) { fprintf(stderr, "Couldn't initialize arrow cursor: %s\n",SDL_GetError()); SDL_FreeCursor(cursor[0]); SDL_Quit(); return(1); } cursor[2] = SDL_CreateCursor(small_cursor_data, small_cursor_mask, 8, 11, 3, 5); if (cursor[2]==NULL) { fprintf(stderr, "Couldn't initialize test cursor: %s\n",SDL_GetError()); SDL_Quit(); return(1); } current = 0; SDL_SetCursor(cursor[current]); while (!quit) { SDL_Event event; while (SDL_PollEvent(&event)) { switch(event.type) { case SDL_MOUSEBUTTONDOWN: current = (current + 1)%3; SDL_SetCursor(cursor[current]); break; case SDL_KEYDOWN: if (event.key.keysym.sym == SDLK_ESCAPE) { quit = SDL_TRUE; } break; case SDL_QUIT: quit = SDL_TRUE; break; } } SDL_Flip(screen); SDL_Delay(1); } SDL_FreeCursor(cursor[0]); SDL_FreeCursor(cursor[1]); SDL_FreeCursor(cursor[2]); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testdyngl.c0000664000000000000000000001115014055566242014112 0ustar00/* * Small SDL example to demonstrate dynamically loading * OpenGL lib and functions * * (FYI it was supposed to look like snow in the wind or something...) * * Compile with : * gcc testdyngl.c `sdl-config --libs --cflags` -o testdyngl -DHAVE_OPENGL * * You can specify a different OpenGL lib on the command line, i.e. : * ./testdyngl /usr/X11R6/lib/libGL.so.1.2 * or * ./testdyngl /usr/lib/libGL.so.1.0.4496 * */ #include #include #include "SDL.h" #ifdef __MACOS__ #define HAVE_OPENGL #endif #ifdef HAVE_OPENGL #include "SDL_opengl.h" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } void* get_funcaddr(const char* p) { void* f=SDL_GL_GetProcAddress(p); if (f) { return f; } else { printf("Unable to get function pointer for %s\n",p); quit(1); } return NULL; } typedef struct { void(APIENTRY*glBegin)(GLenum); void(APIENTRY*glEnd)(); void(APIENTRY*glVertex3f)(GLfloat, GLfloat, GLfloat); void(APIENTRY*glClearColor)(GLfloat, GLfloat, GLfloat, GLfloat); void(APIENTRY*glClear)(GLbitfield); void(APIENTRY*glDisable)(GLenum); void(APIENTRY*glEnable)(GLenum); void(APIENTRY*glColor4ub)(GLubyte,GLubyte,GLubyte,GLubyte); void(APIENTRY*glPointSize)(GLfloat); void(APIENTRY*glHint)(GLenum,GLenum); void(APIENTRY*glBlendFunc)(GLenum,GLenum); void(APIENTRY*glMatrixMode)(GLenum); void(APIENTRY*glLoadIdentity)(); void(APIENTRY*glOrtho)(GLdouble,GLdouble,GLdouble,GLdouble,GLdouble,GLdouble); void(APIENTRY*glRotatef)(GLfloat,GLfloat,GLfloat,GLfloat); void(APIENTRY*glViewport)(GLint,GLint,GLsizei,GLsizei); void(APIENTRY*glFogf)(GLenum,GLfloat); } glfuncs; void init_glfuncs(glfuncs* f) { f->glBegin=get_funcaddr("glBegin"); f->glEnd=get_funcaddr("glEnd"); f->glVertex3f=get_funcaddr("glVertex3f"); f->glClearColor=get_funcaddr("glClearColor"); f->glClear=get_funcaddr("glClear"); f->glDisable=get_funcaddr("glDisable"); f->glEnable=get_funcaddr("glEnable"); f->glColor4ub=get_funcaddr("glColor4ub"); f->glPointSize=get_funcaddr("glPointSize"); f->glHint=get_funcaddr("glHint"); f->glBlendFunc=get_funcaddr("glBlendFunc"); f->glMatrixMode=get_funcaddr("glMatrixMode"); f->glLoadIdentity=get_funcaddr("glLoadIdentity"); f->glOrtho=get_funcaddr("glOrtho"); f->glRotatef=get_funcaddr("glRotatef"); f->glViewport=get_funcaddr("glViewport"); f->glFogf=get_funcaddr("glFogf"); } #define NB_PIXELS 1000 int main(int argc,char *argv[]) { glfuncs f; int i; SDL_Event event; int done=0; GLfloat pixels[NB_PIXELS*3]; const char *gl_library = NULL; /* Use the default GL library */ if (argv[1]) { gl_library = argv[1]; } if (SDL_Init(SDL_INIT_VIDEO)<0) { printf("Unable to init SDL : %s\n",SDL_GetError()); return(1); } if (SDL_GL_SetAttribute(SDL_GL_DOUBLEBUFFER,1)<0) { printf("Unable to set GL attribute : %s\n",SDL_GetError()); quit(1); } if (SDL_GL_LoadLibrary(gl_library)<0) { printf("Unable to dynamically open GL lib : %s\n",SDL_GetError()); quit(1); } if (SDL_SetVideoMode(640,480,0,SDL_OPENGL)==NULL) { printf("Unable to open video mode : %s\n",SDL_GetError()); quit(1); } /* Set the window manager title bar */ SDL_WM_SetCaption( "SDL Dynamic OpenGL Loading Test", "testdyngl" ); init_glfuncs(&f); for(i=0;i #include #include #include "SDL.h" #include "SDL_thread.h" static int alive = 0; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } int SDLCALL ThreadFunc(void *data) { /* Set the child thread error string */ SDL_SetError("Thread %s (%d) had a problem: %s", (char *)data, SDL_ThreadID(), "nevermind"); while ( alive ) { printf("Thread '%s' is alive!\n", (char *)data); SDL_Delay(1*1000); } printf("Child thread error string: %s\n", SDL_GetError()); return(0); } int main(int argc, char *argv[]) { SDL_Thread *thread; /* Load the SDL library */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } /* Set the error value for the main thread */ SDL_SetError("No worries"); alive = 1; thread = SDL_CreateThread(ThreadFunc, "#1"); if ( thread == NULL ) { fprintf(stderr, "Couldn't create thread: %s\n", SDL_GetError()); quit(1); } SDL_Delay(5*1000); printf("Waiting for thread #1\n"); alive = 0; SDL_WaitThread(thread, NULL); printf("Main thread error string: %s\n", SDL_GetError()); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testfile.c0000664000000000000000000001703012115006433013701 0ustar00 /* sanity tests on SDL_rwops.c (usefull for alternative implementations of stdio rwops) */ #include #ifndef _MSC_VER #include #endif #include "SDL.h" #include "SDL_endian.h" #include /* WARNING ! those 2 files will be destroyed by this test program */ #define FBASENAME1 "sdldata1" /* this file will be created during tests */ #define FBASENAME2 "sdldata2" /* this file should not exists before starting test */ #ifndef NULL #define NULL ((void *)0) #endif static void cleanup( void ) { unlink(FBASENAME1); unlink(FBASENAME2); } static void rwops_error_quit( unsigned line, SDL_RWops *rwops) { printf("testfile.c(%d): failed\n",line); if (rwops) { rwops->close(rwops); /* This calls SDL_FreeRW(rwops); */ } cleanup(); exit(1); /* quit with rwops error (test failed) */ } #define RWOP_ERR_QUIT(x) rwops_error_quit( __LINE__, (x) ) int main(int argc, char *argv[]) { SDL_RWops *rwops = NULL; char test_buf[30]; cleanup(); /* test 1 : basic argument test: all those calls to SDL_RWFromFile should fail */ rwops = SDL_RWFromFile(NULL,NULL); if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile(NULL,"ab+"); if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile(NULL,"sldfkjsldkfj"); if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile("something",""); if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile("something",NULL); if (rwops) RWOP_ERR_QUIT(rwops); printf("test1 OK\n"); /* test 2 : check that inexistant file is not successfully opened/created when required */ /* modes : r, r+ implie that file MUST exist modes : a, a+, w, w+ checks that it succeeds (file may not exists) */ rwops = SDL_RWFromFile(FBASENAME2,"rb"); /* this file doesn't exist that call must fail */ if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile(FBASENAME2,"rb+"); /* this file doesn't exist that call must fail */ if (rwops) RWOP_ERR_QUIT(rwops); rwops = SDL_RWFromFile(FBASENAME2,"wb"); if (!rwops) RWOP_ERR_QUIT(rwops); rwops->close(rwops); unlink(FBASENAME2); rwops = SDL_RWFromFile(FBASENAME2,"wb+"); if (!rwops) RWOP_ERR_QUIT(rwops); rwops->close(rwops); unlink(FBASENAME2); rwops = SDL_RWFromFile(FBASENAME2,"ab"); if (!rwops) RWOP_ERR_QUIT(rwops); rwops->close(rwops); unlink(FBASENAME2); rwops = SDL_RWFromFile(FBASENAME2,"ab+"); if (!rwops) RWOP_ERR_QUIT(rwops); rwops->close(rwops); unlink(FBASENAME2); printf("test2 OK\n"); /* test 3 : creation, writing , reading, seeking, test : w mode, r mode, w+ mode */ rwops = SDL_RWFromFile(FBASENAME1,"wb"); /* write only */ if (!rwops) RWOP_ERR_QUIT(rwops); if (1 != rwops->write(rwops,"1234567890",10,1) ) RWOP_ERR_QUIT(rwops); if (10 != rwops->write(rwops,"1234567890",1,10) ) RWOP_ERR_QUIT(rwops); if (7 != rwops->write(rwops,"1234567",1,7) ) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); /* we are in write only mode */ rwops->close(rwops); rwops = SDL_RWFromFile(FBASENAME1,"rb"); /* read mode, file must exists */ if (!rwops) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (20!=rwops->seek(rwops,-7,RW_SEEK_END)) RWOP_ERR_QUIT(rwops); if (7!=rwops->read(rwops,test_buf,1,7)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"1234567",7)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,10,100)) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,-27,RW_SEEK_CUR)) RWOP_ERR_QUIT(rwops); if (2!=rwops->read(rwops,test_buf,10,3)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"12345678901234567890",20)) RWOP_ERR_QUIT(rwops); if (0!=rwops->write(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); /* readonly mode */ rwops->close(rwops); /* test 3: same with w+ mode */ rwops = SDL_RWFromFile(FBASENAME1,"wb+"); /* write + read + truncation */ if (!rwops) RWOP_ERR_QUIT(rwops); if (1 != rwops->write(rwops,"1234567890",10,1) ) RWOP_ERR_QUIT(rwops); if (10 != rwops->write(rwops,"1234567890",1,10) ) RWOP_ERR_QUIT(rwops); if (7 != rwops->write(rwops,"1234567",1,7) ) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (1!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); /* we are in read/write mode */ if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (20!=rwops->seek(rwops,-7,RW_SEEK_END)) RWOP_ERR_QUIT(rwops); if (7!=rwops->read(rwops,test_buf,1,7)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"1234567",7)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,10,100)) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,-27,RW_SEEK_CUR)) RWOP_ERR_QUIT(rwops); if (2!=rwops->read(rwops,test_buf,10,3)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"12345678901234567890",20)) RWOP_ERR_QUIT(rwops); rwops->close(rwops); printf("test3 OK\n"); /* test 4: same in r+ mode */ rwops = SDL_RWFromFile(FBASENAME1,"rb+"); /* write + read + file must exists, no truncation */ if (!rwops) RWOP_ERR_QUIT(rwops); if (1 != rwops->write(rwops,"1234567890",10,1) ) RWOP_ERR_QUIT(rwops); if (10 != rwops->write(rwops,"1234567890",1,10) ) RWOP_ERR_QUIT(rwops); if (7 != rwops->write(rwops,"1234567",1,7) ) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (1!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); /* we are in read/write mode */ if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (20!=rwops->seek(rwops,-7,RW_SEEK_END)) RWOP_ERR_QUIT(rwops); if (7!=rwops->read(rwops,test_buf,1,7)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"1234567",7)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,10,100)) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,-27,RW_SEEK_CUR)) RWOP_ERR_QUIT(rwops); if (2!=rwops->read(rwops,test_buf,10,3)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"12345678901234567890",20)) RWOP_ERR_QUIT(rwops); rwops->close(rwops); printf("test4 OK\n"); /* test5 : append mode */ rwops = SDL_RWFromFile(FBASENAME1,"ab+"); /* write + read + append */ if (!rwops) RWOP_ERR_QUIT(rwops); if (1 != rwops->write(rwops,"1234567890",10,1) ) RWOP_ERR_QUIT(rwops); if (10 != rwops->write(rwops,"1234567890",1,10) ) RWOP_ERR_QUIT(rwops); if (7 != rwops->write(rwops,"1234567",1,7) ) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (1!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (20+27!=rwops->seek(rwops,-7,RW_SEEK_END)) RWOP_ERR_QUIT(rwops); if (7!=rwops->read(rwops,test_buf,1,7)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"1234567",7)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,1,1)) RWOP_ERR_QUIT(rwops); if (0!=rwops->read(rwops,test_buf,10,100)) RWOP_ERR_QUIT(rwops); if (27!=rwops->seek(rwops,-27,RW_SEEK_CUR)) RWOP_ERR_QUIT(rwops); if (0!=rwops->seek(rwops,0L,RW_SEEK_SET)) RWOP_ERR_QUIT(rwops); if (3!=rwops->read(rwops,test_buf,10,3)) RWOP_ERR_QUIT(rwops); if (SDL_memcmp(test_buf,"123456789012345678901234567123",30)) RWOP_ERR_QUIT(rwops); rwops->close(rwops); printf("test5 OK\n"); cleanup(); return 0; /* all ok */ } sdl12-compat-1.2.74/test/testgamma.c0000664000000000000000000001051612115006433014046 0ustar00 /* Bring up a window and manipulate the gamma on it */ #include #include #include #include #include "SDL.h" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } /* Turn a normal gamma value into an appropriate gamma ramp */ void CalculateGamma(double gamma, Uint16 *ramp) { int i, value; gamma = 1.0 / gamma; for ( i=0; i<256; ++i ) { value = (int)(pow((double)i/256.0, gamma)*65535.0 + 0.5); if ( value > 65535 ) { value = 65535; } ramp[i] = (Uint16)value; } } /* This can be used as a general routine for all of the test programs */ int get_video_args(char *argv[], int *w, int *h, int *bpp, Uint32 *flags) { int i; *w = 640; *h = 480; *bpp = 0; *flags = SDL_SWSURFACE; for ( i=1; argv[i]; ++i ) { if ( strcmp(argv[i], "-width") == 0 ) { if ( argv[i+1] ) { *w = atoi(argv[++i]); } } else if ( strcmp(argv[i], "-height") == 0 ) { if ( argv[i+1] ) { *h = atoi(argv[++i]); } } else if ( strcmp(argv[i], "-bpp") == 0 ) { if ( argv[i+1] ) { *bpp = atoi(argv[++i]); } } else if ( strcmp(argv[i], "-fullscreen") == 0 ) { *flags |= SDL_FULLSCREEN; } else if ( strcmp(argv[i], "-hw") == 0 ) { *flags |= SDL_HWSURFACE; } else if ( strcmp(argv[i], "-hwpalette") == 0 ) { *flags |= SDL_HWPALETTE; } else break; } return i; } int main(int argc, char *argv[]) { SDL_Surface *screen; SDL_Surface *image; float gamma; int i; int w, h, bpp; Uint32 flags; Uint16 ramp[256]; Uint16 red_ramp[256]; Uint32 then, timeout; /* Check command line arguments */ argv += get_video_args(argv, &w, &h, &bpp, &flags); /* Initialize SDL */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return(1); } /* Initialize the display, always use hardware palette */ screen = SDL_SetVideoMode(w, h, bpp, flags | SDL_HWPALETTE); if ( screen == NULL ) { fprintf(stderr, "Couldn't set %dx%d video mode: %s\n", w, h, SDL_GetError()); quit(1); } /* Set the window manager title bar */ SDL_WM_SetCaption("SDL gamma test", "testgamma"); /* Set the desired gamma, if any */ gamma = 1.0f; if ( *argv ) { gamma = (float)atof(*argv); } if ( SDL_SetGamma(gamma, gamma, gamma) < 0 ) { fprintf(stderr, "Unable to set gamma: %s\n", SDL_GetError()); quit(1); } #if 0 /* This isn't supported. Integrating the gamma ramps isn't exact */ /* See what gamma was actually set */ float real[3]; if ( SDL_GetGamma(&real[0], &real[1], &real[2]) < 0 ) { printf("Couldn't get gamma: %s\n", SDL_GetError()); } else { printf("Set gamma values: R=%2.2f, G=%2.2f, B=%2.2f\n", real[0], real[1], real[2]); } #endif /* Do all the drawing work */ image = SDL_LoadBMP("sample.bmp"); if ( image ) { SDL_Rect dst; dst.x = (screen->w - image->w)/2; dst.y = (screen->h - image->h)/2; dst.w = image->w; dst.h = image->h; SDL_BlitSurface(image, NULL, screen, &dst); SDL_UpdateRects(screen, 1, &dst); } /* Wait a bit, handling events */ then = SDL_GetTicks(); timeout = (5*1000); while ( (SDL_GetTicks()-then) < timeout ) { SDL_Event event; while ( SDL_PollEvent(&event) ) { switch (event.type) { case SDL_QUIT: /* Quit now */ timeout = 0; break; case SDL_KEYDOWN: switch (event.key.keysym.sym) { case SDLK_SPACE: /* Go longer.. */ timeout += (5*1000); break; case SDLK_UP: gamma += 0.2f; SDL_SetGamma(gamma, gamma, gamma); break; case SDLK_DOWN: gamma -= 0.2f; SDL_SetGamma(gamma, gamma, gamma); break; case SDLK_ESCAPE: timeout = 0; break; default: break; } break; } } } /* Perform a gamma flash to red using color ramps */ while ( gamma < 10.0 ) { /* Increase the red gamma and decrease everything else... */ gamma += 0.1f; CalculateGamma(gamma, red_ramp); CalculateGamma(1.0/gamma, ramp); SDL_SetGammaRamp(red_ramp, ramp, ramp); } /* Finish completely red */ memset(red_ramp, 255, sizeof(red_ramp)); memset(ramp, 0, sizeof(ramp)); SDL_SetGammaRamp(red_ramp, ramp, ramp); /* Now fade out to black */ for ( i=(red_ramp[0] >> 8); i >= 0; --i ) { memset(red_ramp, i, sizeof(red_ramp)); SDL_SetGammaRamp(red_ramp, NULL, NULL); } SDL_Delay(1*1000); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testgl.c0000664000000000000000000004672012115006433013374 0ustar00#include #include #include #include #include "SDL.h" #ifdef __MACOS__ #define HAVE_OPENGL #endif #ifdef HAVE_OPENGL #include "SDL_opengl.h" /* Undefine this if you want a flat cube instead of a rainbow cube */ #define SHADED_CUBE /* Define this to be the name of the logo image to use with -logo */ #define LOGO_FILE "icon.bmp" /* The SDL_OPENGLBLIT interface is deprecated. The code is still available for benchmark purposes though. */ static SDL_bool USE_DEPRECATED_OPENGLBLIT = SDL_FALSE; static SDL_Surface *global_image = NULL; static GLuint global_texture = 0; static GLuint cursor_texture = 0; /**********************************************************************/ void HotKey_ToggleFullScreen(void) { SDL_Surface *screen; screen = SDL_GetVideoSurface(); if ( SDL_WM_ToggleFullScreen(screen) ) { printf("Toggled fullscreen mode - now %s\n", (screen->flags&SDL_FULLSCREEN) ? "fullscreen" : "windowed"); } else { printf("Unable to toggle fullscreen mode\n"); } } void HotKey_ToggleGrab(void) { SDL_GrabMode mode; printf("Ctrl-G: toggling input grab!\n"); mode = SDL_WM_GrabInput(SDL_GRAB_QUERY); if ( mode == SDL_GRAB_ON ) { printf("Grab was on\n"); } else { printf("Grab was off\n"); } mode = SDL_WM_GrabInput(!mode); if ( mode == SDL_GRAB_ON ) { printf("Grab is now on\n"); } else { printf("Grab is now off\n"); } } void HotKey_Iconify(void) { printf("Ctrl-Z: iconifying window!\n"); SDL_WM_IconifyWindow(); } int HandleEvent(SDL_Event *event) { int done; done = 0; switch( event->type ) { case SDL_ACTIVEEVENT: /* See what happened */ printf( "app %s ", event->active.gain ? "gained" : "lost" ); if ( event->active.state & SDL_APPACTIVE ) { printf( "active " ); } else if ( event->active.state & SDL_APPMOUSEFOCUS ) { printf( "mouse " ); } else if ( event->active.state & SDL_APPINPUTFOCUS ) { printf( "input " ); } printf( "focus\n" ); break; case SDL_KEYDOWN: if ( event->key.keysym.sym == SDLK_ESCAPE ) { done = 1; } if ( (event->key.keysym.sym == SDLK_g) && (event->key.keysym.mod & KMOD_CTRL) ) { HotKey_ToggleGrab(); } if ( (event->key.keysym.sym == SDLK_z) && (event->key.keysym.mod & KMOD_CTRL) ) { HotKey_Iconify(); } if ( (event->key.keysym.sym == SDLK_RETURN) && (event->key.keysym.mod & KMOD_ALT) ) { HotKey_ToggleFullScreen(); } printf("key '%s' pressed\n", SDL_GetKeyName(event->key.keysym.sym)); break; case SDL_QUIT: done = 1; break; } return(done); } void SDL_GL_Enter2DMode() { SDL_Surface *screen = SDL_GetVideoSurface(); /* Note, there may be other things you need to change, depending on how you have your OpenGL state set up. */ glPushAttrib(GL_ENABLE_BIT); glDisable(GL_DEPTH_TEST); glDisable(GL_CULL_FACE); glEnable(GL_TEXTURE_2D); /* This allows alpha blending of 2D textures with the scene */ glEnable(GL_BLEND); glBlendFunc(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA); glViewport(0, 0, screen->w, screen->h); glMatrixMode(GL_PROJECTION); glPushMatrix(); glLoadIdentity(); glOrtho(0.0, (GLdouble)screen->w, (GLdouble)screen->h, 0.0, 0.0, 1.0); glMatrixMode(GL_MODELVIEW); glPushMatrix(); glLoadIdentity(); glTexEnvf(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_DECAL); } void SDL_GL_Leave2DMode() { glMatrixMode(GL_MODELVIEW); glPopMatrix(); glMatrixMode(GL_PROJECTION); glPopMatrix(); glPopAttrib(); } /* Quick utility function for texture creation */ static int power_of_two(int input) { int value = 1; while ( value < input ) { value <<= 1; } return value; } GLuint SDL_GL_LoadTexture(SDL_Surface *surface, GLfloat *texcoord) { GLuint texture; int w, h; SDL_Surface *image; SDL_Rect area; Uint32 saved_flags; Uint8 saved_alpha; /* Use the surface width and height expanded to powers of 2 */ w = power_of_two(surface->w); h = power_of_two(surface->h); texcoord[0] = 0.0f; /* Min X */ texcoord[1] = 0.0f; /* Min Y */ texcoord[2] = (GLfloat)surface->w / w; /* Max X */ texcoord[3] = (GLfloat)surface->h / h; /* Max Y */ image = SDL_CreateRGBSurface( SDL_SWSURFACE, w, h, 32, #if SDL_BYTEORDER == SDL_LIL_ENDIAN /* OpenGL RGBA masks */ 0x000000FF, 0x0000FF00, 0x00FF0000, 0xFF000000 #else 0xFF000000, 0x00FF0000, 0x0000FF00, 0x000000FF #endif ); if ( image == NULL ) { return 0; } /* Save the alpha blending attributes */ saved_flags = surface->flags&(SDL_SRCALPHA|SDL_RLEACCELOK); saved_alpha = surface->format->alpha; if ( (saved_flags & SDL_SRCALPHA) == SDL_SRCALPHA ) { SDL_SetAlpha(surface, 0, 0); } /* Copy the surface into the GL texture image */ area.x = 0; area.y = 0; area.w = surface->w; area.h = surface->h; SDL_BlitSurface(surface, &area, image, &area); /* Restore the alpha blending attributes */ if ( (saved_flags & SDL_SRCALPHA) == SDL_SRCALPHA ) { SDL_SetAlpha(surface, saved_flags, saved_alpha); } /* Create an OpenGL texture for the image */ glGenTextures(1, &texture); glBindTexture(GL_TEXTURE_2D, texture); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_NEAREST); glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_NEAREST); glTexImage2D(GL_TEXTURE_2D, 0, GL_RGBA, w, h, 0, GL_RGBA, GL_UNSIGNED_BYTE, image->pixels); SDL_FreeSurface(image); /* No longer needed */ return texture; } void DrawLogoCursor(void) { static GLfloat texMinX, texMinY; static GLfloat texMaxX, texMaxY; static int w, h; int x, y; if ( ! cursor_texture ) { SDL_Surface *image; GLfloat texcoord[4]; /* Load the image (could use SDL_image library here) */ image = SDL_LoadBMP(LOGO_FILE); if ( image == NULL ) { return; } w = image->w; h = image->h; /* Convert the image into an OpenGL texture */ cursor_texture = SDL_GL_LoadTexture(image, texcoord); /* Make texture coordinates easy to understand */ texMinX = texcoord[0]; texMinY = texcoord[1]; texMaxX = texcoord[2]; texMaxY = texcoord[3]; /* We don't need the original image anymore */ SDL_FreeSurface(image); /* Make sure that the texture conversion is okay */ if ( ! cursor_texture ) { return; } } /* Move the image around */ SDL_GetMouseState(&x, &y); x -= w/2; y -= h/2; /* Show the image on the screen */ SDL_GL_Enter2DMode(); glBindTexture(GL_TEXTURE_2D, cursor_texture); glBegin(GL_TRIANGLE_STRIP); glTexCoord2f(texMinX, texMinY); glVertex2i(x, y ); glTexCoord2f(texMaxX, texMinY); glVertex2i(x+w, y ); glTexCoord2f(texMinX, texMaxY); glVertex2i(x, y+h); glTexCoord2f(texMaxX, texMaxY); glVertex2i(x+w, y+h); glEnd(); SDL_GL_Leave2DMode(); } void DrawLogoTexture(void) { static GLfloat texMinX, texMinY; static GLfloat texMaxX, texMaxY; static int x = 0; static int y = 0; static int w, h; static int delta_x = 1; static int delta_y = 1; SDL_Surface *screen = SDL_GetVideoSurface(); if ( ! global_texture ) { SDL_Surface *image; GLfloat texcoord[4]; /* Load the image (could use SDL_image library here) */ image = SDL_LoadBMP(LOGO_FILE); if ( image == NULL ) { return; } w = image->w; h = image->h; /* Convert the image into an OpenGL texture */ global_texture = SDL_GL_LoadTexture(image, texcoord); /* Make texture coordinates easy to understand */ texMinX = texcoord[0]; texMinY = texcoord[1]; texMaxX = texcoord[2]; texMaxY = texcoord[3]; /* We don't need the original image anymore */ SDL_FreeSurface(image); /* Make sure that the texture conversion is okay */ if ( ! global_texture ) { return; } } /* Move the image around */ x += delta_x; if ( x < 0 ) { x = 0; delta_x = -delta_x; } else if ( (x+w) > screen->w ) { x = screen->w-w; delta_x = -delta_x; } y += delta_y; if ( y < 0 ) { y = 0; delta_y = -delta_y; } else if ( (y+h) > screen->h ) { y = screen->h-h; delta_y = -delta_y; } /* Show the image on the screen */ SDL_GL_Enter2DMode(); glBindTexture(GL_TEXTURE_2D, global_texture); glBegin(GL_TRIANGLE_STRIP); glTexCoord2f(texMinX, texMinY); glVertex2i(x, y ); glTexCoord2f(texMaxX, texMinY); glVertex2i(x+w, y ); glTexCoord2f(texMinX, texMaxY); glVertex2i(x, y+h); glTexCoord2f(texMaxX, texMaxY); glVertex2i(x+w, y+h); glEnd(); SDL_GL_Leave2DMode(); } /* This code is deprecated, but available for speed comparisons */ void DrawLogoBlit(void) { static int x = 0; static int y = 0; static int w, h; static int delta_x = 1; static int delta_y = 1; SDL_Rect dst; SDL_Surface *screen = SDL_GetVideoSurface(); if ( global_image == NULL ) { SDL_Surface *temp; /* Load the image (could use SDL_image library here) */ temp = SDL_LoadBMP(LOGO_FILE); if ( temp == NULL ) { return; } w = temp->w; h = temp->h; /* Convert the image into the screen format */ global_image = SDL_CreateRGBSurface( SDL_SWSURFACE, w, h, screen->format->BitsPerPixel, screen->format->Rmask, screen->format->Gmask, screen->format->Bmask, screen->format->Amask); if ( global_image ) { SDL_BlitSurface(temp, NULL, global_image, NULL); } SDL_FreeSurface(temp); /* Make sure that the texture conversion is okay */ if ( ! global_image ) { return; } } /* Move the image around Note that we do not clear the old position. This is because we perform a glClear() which clears the framebuffer and then only update the new area. Note that you can also achieve interesting effects by modifying the screen surface alpha channel. It's set to 255 by default.. */ x += delta_x; if ( x < 0 ) { x = 0; delta_x = -delta_x; } else if ( (x+w) > screen->w ) { x = screen->w-w; delta_x = -delta_x; } y += delta_y; if ( y < 0 ) { y = 0; delta_y = -delta_y; } else if ( (y+h) > screen->h ) { y = screen->h-h; delta_y = -delta_y; } dst.x = x; dst.y = y; dst.w = w; dst.h = h; SDL_BlitSurface(global_image, NULL, screen, &dst); /* Show the image on the screen */ SDL_UpdateRects(screen, 1, &dst); } int RunGLTest( int argc, char* argv[], int logo, int logocursor, int slowly, int bpp, float gamma, int noframe, int fsaa, int sync, int accel ) { int i; int rgb_size[3]; int w = 640; int h = 480; int done = 0; int frames; Uint32 start_time, this_time; float color[8][3]= {{ 1.0, 1.0, 0.0}, { 1.0, 0.0, 0.0}, { 0.0, 0.0, 0.0}, { 0.0, 1.0, 0.0}, { 0.0, 1.0, 1.0}, { 1.0, 1.0, 1.0}, { 1.0, 0.0, 1.0}, { 0.0, 0.0, 1.0}}; float cube[8][3]= {{ 0.5, 0.5, -0.5}, { 0.5, -0.5, -0.5}, {-0.5, -0.5, -0.5}, {-0.5, 0.5, -0.5}, {-0.5, 0.5, 0.5}, { 0.5, 0.5, 0.5}, { 0.5, -0.5, 0.5}, {-0.5, -0.5, 0.5}}; Uint32 video_flags; int value; if( SDL_Init( SDL_INIT_VIDEO ) < 0 ) { fprintf(stderr,"Couldn't initialize SDL: %s\n",SDL_GetError()); exit( 1 ); } /* See if we should detect the display depth */ if ( bpp == 0 ) { if ( SDL_GetVideoInfo()->vfmt->BitsPerPixel <= 8 ) { bpp = 8; } else { bpp = 16; /* More doesn't seem to work */ } } /* Set the flags we want to use for setting the video mode */ if ( logo && USE_DEPRECATED_OPENGLBLIT ) { video_flags = SDL_OPENGLBLIT; } else { video_flags = SDL_OPENGL; } for ( i=1; argv[i]; ++i ) { if ( strcmp(argv[i], "-fullscreen") == 0 ) { video_flags |= SDL_FULLSCREEN; } } if (noframe) { video_flags |= SDL_NOFRAME; } /* Initialize the display */ switch (bpp) { case 8: rgb_size[0] = 3; rgb_size[1] = 3; rgb_size[2] = 2; break; case 15: case 16: rgb_size[0] = 5; rgb_size[1] = 5; rgb_size[2] = 5; break; default: rgb_size[0] = 8; rgb_size[1] = 8; rgb_size[2] = 8; break; } SDL_GL_SetAttribute( SDL_GL_RED_SIZE, rgb_size[0] ); SDL_GL_SetAttribute( SDL_GL_GREEN_SIZE, rgb_size[1] ); SDL_GL_SetAttribute( SDL_GL_BLUE_SIZE, rgb_size[2] ); SDL_GL_SetAttribute( SDL_GL_DEPTH_SIZE, 16 ); SDL_GL_SetAttribute( SDL_GL_DOUBLEBUFFER, 1 ); if ( fsaa ) { SDL_GL_SetAttribute( SDL_GL_MULTISAMPLEBUFFERS, 1 ); SDL_GL_SetAttribute( SDL_GL_MULTISAMPLESAMPLES, fsaa ); } if ( accel ) { SDL_GL_SetAttribute( SDL_GL_ACCELERATED_VISUAL, 1 ); } if ( sync ) { SDL_GL_SetAttribute( SDL_GL_SWAP_CONTROL, 1 ); } else { SDL_GL_SetAttribute( SDL_GL_SWAP_CONTROL, 0 ); } if ( SDL_SetVideoMode( w, h, bpp, video_flags ) == NULL ) { fprintf(stderr, "Couldn't set GL mode: %s\n", SDL_GetError()); SDL_Quit(); exit(1); } printf("Screen BPP: %d\n", SDL_GetVideoSurface()->format->BitsPerPixel); printf("\n"); printf( "Vendor : %s\n", glGetString( GL_VENDOR ) ); printf( "Renderer : %s\n", glGetString( GL_RENDERER ) ); printf( "Version : %s\n", glGetString( GL_VERSION ) ); printf( "Extensions : %s\n", glGetString( GL_EXTENSIONS ) ); printf("\n"); SDL_GL_GetAttribute( SDL_GL_RED_SIZE, &value ); printf( "SDL_GL_RED_SIZE: requested %d, got %d\n", rgb_size[0],value); SDL_GL_GetAttribute( SDL_GL_GREEN_SIZE, &value ); printf( "SDL_GL_GREEN_SIZE: requested %d, got %d\n", rgb_size[1],value); SDL_GL_GetAttribute( SDL_GL_BLUE_SIZE, &value ); printf( "SDL_GL_BLUE_SIZE: requested %d, got %d\n", rgb_size[2],value); SDL_GL_GetAttribute( SDL_GL_DEPTH_SIZE, &value ); printf( "SDL_GL_DEPTH_SIZE: requested %d, got %d\n", bpp, value ); SDL_GL_GetAttribute( SDL_GL_DOUBLEBUFFER, &value ); printf( "SDL_GL_DOUBLEBUFFER: requested 1, got %d\n", value ); if ( fsaa ) { SDL_GL_GetAttribute( SDL_GL_MULTISAMPLEBUFFERS, &value ); printf("SDL_GL_MULTISAMPLEBUFFERS: requested 1, got %d\n", value ); SDL_GL_GetAttribute( SDL_GL_MULTISAMPLESAMPLES, &value ); printf("SDL_GL_MULTISAMPLESAMPLES: requested %d, got %d\n", fsaa, value ); } if ( accel ) { SDL_GL_GetAttribute( SDL_GL_ACCELERATED_VISUAL, &value ); printf( "SDL_GL_ACCELERATED_VISUAL: requested 1, got %d\n", value ); } if ( sync ) { SDL_GL_GetAttribute( SDL_GL_SWAP_CONTROL, &value ); printf( "SDL_GL_SWAP_CONTROL: requested 1, got %d\n", value ); } /* Set the window manager title bar */ SDL_WM_SetCaption( "SDL GL test", "testgl" ); /* Set the gamma for the window */ if ( gamma != 0.0 ) { SDL_SetGamma(gamma, gamma, gamma); } glViewport( 0, 0, w, h ); glMatrixMode( GL_PROJECTION ); glLoadIdentity( ); glOrtho( -2.0, 2.0, -2.0, 2.0, -20.0, 20.0 ); glMatrixMode( GL_MODELVIEW ); glLoadIdentity( ); glEnable(GL_DEPTH_TEST); glDepthFunc(GL_LESS); glShadeModel(GL_SMOOTH); /* Loop until done. */ start_time = SDL_GetTicks(); frames = 0; while( !done ) { GLenum gl_error; char* sdl_error; SDL_Event event; /* Do our drawing, too. */ glClearColor( 0.0, 0.0, 0.0, 1.0 ); glClear( GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glBegin( GL_QUADS ); #ifdef SHADED_CUBE glColor3fv(color[0]); glVertex3fv(cube[0]); glColor3fv(color[1]); glVertex3fv(cube[1]); glColor3fv(color[2]); glVertex3fv(cube[2]); glColor3fv(color[3]); glVertex3fv(cube[3]); glColor3fv(color[3]); glVertex3fv(cube[3]); glColor3fv(color[4]); glVertex3fv(cube[4]); glColor3fv(color[7]); glVertex3fv(cube[7]); glColor3fv(color[2]); glVertex3fv(cube[2]); glColor3fv(color[0]); glVertex3fv(cube[0]); glColor3fv(color[5]); glVertex3fv(cube[5]); glColor3fv(color[6]); glVertex3fv(cube[6]); glColor3fv(color[1]); glVertex3fv(cube[1]); glColor3fv(color[5]); glVertex3fv(cube[5]); glColor3fv(color[4]); glVertex3fv(cube[4]); glColor3fv(color[7]); glVertex3fv(cube[7]); glColor3fv(color[6]); glVertex3fv(cube[6]); glColor3fv(color[5]); glVertex3fv(cube[5]); glColor3fv(color[0]); glVertex3fv(cube[0]); glColor3fv(color[3]); glVertex3fv(cube[3]); glColor3fv(color[4]); glVertex3fv(cube[4]); glColor3fv(color[6]); glVertex3fv(cube[6]); glColor3fv(color[1]); glVertex3fv(cube[1]); glColor3fv(color[2]); glVertex3fv(cube[2]); glColor3fv(color[7]); glVertex3fv(cube[7]); #else /* flat cube */ glColor3f(1.0, 0.0, 0.0); glVertex3fv(cube[0]); glVertex3fv(cube[1]); glVertex3fv(cube[2]); glVertex3fv(cube[3]); glColor3f(0.0, 1.0, 0.0); glVertex3fv(cube[3]); glVertex3fv(cube[4]); glVertex3fv(cube[7]); glVertex3fv(cube[2]); glColor3f(0.0, 0.0, 1.0); glVertex3fv(cube[0]); glVertex3fv(cube[5]); glVertex3fv(cube[6]); glVertex3fv(cube[1]); glColor3f(0.0, 1.0, 1.0); glVertex3fv(cube[5]); glVertex3fv(cube[4]); glVertex3fv(cube[7]); glVertex3fv(cube[6]); glColor3f(1.0, 1.0, 0.0); glVertex3fv(cube[5]); glVertex3fv(cube[0]); glVertex3fv(cube[3]); glVertex3fv(cube[4]); glColor3f(1.0, 0.0, 1.0); glVertex3fv(cube[6]); glVertex3fv(cube[1]); glVertex3fv(cube[2]); glVertex3fv(cube[7]); #endif /* SHADED_CUBE */ glEnd( ); glMatrixMode(GL_MODELVIEW); glRotatef(5.0, 1.0, 1.0, 1.0); /* Draw 2D logo onto the 3D display */ if ( logo ) { if ( USE_DEPRECATED_OPENGLBLIT ) { DrawLogoBlit(); } else { DrawLogoTexture(); } } if ( logocursor ) { DrawLogoCursor(); } SDL_GL_SwapBuffers( ); /* Check for error conditions. */ gl_error = glGetError( ); if( gl_error != GL_NO_ERROR ) { fprintf( stderr, "testgl: OpenGL error: %d\n", gl_error ); } sdl_error = SDL_GetError( ); if( sdl_error[0] != '\0' ) { fprintf(stderr, "testgl: SDL error '%s'\n", sdl_error); SDL_ClearError(); } /* Allow the user to see what's happening */ if ( slowly ) { SDL_Delay( 20 ); } /* Check if there's a pending event. */ while( SDL_PollEvent( &event ) ) { done = HandleEvent(&event); } ++frames; } /* Print out the frames per second */ this_time = SDL_GetTicks(); if ( this_time != start_time ) { printf("%2.2f FPS\n", ((float)frames/(this_time-start_time))*1000.0); } if ( global_image ) { SDL_FreeSurface(global_image); global_image = NULL; } if ( global_texture ) { glDeleteTextures( 1, &global_texture ); global_texture = 0; } if ( cursor_texture ) { glDeleteTextures( 1, &cursor_texture ); cursor_texture = 0; } /* Destroy our GL context, etc. */ SDL_Quit( ); return(0); } int main(int argc, char *argv[]) { int i, logo, logocursor = 0; int numtests; int bpp = 0; int slowly; float gamma = 0.0; int noframe = 0; int fsaa = 0; int accel = 0; int sync = 0; logo = 0; slowly = 0; numtests = 1; for ( i=1; argv[i]; ++i ) { if ( strcmp(argv[i], "-twice") == 0 ) { ++numtests; } if ( strcmp(argv[i], "-logo") == 0 ) { logo = 1; USE_DEPRECATED_OPENGLBLIT = SDL_FALSE; } if ( strcmp(argv[i], "-logoblit") == 0 ) { logo = 1; USE_DEPRECATED_OPENGLBLIT = SDL_TRUE; } if ( strcmp(argv[i], "-logocursor") == 0 ) { logocursor = 1; } if ( strcmp(argv[i], "-slow") == 0 ) { slowly = 1; } if ( strcmp(argv[i], "-bpp") == 0 ) { bpp = atoi(argv[++i]); } if ( strcmp(argv[i], "-gamma") == 0 ) { gamma = (float)atof(argv[++i]); } if ( strcmp(argv[i], "-noframe") == 0 ) { noframe = 1; } if ( strcmp(argv[i], "-fsaa") == 0 ) { ++fsaa; } if ( strcmp(argv[i], "-accel") == 0 ) { ++accel; } if ( strcmp(argv[i], "-sync") == 0 ) { ++sync; } if ( strncmp(argv[i], "-h", 2) == 0 ) { printf( "Usage: %s [-twice] [-logo] [-logocursor] [-slow] [-bpp n] [-gamma n] [-noframe] [-fsaa] [-accel] [-sync] [-fullscreen]\n", argv[0]); exit(0); } } for ( i=0; i #include "SDL.h" static size_t widelen(char *data) { size_t len = 0; Uint32 *p = (Uint32 *)data; while(*p++) { ++len; } return len; } int main(int argc, char *argv[]) { const char * formats[] = { "UTF8", "UTF-8", "UTF16BE", "UTF-16BE", "UTF16LE", "UTF-16LE", "UTF32BE", "UTF-32BE", "UTF32LE", "UTF-32LE", "UCS4", "UCS-4", }; const char * fname; char buffer[BUFSIZ]; char *ucs4; char *test[2]; int i; FILE *file; int errors = 0; fname = (argc < 2) ? "utf8.txt" : argv[1]; file = fopen(fname, "rb"); if ( !file ) { fprintf(stderr, "Unable to open %s\n", fname); return (1); } while ( fgets(buffer, sizeof(buffer), file) ) { /* Convert to UCS-4 */ size_t len; ucs4 = SDL_iconv_string("UCS-4", "UTF-8", buffer, SDL_strlen(buffer)+1); len = (widelen(ucs4)+1)*4; for ( i = 0; i < SDL_arraysize(formats); ++i ) { test[0] = SDL_iconv_string(formats[i], "UCS-4", ucs4, len); test[1] = SDL_iconv_string("UCS-4", formats[i], test[0], len); if ( !test[1] || SDL_memcmp(test[1], ucs4, len) != 0 ) { fprintf(stderr, "FAIL: %s\n", formats[i]); ++errors; } if ( test[0] ) { SDL_free(test[0]); } if ( test[1] ) { SDL_free(test[1]); } } test[0] = SDL_iconv_string("UTF-8", "UCS-4", ucs4, len); SDL_free(ucs4); fputs(test[0], stdout); SDL_free(test[0]); } fprintf(stderr, "\nTotal errors: %d\n", errors); return (errors ? errors + 1 : 0); } sdl12-compat-1.2.74/test/testjoystick.c0000664000000000000000000001166112115006433014625 0ustar00 /* Simple program to test the SDL joystick routines */ #include #include #include #include "SDL.h" #define SCREEN_WIDTH 640 #define SCREEN_HEIGHT 480 void WatchJoystick(SDL_Joystick *joystick) { SDL_Surface *screen; const char *name; int i, done; SDL_Event event; int x, y, draw; SDL_Rect axis_area[2]; /* Set a video mode to display joystick axis position */ screen = SDL_SetVideoMode(SCREEN_WIDTH, SCREEN_HEIGHT, 16, 0); if ( screen == NULL ) { fprintf(stderr, "Couldn't set video mode: %s\n",SDL_GetError()); return; } /* Print info about the joystick we are watching */ name = SDL_JoystickName(SDL_JoystickIndex(joystick)); printf("Watching joystick %d: (%s)\n", SDL_JoystickIndex(joystick), name ? name : "Unknown Joystick"); printf("Joystick has %d axes, %d hats, %d balls, and %d buttons\n", SDL_JoystickNumAxes(joystick), SDL_JoystickNumHats(joystick), SDL_JoystickNumBalls(joystick),SDL_JoystickNumButtons(joystick)); /* Initialize drawing rectangles */ memset(axis_area, 0, (sizeof axis_area)); draw = 0; /* Loop, getting joystick events! */ done = 0; while ( ! done ) { while ( SDL_PollEvent(&event) ) { switch (event.type) { case SDL_JOYAXISMOTION: printf("Joystick %d axis %d value: %d\n", event.jaxis.which, event.jaxis.axis, event.jaxis.value); break; case SDL_JOYHATMOTION: printf("Joystick %d hat %d value:", event.jhat.which, event.jhat.hat); if ( event.jhat.value == SDL_HAT_CENTERED ) printf(" centered"); if ( event.jhat.value & SDL_HAT_UP ) printf(" up"); if ( event.jhat.value & SDL_HAT_RIGHT ) printf(" right"); if ( event.jhat.value & SDL_HAT_DOWN ) printf(" down"); if ( event.jhat.value & SDL_HAT_LEFT ) printf(" left"); printf("\n"); break; case SDL_JOYBALLMOTION: printf("Joystick %d ball %d delta: (%d,%d)\n", event.jball.which, event.jball.ball, event.jball.xrel, event.jball.yrel); break; case SDL_JOYBUTTONDOWN: printf("Joystick %d button %d down\n", event.jbutton.which, event.jbutton.button); break; case SDL_JOYBUTTONUP: printf("Joystick %d button %d up\n", event.jbutton.which, event.jbutton.button); break; case SDL_KEYDOWN: if ( event.key.keysym.sym != SDLK_ESCAPE ) { break; } /* Fall through to signal quit */ case SDL_QUIT: done = 1; break; default: break; } } /* Update visual joystick state */ for ( i=0; i (SCREEN_WIDTH-16) ) { x = SCREEN_WIDTH-16; } y = (((int)SDL_JoystickGetAxis(joystick, 1))+32768); y *= SCREEN_HEIGHT; y /= 65535; if ( y < 0 ) { y = 0; } else if ( y > (SCREEN_HEIGHT-16) ) { y = SCREEN_HEIGHT-16; } axis_area[draw].x = (Sint16)x; axis_area[draw].y = (Sint16)y; axis_area[draw].w = 16; axis_area[draw].h = 16; SDL_FillRect(screen, &axis_area[draw], 0xFFFF); SDL_UpdateRects(screen, 2, axis_area); } } int main(int argc, char *argv[]) { const char *name; int i; SDL_Joystick *joystick; /* Initialize SDL (Note: video is required to start event loop) */ if ( SDL_Init(SDL_INIT_VIDEO|SDL_INIT_JOYSTICK) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); exit(1); } /* Print information about the joysticks */ printf("There are %d joysticks attached\n", SDL_NumJoysticks()); for ( i=0; i #include #include #include #include "SDL.h" int main(int argc, char *argv[]) { SDLKey key; if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); exit(1); } for ( key=SDLK_FIRST; key #include #include "SDL.h" typedef int (*fntype)(const char *); int main(int argc, char *argv[]) { int retval = 0; int hello = 0; const char *libname = NULL; const char *symname = NULL; void *lib = NULL; fntype fn = NULL; if (argc != 3) { const char *app = argv[0]; fprintf(stderr, "USAGE: %s \n", app); fprintf(stderr, " %s --hello \n", app); return 1; } /* Initialize SDL */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return 2; } if (strcmp(argv[1], "--hello") == 0) { hello = 1; libname = argv[2]; symname = "puts"; } else { libname = argv[1]; symname = argv[2]; } lib = SDL_LoadObject(libname); if (lib == NULL) { fprintf(stderr, "SDL_LoadObject('%s') failed: %s\n", libname, SDL_GetError()); retval = 3; } else { fn = (fntype) SDL_LoadFunction(lib, symname); if (fn == NULL) { fprintf(stderr, "SDL_LoadFunction('%s') failed: %s\n", symname, SDL_GetError()); retval = 4; } else { printf("Found %s in %s at %p\n", symname, libname, fn); if (hello) { printf("Calling function...\n"); fflush(stdout); fn(" HELLO, WORLD!\n"); printf("...apparently, we survived. :)\n"); printf("Unloading library...\n"); fflush(stdout); } } SDL_UnloadObject(lib); } SDL_Quit(); return retval; } sdl12-compat-1.2.74/test/testlock.c0000664000000000000000000000432212115006433013712 0ustar00 /* Test the thread and mutex locking functions Also exercises the system's signal/thread interaction */ #include #include #include "SDL.h" #include "SDL_mutex.h" #include "SDL_thread.h" static SDL_mutex *mutex = NULL; static Uint32 mainthread; static SDL_Thread *threads[6]; static volatile int doterminate = 0; /* * SDL_Quit() shouldn't be used with atexit() directly because * calling conventions may differ... */ static void SDL_Quit_Wrapper(void) { SDL_Quit(); } void printid(void) { printf("Process %u: exiting\n", SDL_ThreadID()); } void terminate(int sig) { signal(SIGINT, terminate); doterminate = 1; } void closemutex(int sig) { Uint32 id = SDL_ThreadID(); int i; printf("Process %u: Cleaning up...\n", id == mainthread ? 0 : id); for ( i=0; i<6; ++i ) SDL_KillThread(threads[i]); SDL_DestroyMutex(mutex); exit(sig); } int SDLCALL Run(void *data) { if ( SDL_ThreadID() == mainthread ) signal(SIGTERM, closemutex); while ( 1 ) { printf("Process %u ready to work\n", SDL_ThreadID()); if ( SDL_mutexP(mutex) < 0 ) { fprintf(stderr, "Couldn't lock mutex: %s", SDL_GetError()); exit(1); } printf("Process %u, working!\n", SDL_ThreadID()); SDL_Delay(1*1000); printf("Process %u, done!\n", SDL_ThreadID()); if ( SDL_mutexV(mutex) < 0 ) { fprintf(stderr, "Couldn't unlock mutex: %s", SDL_GetError()); exit(1); } /* If this sleep isn't done, then threads may starve */ SDL_Delay(10); if (SDL_ThreadID() == mainthread && doterminate) { printf("Process %u: raising SIGTERM\n", SDL_ThreadID()); raise(SIGTERM); } } return(0); } int main(int argc, char *argv[]) { int i; int maxproc = 6; /* Load the SDL library */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "%s\n", SDL_GetError()); exit(1); } atexit(SDL_Quit_Wrapper); if ( (mutex=SDL_CreateMutex()) == NULL ) { fprintf(stderr, "Couldn't create mutex: %s\n", SDL_GetError()); exit(1); } mainthread = SDL_ThreadID(); printf("Main thread: %u\n", mainthread); atexit(printid); for ( i=0; i #include #include #define BENCHMARK_SDL #define NOTICE(X) printf("%s", X); #define WINDOW_WIDTH 640 #define WINDOW_HEIGHT 480 #include "SDL.h" SDL_Surface *screen, *pic; SDL_Overlay *overlay; int scale; int monochrome; int luminance; int w, h; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } /* NOTE: These RGB conversion functions are not intended for speed, only as examples. */ void RGBtoYUV(Uint8 *rgb, int *yuv, int monochrome, int luminance) { if (monochrome) { #if 1 /* these are the two formulas that I found on the FourCC site... */ yuv[0] = (int) (0.299*rgb[0] + 0.587*rgb[1] + 0.114*rgb[2]); yuv[1] = 128; yuv[2] = 128; #else yuv[0] = (int) ((0.257 * rgb[0]) + (0.504 * rgb[1]) + (0.098 * rgb[2]) + 16); yuv[1] = 128; yuv[2] = 128; #endif } else { #if 1 /* these are the two formulas that I found on the FourCC site... */ yuv[0] = (int) (0.299*rgb[0] + 0.587*rgb[1] + 0.114*rgb[2]); yuv[1] = (int) ((rgb[2]-yuv[0])*0.565 + 128); yuv[2] = (int) ((rgb[0]-yuv[0])*0.713 + 128); #else yuv[0] = (int) ((0.257 * rgb[0]) + (0.504 * rgb[1]) + (0.098 * rgb[2]) + 16); yuv[1] = (int) (128 - (0.148 * rgb[0]) - (0.291 * rgb[1]) + (0.439 * rgb[2])); yuv[2] = (int) (128 + (0.439 * rgb[0]) - (0.368 * rgb[1]) - (0.071 * rgb[2])); #endif } if (luminance!=100) { yuv[0]=yuv[0]*luminance/100; if (yuv[0]>255) yuv[0]=255; } /* clamp values...if you need to, we don't seem to have a need */ /* for(i=0;i<3;i++) { if(yuv[i]<0) yuv[i]=0; if(yuv[i]>255) yuv[i]=255; } */ } void ConvertRGBtoYV12(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op[3]; SDL_LockSurface(s); SDL_LockYUVOverlay(o); /* Black initialization */ /* memset(o->pixels[0],0,o->pitches[0]*o->h); memset(o->pixels[1],128,o->pitches[1]*((o->h+1)/2)); memset(o->pixels[2],128,o->pitches[2]*((o->h+1)/2)); */ /* Convert */ for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op[0]=o->pixels[0]+o->pitches[0]*y; op[1]=o->pixels[1]+o->pitches[1]*(y/2); op[2]=o->pixels[2]+o->pitches[2]*(y/2); for(x=0; xw && xw; x++) { RGBtoYUV(p, yuv, monochrome, luminance); *(op[0]++)=yuv[0]; if(x%2==0 && y%2==0) { *(op[1]++)=yuv[2]; *(op[2]++)=yuv[1]; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoIYUV(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op[3]; SDL_LockSurface(s); SDL_LockYUVOverlay(o); /* Black initialization */ /* memset(o->pixels[0],0,o->pitches[0]*o->h); memset(o->pixels[1],128,o->pitches[1]*((o->h+1)/2)); memset(o->pixels[2],128,o->pitches[2]*((o->h+1)/2)); */ /* Convert */ for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op[0]=o->pixels[0]+o->pitches[0]*y; op[1]=o->pixels[1]+o->pitches[1]*(y/2); op[2]=o->pixels[2]+o->pitches[2]*(y/2); for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); *(op[0]++)=yuv[0]; if(x%2==0 && y%2==0) { *(op[1]++)=yuv[1]; *(op[2]++)=yuv[2]; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoUYVY(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p, yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[1]; *(op++)=yuv[0]; *(op++)=yuv[2]; } else *(op++)=yuv[0]; p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoYVYU(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[0]; *(op++)=yuv[2]; op[1]=yuv[1]; } else { *op=yuv[0]; op+=2; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoYUY2(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[0]; *(op++)=yuv[1]; op[1]=yuv[2]; } else { *op=yuv[0]; op+=2; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void Draw() { SDL_Rect rect; int i; int disp; if(!scale) { rect.w=overlay->w; rect.h=overlay->h; for(i=0; iw/2; rect.h=overlay->h/2; rect.x=(w-rect.w)/2; rect.y=(h-rect.h)/2; disp=rect.y-1; for(i=0; i\n"); fprintf(stderr, " -width \n"); fprintf(stderr, " -height \n"); fprintf(stderr, " -bpp \n"); fprintf(stderr, " -format (one of the: YV12, IYUV, YUY2, UYVY, YVYU)\n"); fprintf(stderr, " -hw\n"); fprintf(stderr, " -flip\n"); fprintf(stderr, " -scale (test scaling features, from 50%% upto window size)\n"); fprintf(stderr, " -mono (use monochromatic RGB2YUV conversion)\n"); fprintf(stderr, " -lum (use luminance correction during RGB2YUV conversion,\n"); fprintf(stderr, " from 0%% to unlimited, normal is 100%%)\n"); fprintf(stderr, " -help (shows this help)\n"); fprintf(stderr, " -fullscreen (test overlay in fullscreen mode)\n"); } int main(int argc, char **argv) { char *argv0 = argv[0]; int delay; int desired_bpp; Uint32 video_flags, overlay_format; const char *bmpfile; #ifdef BENCHMARK_SDL Uint32 then, now; #endif int i; /* Set default options and check command-line */ scale=0; monochrome=0; luminance=100; delay = 1; w = WINDOW_WIDTH; h = WINDOW_HEIGHT; desired_bpp = 0; video_flags = 0; overlay_format = SDL_YV12_OVERLAY; while ( argc > 1 ) { if ( strcmp(argv[1], "-delay") == 0 ) { if ( argv[2] ) { delay = atoi(argv[2]); argv += 2; argc -= 2; } else { fprintf(stderr, "The -delay option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-width") == 0 ) { if ( argv[2] && ((w = atoi(argv[2])) > 0) ) { argv += 2; argc -= 2; } else { fprintf(stderr, "The -width option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-height") == 0 ) { if ( argv[2] && ((h = atoi(argv[2])) > 0) ) { argv += 2; argc -= 2; } else { fprintf(stderr, "The -height option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-bpp") == 0 ) { if ( argv[2] ) { desired_bpp = atoi(argv[2]); argv += 2; argc -= 2; } else { fprintf(stderr, "The -bpp option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-lum") == 0 ) { if ( argv[2] ) { luminance = atoi(argv[2]); argv += 2; argc -= 2; } else { fprintf(stderr, "The -lum option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-format") == 0 ) { if ( argv[2] ) { if(!strcmp(argv[2],"YV12")) overlay_format = SDL_YV12_OVERLAY; else if(!strcmp(argv[2],"IYUV")) overlay_format = SDL_IYUV_OVERLAY; else if(!strcmp(argv[2],"YUY2")) overlay_format = SDL_YUY2_OVERLAY; else if(!strcmp(argv[2],"UYVY")) overlay_format = SDL_UYVY_OVERLAY; else if(!strcmp(argv[2],"YVYU")) overlay_format = SDL_YVYU_OVERLAY; else { fprintf(stderr, "The -format option %s is not recognized\n",argv[2]); return(1); } argv += 2; argc -= 2; } else { fprintf(stderr, "The -format option requires an argument\n"); return(1); } } else if ( strcmp(argv[1], "-hw") == 0 ) { video_flags |= SDL_HWSURFACE; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-flip") == 0 ) { video_flags |= SDL_DOUBLEBUF; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-scale") == 0 ) { scale = 1; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-mono") == 0 ) { monochrome = 1; argv += 1; argc -= 1; } else if (( strcmp(argv[1], "-help") == 0 ) || (strcmp(argv[1], "-h") == 0)) { PrintUsage(argv0); return(1); } else if ( strcmp(argv[1], "-fullscreen") == 0 ) { video_flags |= SDL_FULLSCREEN; argv += 1; argc -= 1; } else break; } if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return(1); } /* Initialize the display */ screen = SDL_SetVideoMode(w, h, desired_bpp, video_flags); if ( screen == NULL ) { fprintf(stderr, "Couldn't set %dx%dx%d video mode: %s\n", w, h, desired_bpp, SDL_GetError()); quit(1); } printf("Set%s %dx%dx%d mode\n", screen->flags & SDL_FULLSCREEN ? " fullscreen" : "", screen->w, screen->h, screen->format->BitsPerPixel); printf("(video surface located in %s memory)\n", (screen->flags&SDL_HWSURFACE) ? "video" : "system"); if ( screen->flags & SDL_DOUBLEBUF ) { printf("Double-buffering enabled\n"); } /* Set the window manager title bar */ SDL_WM_SetCaption("SDL test overlay", "testoverlay"); /* Load picture */ bmpfile = argv[1] ? argv[1]:"sample.bmp"; pic = SDL_LoadBMP(bmpfile); if ( pic == NULL ) { fprintf(stderr, "Couldn't load %s: %s\n", bmpfile, SDL_GetError()); quit(1); } /* Convert the picture to 32bits, for easy conversion */ { SDL_Surface *newsurf; SDL_PixelFormat format; format.palette=NULL; format.BitsPerPixel=32; format.BytesPerPixel=4; #if SDL_BYTEORDER == SDL_LIL_ENDIAN format.Rshift=0; format.Gshift=8; format.Bshift=16; #else format.Rshift=24; format.Gshift=16; format.Bshift=8; #endif format.Ashift=0; format.Rmask=0xff<w, pic->h, overlay_format, screen); if ( overlay == NULL ) { fprintf(stderr, "Couldn't create overlay: %s\n", SDL_GetError()); quit(1); } printf("Created %dx%dx%d %s %s overlay\n",overlay->w,overlay->h,overlay->planes, overlay->hw_overlay?"hardware":"software", overlay->format==SDL_YV12_OVERLAY?"YV12": overlay->format==SDL_IYUV_OVERLAY?"IYUV": overlay->format==SDL_YUY2_OVERLAY?"YUY2": overlay->format==SDL_UYVY_OVERLAY?"UYVY": overlay->format==SDL_YVYU_OVERLAY?"YVYU": "Unknown"); for(i=0; iplanes; i++) { printf(" plane %d: pitch=%d\n", i, overlay->pitches[i]); } /* Convert to YUV, and draw to the overlay */ #ifdef BENCHMARK_SDL then = SDL_GetTicks(); #endif switch(overlay->format) { case SDL_YV12_OVERLAY: ConvertRGBtoYV12(pic,overlay,monochrome,luminance); break; case SDL_UYVY_OVERLAY: ConvertRGBtoUYVY(pic,overlay,monochrome,luminance); break; case SDL_YVYU_OVERLAY: ConvertRGBtoYVYU(pic,overlay,monochrome,luminance); break; case SDL_YUY2_OVERLAY: ConvertRGBtoYUY2(pic,overlay,monochrome,luminance); break; case SDL_IYUV_OVERLAY: ConvertRGBtoIYUV(pic,overlay,monochrome,luminance); break; default: printf("cannot convert RGB picture to obtained YUV format!\n"); quit(1); break; } #ifdef BENCHMARK_SDL now = SDL_GetTicks(); printf("Conversion Time: %d milliseconds\n", now-then); #endif /* Do all the drawing work */ #ifdef BENCHMARK_SDL then = SDL_GetTicks(); #endif Draw(); #ifdef BENCHMARK_SDL now = SDL_GetTicks(); printf("Time: %d milliseconds\n", now-then); #endif SDL_Delay(delay*1000); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testoverlay2.c0000664000000000000000000004142714055566242014552 0ustar00/******************************************************************************** * * * Test of the overlay used for moved pictures, test more closed to real life. * * Running trojan moose :) Coded by Mike Gorchak. * * * ********************************************************************************/ #include #include #include #include "SDL.h" #define MOOSEPIC_W 64 #define MOOSEPIC_H 88 #define MOOSEFRAME_SIZE (MOOSEPIC_W * MOOSEPIC_H) #define MOOSEFRAMES_COUNT 10 SDL_Color MooseColors[84]={ { 49, 49, 49}, { 66, 24, 0}, { 66, 33, 0}, { 66, 66, 66}, { 66, 115, 49}, { 74, 33, 0}, { 74, 41, 16}, { 82, 33, 8}, { 82, 41, 8}, { 82, 49, 16}, { 82, 82, 82}, { 90, 41, 8}, { 90, 41, 16}, { 90, 57, 24}, { 99, 49, 16}, { 99, 66, 24}, { 99, 66, 33}, { 99, 74, 33}, {107, 57, 24}, {107, 82, 41}, {115, 57, 33}, {115, 66, 33}, {115, 66, 41}, {115, 74, 0}, {115, 90, 49}, {115, 115, 115}, {123, 82, 0}, {123, 99, 57}, {132, 66, 41}, {132, 74, 41}, {132, 90, 8}, {132, 99, 33}, {132, 99, 66}, {132, 107, 66}, {140, 74, 49}, {140, 99, 16}, {140, 107, 74}, {140, 115, 74}, {148, 107, 24}, {148, 115, 82}, {148, 123, 74}, {148, 123, 90}, {156, 115, 33}, {156, 115, 90}, {156, 123, 82}, {156, 132, 82}, {156, 132, 99}, {156, 156, 156}, {165, 123, 49}, {165, 123, 90}, {165, 132, 82}, {165, 132, 90}, {165, 132, 99}, {165, 140, 90}, {173, 132, 57}, {173, 132, 99}, {173, 140, 107}, {173, 140, 115}, {173, 148, 99}, {173, 173, 173}, {181, 140, 74}, {181, 148, 115}, {181, 148, 123}, {181, 156, 107}, {189, 148, 123}, {189, 156, 82}, {189, 156, 123}, {189, 156, 132}, {189, 189, 189}, {198, 156, 123}, {198, 165, 132}, {206, 165, 99}, {206, 165, 132}, {206, 173, 140}, {206, 206, 206}, {214, 173, 115}, {214, 173, 140}, {222, 181, 148}, {222, 189, 132}, {222, 189, 156}, {222, 222, 222}, {231, 198, 165}, {231, 231, 231}, {239, 206, 173} }; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } /* All RGB2YUV conversion code and some other parts of code has been taken from testoverlay.c */ /* NOTE: These RGB conversion functions are not intended for speed, only as examples. */ void RGBtoYUV(Uint8 *rgb, int *yuv, int monochrome, int luminance) { if (monochrome) { #if 1 /* these are the two formulas that I found on the FourCC site... */ yuv[0] = (int) (0.299*rgb[0] + 0.587*rgb[1] + 0.114*rgb[2]); yuv[1] = 128; yuv[2] = 128; #else yuv[0] = (int) ((0.257 * rgb[0]) + (0.504 * rgb[1]) + (0.098 * rgb[2]) + 16); yuv[1] = 128; yuv[2] = 128; #endif } else { #if 1 /* these are the two formulas that I found on the FourCC site... */ yuv[0] = (int) (0.299*rgb[0] + 0.587*rgb[1] + 0.114*rgb[2]); yuv[1] = (int) ((rgb[2]-yuv[0])*0.565 + 128); yuv[2] = (int) ((rgb[0]-yuv[0])*0.713 + 128); #else yuv[0] = (int) ((0.257 * rgb[0]) + (0.504 * rgb[1]) + (0.098 * rgb[2]) + 16); yuv[1] = (int) (128 - (0.148 * rgb[0]) - (0.291 * rgb[1]) + (0.439 * rgb[2])); yuv[2] = (int) (128 + (0.439 * rgb[0]) - (0.368 * rgb[1]) - (0.071 * rgb[2])); #endif } if (luminance!=100) { yuv[0]=yuv[0]*luminance/100; if (yuv[0]>255) yuv[0]=255; } } void ConvertRGBtoYV12(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op[3]; SDL_LockSurface(s); SDL_LockYUVOverlay(o); /* Convert */ for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op[0]=o->pixels[0]+o->pitches[0]*y; op[1]=o->pixels[1]+o->pitches[1]*(y/2); op[2]=o->pixels[2]+o->pitches[2]*(y/2); for(x=0; xw && xw; x++) { RGBtoYUV(p, yuv, monochrome, luminance); *(op[0]++)=yuv[0]; if(x%2==0 && y%2==0) { *(op[1]++)=yuv[2]; *(op[2]++)=yuv[1]; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoIYUV(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op[3]; SDL_LockSurface(s); SDL_LockYUVOverlay(o); /* Convert */ for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op[0]=o->pixels[0]+o->pitches[0]*y; op[1]=o->pixels[1]+o->pitches[1]*(y/2); op[2]=o->pixels[2]+o->pitches[2]*(y/2); for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); *(op[0]++)=yuv[0]; if(x%2==0 && y%2==0) { *(op[1]++)=yuv[1]; *(op[2]++)=yuv[2]; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoUYVY(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p, yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[1]; *(op++)=yuv[0]; *(op++)=yuv[2]; } else *(op++)=yuv[0]; p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoYVYU(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[0]; *(op++)=yuv[2]; op[1]=yuv[1]; } else { *op=yuv[0]; op+=2; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } void ConvertRGBtoYUY2(SDL_Surface *s, SDL_Overlay *o, int monochrome, int luminance) { int x,y; int yuv[3]; Uint8 *p,*op; SDL_LockSurface(s); SDL_LockYUVOverlay(o); for(y=0; yh && yh; y++) { p=((Uint8 *) s->pixels)+s->pitch*y; op=o->pixels[0]+o->pitches[0]*y; for(x=0; xw && xw; x++) { RGBtoYUV(p,yuv, monochrome, luminance); if(x%2==0) { *(op++)=yuv[0]; *(op++)=yuv[1]; op[1]=yuv[2]; } else { *op=yuv[0]; op+=2; } p+=s->format->BytesPerPixel; } } SDL_UnlockYUVOverlay(o); SDL_UnlockSurface(s); } static void PrintUsage(char *argv0) { fprintf(stderr, "Usage: %s [arg] [arg] [arg] ...\n", argv0); fprintf(stderr, "\n"); fprintf(stderr, "Where 'arg' is any of the following options:\n"); fprintf(stderr, "\n"); fprintf(stderr, " -fps \n"); fprintf(stderr, " -format (one of the: YV12, IYUV, YUY2, UYVY, YVYU)\n"); fprintf(stderr, " -scale (initial scale of the overlay)\n"); fprintf(stderr, " -help (shows this help)\n"); fprintf(stderr, "\n"); fprintf(stderr, "Press ESC to exit, or SPACE to freeze the movie while application running.\n"); fprintf(stderr, "\n"); } int main(int argc, char **argv) { Uint8* RawMooseData; SDL_RWops* handle; SDL_Surface* screen; SDL_Surface* MooseFrame[MOOSEFRAMES_COUNT]; SDL_Overlay* overlay; SDL_Rect overlayrect; SDL_Event event; Uint32 lastftick; int paused=0; int resized=0; int i; int fps=12; Uint32 fpsdelay; int overlay_format=SDL_YUY2_OVERLAY; int scale=5; if (SDL_Init(SDL_INIT_VIDEO | SDL_INIT_NOPARACHUTE) < 0) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return 3; } while ( argc > 1 ) { if (strcmp(argv[1], "-fps")== 0) { if (argv[2]) { fps = atoi(argv[2]); if (fps==0) { fprintf(stderr, "The -fps option requires an argument [from 1 to 1000], default is 12.\n"); quit(10); } if ((fps<0) || (fps>1000)) { fprintf(stderr, "The -fps option must be in range from 1 to 1000, default is 12.\n"); quit(10); } argv += 2; argc -= 2; } else { fprintf(stderr, "The -fps option requires an argument [from 1 to 1000], default is 12.\n"); quit(10); } } else if (strcmp(argv[1], "-format") == 0) { if (argv[2]) { if (!strcmp(argv[2],"YV12")) overlay_format = SDL_YV12_OVERLAY; else if(!strcmp(argv[2],"IYUV")) overlay_format = SDL_IYUV_OVERLAY; else if(!strcmp(argv[2],"YUY2")) overlay_format = SDL_YUY2_OVERLAY; else if(!strcmp(argv[2],"UYVY")) overlay_format = SDL_UYVY_OVERLAY; else if(!strcmp(argv[2],"YVYU")) overlay_format = SDL_YVYU_OVERLAY; else { fprintf(stderr, "The -format option %s is not recognized, see help for info.\n", argv[2]); quit(10); } argv += 2; argc -= 2; } else { fprintf(stderr, "The -format option requires an argument, default is YUY2.\n"); quit(10); } } else if (strcmp(argv[1], "-scale") == 0) { if (argv[2]) { scale = atoi(argv[2]); if (scale==0) { fprintf(stderr, "The -scale option requires an argument [from 1 to 50], default is 5.\n"); quit(10); } if ((scale<0) || (scale>50)) { fprintf(stderr, "The -scale option must be in range from 1 to 50, default is 5.\n"); quit(10); } argv += 2; argc -= 2; } else { fprintf(stderr, "The -fps option requires an argument [from 1 to 1000], default is 12.\n"); quit(10); } } else if ((strcmp(argv[1], "-help") == 0 ) || (strcmp(argv[1], "-h") == 0)) { PrintUsage(argv[0]); quit(0); } else { fprintf(stderr, "Unrecognized option: %s.\n", argv[1]); quit(10); } break; } RawMooseData=(Uint8*)malloc(MOOSEFRAME_SIZE * MOOSEFRAMES_COUNT); if (RawMooseData==NULL) { fprintf(stderr, "Can't allocate memory for movie !\n"); free(RawMooseData); quit(1); } /* load the trojan moose images */ handle=SDL_RWFromFile("moose.dat", "rb"); if (handle==NULL) { fprintf(stderr, "Can't find the file moose.dat !\n"); free(RawMooseData); quit(2); } SDL_RWread(handle, RawMooseData, MOOSEFRAME_SIZE, MOOSEFRAMES_COUNT); SDL_RWclose(handle); /* Set video mode */ if ( (screen=SDL_SetVideoMode(MOOSEPIC_W*scale, MOOSEPIC_H*scale, 0, SDL_RESIZABLE | SDL_SWSURFACE)) == NULL ) { fprintf(stderr, "Couldn't set video mode: %s\n", SDL_GetError()); free(RawMooseData); quit(4); } /* Set the window manager title bar */ SDL_WM_SetCaption("SDL test overlay: running moose", "testoverlay2"); for (i=0; iw,overlay->h,overlay->planes, overlay->hw_overlay?"hardware":"software", overlay->format==SDL_YV12_OVERLAY?"YV12": overlay->format==SDL_IYUV_OVERLAY?"IYUV": overlay->format==SDL_YUY2_OVERLAY?"YUY2": overlay->format==SDL_UYVY_OVERLAY?"UYVY": overlay->format==SDL_YVYU_OVERLAY?"YVYU": "Unknown"); for(i=0; iplanes; i++) { printf(" plane %d: pitch=%d\n", i, overlay->pitches[i]); } overlayrect.x=0; overlayrect.y=0; overlayrect.w=MOOSEPIC_W*scale; overlayrect.h=MOOSEPIC_H*scale; /* set the start frame */ i=0; fpsdelay=(Uint32)(1000/fps); /* Ignore key up events, they don't even get filtered */ SDL_EventState(SDL_KEYUP, SDL_IGNORE); lastftick=SDL_GetTicks(); /* Loop, waiting for QUIT or RESIZE */ while (1) { if (SDL_PollEvent(&event)) { switch (event.type) { case SDL_VIDEORESIZE: screen=SDL_SetVideoMode(event.resize.w, event.resize.h, 0, SDL_RESIZABLE | SDL_SWSURFACE); overlayrect.w=event.resize.w; overlayrect.h=event.resize.h; if (paused) { resized=1; } break; case SDL_MOUSEBUTTONDOWN: overlayrect.x = event.button.x - overlayrect.w/2; overlayrect.y = event.button.y - overlayrect.h/2; break; case SDL_KEYDOWN: if (event.key.keysym.sym == SDLK_SPACE) { paused=!paused; break; } if (event.key.keysym.sym != SDLK_ESCAPE) { break; } case SDL_QUIT: SDL_FreeYUVOverlay(overlay); for (i=0; ifpsdelay)||(resized)) { lastftick=SDL_GetTicks(); switch (overlay_format) { case SDL_YUY2_OVERLAY: ConvertRGBtoYUY2(MooseFrame[i], overlay, 0, 100); break; case SDL_YV12_OVERLAY: ConvertRGBtoYV12(MooseFrame[i], overlay, 0, 100); break; case SDL_UYVY_OVERLAY: ConvertRGBtoUYVY(MooseFrame[i], overlay, 0, 100); break; case SDL_YVYU_OVERLAY: ConvertRGBtoYVYU(MooseFrame[i], overlay, 0, 100); break; case SDL_IYUV_OVERLAY: ConvertRGBtoIYUV(MooseFrame[i], overlay, 0, 100); break; } SDL_DisplayYUVOverlay(overlay, &overlayrect); if (!resized) { i++; if (i==10) { i=0; } } else { resized=0; } } } /* kind of timeslice to OS */ SDL_Delay(1); } SDL_Quit(); return 0; } sdl12-compat-1.2.74/test/testpalette.c0000664000000000000000000002322414145137266014440 0ustar00/* * testpalette.c * * A simple test of runtime palette modification for animation * (using the SDL_SetPalette() API). */ #include #include #include #include /* This isn't in the Windows headers */ #ifndef M_PI #define M_PI 3.14159265358979323846 #endif #include "SDL.h" /* screen size */ #define SCRW 640 #define SCRH 480 #define NBOATS 5 #define SPEED 2 #ifndef MIN #define MIN(a, b) ((a) < (b) ? (a) : (b)) #endif #ifndef MAX #define MAX(a, b) ((a) > (b) ? (a) : (b)) #endif /* * wave colours: Made by taking a narrow cross-section of a wave picture * in Gimp, saving in PPM ascii format and formatting with Emacs macros. */ static SDL_Color wavemap[] = { {0,2,103}, {0,7,110}, {0,13,117}, {0,19,125}, {0,25,133}, {0,31,141}, {0,37,150}, {0,43,158}, {0,49,166}, {0,55,174}, {0,61,182}, {0,67,190}, {0,73,198}, {0,79,206}, {0,86,214}, {0,96,220}, {5,105,224}, {12,112,226}, {19,120,227}, {26,128,229}, {33,135,230}, {40,143,232}, {47,150,234}, {54,158,236}, {61,165,238}, {68,173,239}, {75,180,241}, {82,188,242}, {89,195,244}, {96,203,246}, {103,210,248}, {112,218,250}, {124,224,250}, {135,226,251}, {146,229,251}, {156,231,252}, {167,233,252}, {178,236,252}, {189,238,252}, {200,240,252}, {211,242,252}, {222,244,252}, {233,247,252}, {242,249,252}, {237,250,252}, {209,251,252}, {174,251,252}, {138,252,252}, {102,251,252}, {63,250,252}, {24,243,252}, {7,225,252}, {4,203,252}, {3,181,252}, {2,158,252}, {1,136,251}, {0,111,248}, {0,82,234}, {0,63,213}, {0,50,192}, {0,39,172}, {0,28,152}, {0,17,132}, {0,7,114} }; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } static void sdlerr(const char *when) { fprintf(stderr, "SDL error: %s: %s\n", when, SDL_GetError()); quit(1); } /* create a background surface */ static SDL_Surface *make_bg(SDL_Surface *screen, int startcol) { int i; SDL_Surface *bg = SDL_CreateRGBSurface(SDL_SWSURFACE, screen->w, screen->h, 8, 0, 0, 0, 0); if(!bg) sdlerr("creating background surface"); /* set the palette to the logical screen palette so that blits won't be translated */ SDL_SetColors(bg, screen->format->palette->colors, 0, 256); /* Make a wavy background pattern using colours 0-63 */ if(SDL_LockSurface(bg) < 0) sdlerr("locking background"); for(i = 0; i < SCRH; i++) { Uint8 *p = (Uint8 *)bg->pixels + i * bg->pitch; int j, d; d = 0; for(j = 0; j < SCRW; j++) { int v = MAX(d, -2); v = MIN(v, 2); if(i > 0) v += p[-bg->pitch] + 65 - startcol; p[j] = startcol + (v & 63); d += ((rand() >> 3) % 3) - 1; } } SDL_UnlockSurface(bg); return(bg); } /* * Return a surface flipped horisontally. Only works for 8bpp; * extension to arbitrary bitness is left as an exercise for the reader. */ static SDL_Surface *hflip(SDL_Surface *s) { int i; SDL_Surface *z = SDL_CreateRGBSurface(SDL_SWSURFACE, s->w, s->h, 8, 0, 0, 0, 0); /* copy palette */ SDL_SetColors(z, s->format->palette->colors, 0, s->format->palette->ncolors); if(SDL_LockSurface(s) < 0 || SDL_LockSurface(z) < 0) sdlerr("locking flip images"); for(i = 0; i < s->h; i++) { int j; Uint8 *from = (Uint8 *)s->pixels + i * s->pitch; Uint8 *to = (Uint8 *)z->pixels + i * z->pitch + s->w - 1; for(j = 0; j < s->w; j++) to[-j] = from[j]; } SDL_UnlockSurface(z); SDL_UnlockSurface(s); return z; } int main(int argc, char **argv) { SDL_Color cmap[256]; SDL_Surface *screen; SDL_Surface *bg; SDL_Surface *boat[2]; unsigned vidflags = 0; unsigned start; int fade_max = 400; int fade_level, fade_dir; int boatcols, frames, i, red; int boatx[NBOATS], boaty[NBOATS], boatdir[NBOATS]; int gamma_fade = 0; int gamma_ramp = 0; if(SDL_Init(SDL_INIT_VIDEO) < 0) sdlerr("initialising SDL"); while(--argc) { ++argv; if(strcmp(*argv, "-hw") == 0) vidflags |= SDL_HWSURFACE; else if(strcmp(*argv, "-fullscreen") == 0) vidflags |= SDL_FULLSCREEN; else if(strcmp(*argv, "-nofade") == 0) fade_max = 1; else if(strcmp(*argv, "-gamma") == 0) gamma_fade = 1; else if(strcmp(*argv, "-gammaramp") == 0) gamma_ramp = 1; else { fprintf(stderr, "usage: testpalette " " [-hw] [-fullscreen] [-nofade] [-gamma] [-gammaramp]\n"); quit(1); } } /* Ask explicitly for 8bpp and a hardware palette */ if((screen = SDL_SetVideoMode(SCRW, SCRH, 8, vidflags | SDL_HWPALETTE)) == NULL) { fprintf(stderr, "error setting %dx%d 8bpp indexed mode: %s\n", SCRW, SCRH, SDL_GetError()); quit(1); } if (vidflags & SDL_FULLSCREEN) SDL_ShowCursor (SDL_FALSE); if((boat[0] = SDL_LoadBMP("sail.bmp")) == NULL) sdlerr("loading sail.bmp"); /* We've chosen magenta (#ff00ff) as colour key for the boat */ SDL_SetColorKey(boat[0], SDL_SRCCOLORKEY | SDL_RLEACCEL, SDL_MapRGB(boat[0]->format, 0xff, 0x00, 0xff)); boatcols = boat[0]->format->palette->ncolors; boat[1] = hflip(boat[0]); SDL_SetColorKey(boat[1], SDL_SRCCOLORKEY | SDL_RLEACCEL, SDL_MapRGB(boat[1]->format, 0xff, 0x00, 0xff)); /* * First set the physical screen palette to black, so the user won't * see our initial drawing on the screen. */ memset(cmap, 0, sizeof(cmap)); SDL_SetPalette(screen, SDL_PHYSPAL, cmap, 0, 256); /* * Proper palette management is important when playing games with the * colormap. We have divided the palette as follows: * * index 0..(boatcols-1): used for the boat * index boatcols..(boatcols+63): used for the waves */ SDL_SetPalette(screen, SDL_LOGPAL, boat[0]->format->palette->colors, 0, boatcols); SDL_SetPalette(screen, SDL_LOGPAL, wavemap, boatcols, 64); /* * Now the logical screen palette is set, and will remain unchanged. * The boats already have the same palette so fast blits can be used. */ memcpy(cmap, screen->format->palette->colors, 256 * sizeof(SDL_Color)); /* save the index of the red colour for later */ red = SDL_MapRGB(screen->format, 0xff, 0x00, 0x00); bg = make_bg(screen, boatcols); /* make a nice wavy background surface */ /* initial screen contents */ if(SDL_BlitSurface(bg, NULL, screen, NULL) < 0) sdlerr("blitting background to screen"); SDL_Flip(screen); /* actually put the background on screen */ /* determine initial boat placements */ for(i = 0; i < NBOATS; i++) { boatx[i] = (rand() % (SCRW + boat[0]->w)) - boat[0]->w; boaty[i] = i * (SCRH - boat[0]->h) / (NBOATS - 1); boatdir[i] = ((rand() >> 5) & 1) * 2 - 1; } start = SDL_GetTicks(); frames = 0; fade_dir = 1; fade_level = 0; do { SDL_Event e; SDL_Rect updates[NBOATS]; SDL_Rect r; int redphase; /* A small event loop: just exit on any key or mouse button event */ while(SDL_PollEvent(&e)) { if(e.type == SDL_KEYDOWN || e.type == SDL_QUIT || e.type == SDL_MOUSEBUTTONDOWN) { if(fade_dir < 0) fade_level = 0; fade_dir = -1; } } /* move boats */ for(i = 0; i < NBOATS; i++) { int old_x = boatx[i]; /* update boat position */ boatx[i] += boatdir[i] * SPEED; if(boatx[i] <= -boat[0]->w || boatx[i] >= SCRW) boatdir[i] = -boatdir[i]; /* paint over the old boat position */ r.x = old_x; r.y = boaty[i]; r.w = boat[0]->w; r.h = boat[0]->h; if(SDL_BlitSurface(bg, &r, screen, &r) < 0) sdlerr("blitting background"); /* construct update rectangle (bounding box of old and new pos) */ updates[i].x = MIN(old_x, boatx[i]); updates[i].y = boaty[i]; updates[i].w = boat[0]->w + SPEED; updates[i].h = boat[0]->h; /* clip update rectangle to screen */ if(updates[i].x < 0) { updates[i].w += updates[i].x; updates[i].x = 0; } if(updates[i].x + updates[i].w > SCRW) updates[i].w = SCRW - updates[i].x; } for(i = 0; i < NBOATS; i++) { /* paint boat on new position */ r.x = boatx[i]; r.y = boaty[i]; if(SDL_BlitSurface(boat[(boatdir[i] + 1) / 2], NULL, screen, &r) < 0) sdlerr("blitting boat"); } /* cycle wave palette */ for(i = 0; i < 64; i++) cmap[boatcols + ((i + frames) & 63)] = wavemap[i]; if(fade_dir) { /* Fade the entire palette in/out */ fade_level += fade_dir; if(gamma_fade) { /* Fade linearly in gamma level (lousy) */ float level = (float)fade_level / fade_max; if(SDL_SetGamma(level, level, level) < 0) sdlerr("setting gamma"); } else if(gamma_ramp) { /* Fade using gamma ramp (better) */ Uint16 ramp[256]; for(i = 0; i < 256; i++) ramp[i] = (i * fade_level / fade_max) << 8; if(SDL_SetGammaRamp(ramp, ramp, ramp) < 0) sdlerr("setting gamma ramp"); } else { /* Fade using direct palette manipulation (best) */ memcpy(cmap, screen->format->palette->colors, boatcols * sizeof(SDL_Color)); for(i = 0; i < boatcols + 64; i++) { cmap[i].r = cmap[i].r * fade_level / fade_max; cmap[i].g = cmap[i].g * fade_level / fade_max; cmap[i].b = cmap[i].b * fade_level / fade_max; } } if(fade_level == fade_max) fade_dir = 0; } /* pulse the red colour (done after the fade, for a night effect) */ redphase = frames % 64; cmap[red].r = (int)(255 * sin(redphase * M_PI / 63)); SDL_SetPalette(screen, SDL_PHYSPAL, cmap, 0, boatcols + 64); /* update changed areas of the screen */ SDL_UpdateRects(screen, NBOATS, updates); frames++; } while(fade_level > 0); printf("%d frames, %.2f fps\n", frames, 1000.0 * frames / (SDL_GetTicks() - start)); if (vidflags & SDL_FULLSCREEN) SDL_ShowCursor (SDL_TRUE); SDL_Quit(); return 0; } sdl12-compat-1.2.74/test/testplatform.c0000664000000000000000000001123514074075446014627 0ustar00#include #include "SDL.h" #include "SDL_endian.h" #include "SDL_cpuinfo.h" /* * Watcom C flags these as Warning 201: "Unreachable code" if you just * compare them directly, so we push it through a function to keep the * compiler quiet. --ryan. */ static int badsize(size_t sizeoftype, size_t hardcodetype) { return sizeoftype != hardcodetype; } int TestTypes(SDL_bool verbose) { int error = 0; if ( badsize(sizeof(Uint8), 1) ) { if ( verbose ) printf("sizeof(Uint8) != 1, instead = %lu\n", (unsigned long) sizeof(Uint8)); ++error; } if ( badsize(sizeof(Uint16), 2) ) { if ( verbose ) printf("sizeof(Uint16) != 2, instead = %lu\n", (unsigned long) sizeof(Uint16)); ++error; } if ( badsize(sizeof(Uint32), 4) ) { if ( verbose ) printf("sizeof(Uint32) != 4, instead = %lu\n", (unsigned long) sizeof(Uint32)); ++error; } #ifdef SDL_HAS_64BIT_TYPE if ( badsize(sizeof(Uint64), 8) ) { if ( verbose ) printf("sizeof(Uint64) != 8, instead = %lu\n", (unsigned long) sizeof(Uint64)); ++error; } #else if ( verbose ) { printf("WARNING: No 64-bit datatype on this platform\n"); } #endif if ( verbose && !error ) printf("All data types are the expected size.\n"); return( error ? 1 : 0 ); } int TestEndian(SDL_bool verbose) { int error = 0; Uint16 value = 0x1234; int real_byteorder; Uint16 value16 = 0xCDAB; Uint16 swapped16 = 0xABCD; Uint32 value32 = 0xEFBEADDE; Uint32 swapped32 = 0xDEADBEEF; #ifdef SDL_HAS_64BIT_TYPE Uint64 value64, swapped64; value64 = 0xEFBEADDE; value64 <<= 32; value64 |= 0xCDAB3412; swapped64 = 0x1234ABCD; swapped64 <<= 32; swapped64 |= 0xDEADBEEF; #endif if ( verbose ) { printf("Detected a %s endian machine.\n", (SDL_BYTEORDER == SDL_LIL_ENDIAN) ? "little" : "big"); } if ( (*((char *)&value) >> 4) == 0x1 ) { real_byteorder = SDL_BIG_ENDIAN; } else { real_byteorder = SDL_LIL_ENDIAN; } if ( real_byteorder != SDL_BYTEORDER ) { if ( verbose ) { printf("Actually a %s endian machine!\n", (real_byteorder == SDL_LIL_ENDIAN) ? "little" : "big"); } ++error; } if ( verbose ) { printf("Value 16 = 0x%X, swapped = 0x%X\n", value16, SDL_Swap16(value16)); } if ( SDL_Swap16(value16) != swapped16 ) { if ( verbose ) { printf("16 bit value swapped incorrectly!\n"); } ++error; } if ( verbose ) { printf("Value 32 = 0x%X, swapped = 0x%X\n", value32, SDL_Swap32(value32)); } if ( SDL_Swap32(value32) != swapped32 ) { if ( verbose ) { printf("32 bit value swapped incorrectly!\n"); } ++error; } #ifdef SDL_HAS_64BIT_TYPE if ( verbose ) { #ifdef _WIN32 printf("Value 64 = 0x%I64X, swapped = 0x%I64X\n", value64, SDL_Swap64(value64)); #else printf("Value 64 = 0x%llX, swapped = 0x%llX\n", (unsigned long long) value64, (unsigned long long) SDL_Swap64(value64)); #endif } if ( SDL_Swap64(value64) != swapped64 ) { if ( verbose ) { printf("64 bit value swapped incorrectly!\n"); } ++error; } #endif return( error ? 1 : 0 ); } int TestCPUInfo(SDL_bool verbose) { if ( verbose ) { printf("RDTSC %s\n", SDL_HasRDTSC() ? "detected" : "not detected"); printf("MMX %s\n", SDL_HasMMX() ? "detected" : "not detected"); printf("MMX Ext %s\n", SDL_HasMMXExt() ? "detected" : "not detected"); printf("3DNow %s\n", SDL_Has3DNow() ? "detected" : "not detected"); printf("3DNow Ext %s\n", SDL_Has3DNowExt() ? "detected" : "not detected"); printf("SSE %s\n", SDL_HasSSE() ? "detected" : "not detected"); printf("SSE2 %s\n", SDL_HasSSE2() ? "detected" : "not detected"); printf("AltiVec %s\n", SDL_HasAltiVec() ? "detected" : "not detected"); } return(0); } int main(int argc, char *argv[]) { SDL_bool verbose = SDL_TRUE; int status = 0; if ( argv[1] && (SDL_strcmp(argv[1], "-q") == 0) ) { verbose = SDL_FALSE; } if ( verbose ) { printf("This system is running %s\n", #if __AIX__ "AIX" #elif __HAIKU__ /* Haiku must appear here before BeOS, since it also defines __BEOS__ */ "Haiku" #elif __BEOS__ "BeOS" #elif __BSDI__ "BSDI" #elif __DREAMCAST__ "Dreamcast" #elif __FREEBSD__ "FreeBSD" #elif __HPUX__ "HP-UX" #elif __IRIX__ "Irix" #elif __LINUX__ "Linux" #elif __MINT__ "Atari MiNT" #elif __MACOS__ "MacOS Classic" #elif __MACOSX__ "Mac OS X" #elif __NETBSD__ "NetBSD" #elif __OPENBSD__ "OpenBSD" #elif __OS2__ "OS/2" #elif __OSF__ "OSF/1" #elif __QNXNTO__ "QNX Neutrino" #elif __RISCOS__ "RISC OS" #elif __SOLARIS__ "Solaris" #elif __WIN32__ #ifdef _WIN32_WCE "Windows CE" #else "Windows" #endif #else "an unknown operating system! (see SDL_platform.h)" #endif ); } status += TestTypes(verbose); status += TestEndian(verbose); status += TestCPUInfo(verbose); return status; } sdl12-compat-1.2.74/test/testsem.c0000664000000000000000000000460112115006433013546 0ustar00 /* Simple test of the SDL semaphore code */ #include #include #include #include "SDL.h" #include "SDL_thread.h" #define NUM_THREADS 10 static SDL_sem *sem; int alive = 1; int SDLCALL ThreadFunc(void *data) { int threadnum = (int)(uintptr_t)data; while ( alive ) { SDL_SemWait(sem); fprintf(stderr, "Thread number %d has got the semaphore (value = %d)!\n", threadnum, SDL_SemValue(sem)); SDL_Delay(200); SDL_SemPost(sem); fprintf(stderr, "Thread number %d has released the semaphore (value = %d)!\n", threadnum, SDL_SemValue(sem)); SDL_Delay(1); /* For the scheduler */ } printf("Thread number %d exiting.\n", threadnum); return 0; } static void killed(int sig) { alive = 0; } static void TestWaitTimeout(void) { Uint32 start_ticks; Uint32 end_ticks; Uint32 duration; int retval; sem = SDL_CreateSemaphore(0); printf("Waiting 2 seconds on semaphore\n"); start_ticks = SDL_GetTicks(); retval = SDL_SemWaitTimeout(sem, 2000); end_ticks = SDL_GetTicks(); duration = end_ticks - start_ticks; /* Accept a little offset in the effective wait */ if (duration > 1900 && duration < 2050) printf("Wait done.\n"); else fprintf(stderr, "Wait took %d milliseconds\n", duration); /* Check to make sure the return value indicates timed out */ if (retval != SDL_MUTEX_TIMEDOUT) fprintf(stderr, "SDL_SemWaitTimeout returned: %d; expected: %d\n", retval, SDL_MUTEX_TIMEDOUT); } int main(int argc, char **argv) { SDL_Thread *threads[NUM_THREADS]; uintptr_t i; int init_sem; if(argc < 2) { fprintf(stderr,"Usage: %s init_value\n", argv[0]); return(1); } /* Load the SDL library */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } signal(SIGTERM, killed); signal(SIGINT, killed); init_sem = atoi(argv[1]); sem = SDL_CreateSemaphore(init_sem); printf("Running %d threads, semaphore value = %d\n", NUM_THREADS, init_sem); /* Create all the threads */ for( i = 0; i < NUM_THREADS; ++i ) { threads[i] = SDL_CreateThread(ThreadFunc, (void*)i); } /* Wait 10 seconds */ SDL_Delay(10 * 1000); /* Wait for all threads to finish */ printf("Waiting for threads to finish\n"); alive = 0; for( i = 0; i < NUM_THREADS; ++i ) { SDL_WaitThread(threads[i], NULL); } printf("Finished waiting for threads\n"); SDL_DestroySemaphore(sem); TestWaitTimeout(); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testsprite.c0000664000000000000000000002015315045234655014306 0ustar00/* Simple program: Move N sprites around on the screen as fast as possible */ #include #include #include #include #include #include #include "SDL.h" #define NUM_SPRITES 100 #define MAX_SPEED 1 SDL_Surface *sprite; int numsprites; SDL_Rect *sprite_rects; SDL_Rect *positions; SDL_Rect *velocities; int sprites_visible; int debug_flip; Uint16 sprite_w, sprite_h; int refresh_rate = SDL_REFRESH_DEFAULT; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } int LoadSprite(const char *file) { SDL_Surface *temp; /* Load the sprite image */ sprite = SDL_LoadBMP(file); if ( sprite == NULL ) { fprintf(stderr, "Couldn't load %s: %s", file, SDL_GetError()); return(-1); } /* Set transparent pixel as the pixel at (0,0) */ if ( sprite->format->palette ) { SDL_SetColorKey(sprite, (SDL_SRCCOLORKEY|SDL_RLEACCEL), *(Uint8 *)sprite->pixels); } /* Convert sprite to video format */ temp = SDL_DisplayFormat(sprite); SDL_FreeSurface(sprite); if ( temp == NULL ) { fprintf(stderr, "Couldn't convert background: %s\n", SDL_GetError()); return(-1); } sprite = temp; /* We're ready to roll. :) */ return(0); } void MoveSprites(SDL_Surface *screen, Uint32 background) { int i, nupdates; SDL_Rect area, *position, *velocity; nupdates = 0; /* Erase all the sprites if necessary */ if ( sprites_visible ) { SDL_FillRect(screen, NULL, background); } /* Move the sprite, bounce at the wall, and draw */ for ( i=0; ix += velocity->x; if ( (position->x < 0) || (position->x >= (screen->w - sprite_w)) ) { velocity->x = -velocity->x; position->x += velocity->x; } position->y += velocity->y; if ( (position->y < 0) || (position->y >= (screen->h - sprite_w)) ) { velocity->y = -velocity->y; position->y += velocity->y; } /* Blit the sprite onto the screen */ area = *position; SDL_BlitSurface(sprite, NULL, screen, &area); sprite_rects[nupdates++] = area; } if (debug_flip) { if ( (screen->flags & SDL_DOUBLEBUF) == SDL_DOUBLEBUF ) { static int t = 0; Uint32 color = SDL_MapRGB (screen->format, 255, 0, 0); SDL_Rect r; r.x = (Sint16) ((sin((float)t * 2 * 3.1459) + 1.0) / 2.0 * (screen->w-20)); r.y = 0; r.w = 20; r.h = screen->h; SDL_FillRect (screen, &r, color); t+=2; } } /* Update the screen! */ if ( (screen->flags & SDL_DOUBLEBUF) == SDL_DOUBLEBUF ) { SDL_Flip(screen); } else { SDL_UpdateRects(screen, nupdates, sprite_rects); } sprites_visible = 1; } /* This is a way of telling whether or not to use hardware surfaces */ Uint32 FastestFlags(Uint32 flags, int width, int height, int bpp) { const SDL_VideoInfo *info; /* Hardware acceleration is only used in fullscreen mode */ flags |= SDL_FULLSCREEN; /* Check for various video capabilities */ info = SDL_GetVideoInfo(); if ( info->blit_hw_CC && info->blit_fill ) { /* We use accelerated colorkeying and color filling */ flags |= SDL_HWSURFACE; } /* If we have enough video memory, and will use accelerated blits directly to it, then use page flipping. */ if ( (flags & SDL_HWSURFACE) == SDL_HWSURFACE ) { /* Direct hardware blitting without double-buffering causes really bad flickering. */ if ( info->video_mem*1024 > ((Uint32)(height*width*bpp/8)) ) { flags |= SDL_DOUBLEBUF; } else { flags &= ~SDL_HWSURFACE; } } /* Return the flags */ return(flags); } int main(int argc, char *argv[]) { SDL_Surface *screen; Uint8 *mem; int width, height; Uint8 video_bpp; Uint32 videoflags; Uint32 background; int i, done; SDL_Event event; Uint32 then, now, frames; /* Initialize SDL */ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } numsprites = NUM_SPRITES; videoflags = SDL_SWSURFACE|SDL_ANYFORMAT; width = 640; height = 480; video_bpp = 8; debug_flip = 0; while ( argc > 1 ) { --argc; if ( strcmp(argv[argc-1], "-width") == 0 ) { width = atoi(argv[argc]); --argc; } else if ( strcmp(argv[argc-1], "-height") == 0 ) { height = atoi(argv[argc]); --argc; } else if ( strcmp(argv[argc-1], "-refresh") == 0 ) { refresh_rate = atoi(argv[argc]); --argc; } else if ( strcmp(argv[argc-1], "-bpp") == 0 ) { video_bpp = atoi(argv[argc]); videoflags &= ~SDL_ANYFORMAT; --argc; } else if ( strcmp(argv[argc], "-fast") == 0 ) { videoflags = FastestFlags(videoflags, width, height, video_bpp); } else if ( strcmp(argv[argc], "-hw") == 0 ) { videoflags ^= SDL_HWSURFACE; } else if ( strcmp(argv[argc], "-flip") == 0 ) { videoflags ^= SDL_DOUBLEBUF; } else if ( strcmp(argv[argc], "-debugflip") == 0 ) { debug_flip ^= 1; } else if ( strcmp(argv[argc], "-fullscreen") == 0 ) { videoflags ^= SDL_FULLSCREEN; } else if ( strcmp(argv[argc], "-noframe") == 0 ) { videoflags ^= SDL_NOFRAME; } else if ( isdigit(argv[argc][0]) ) { numsprites = atoi(argv[argc]); } else { fprintf(stderr, "Usage: %s [-bpp N] [-refresh N] [-hw] [-flip] [-fast] [-fullscreen] [numsprites]\n", argv[0]); quit(1); } } /* Set video mode */ SDL_SetRefreshRate(refresh_rate); screen = SDL_SetVideoMode(width, height, video_bpp, videoflags); if ( ! screen ) { fprintf(stderr, "Couldn't set %dx%d video mode: %s\n", width, height, SDL_GetError()); quit(2); } /* Load the sprite */ if ( LoadSprite("icon.bmp") < 0 ) { quit(1); } /* Allocate memory for the sprite info */ mem = (Uint8 *)malloc(4*sizeof(SDL_Rect)*numsprites); if ( mem == NULL ) { SDL_FreeSurface(sprite); fprintf(stderr, "Out of memory!\n"); quit(2); } sprite_rects = (SDL_Rect *)mem; positions = sprite_rects; sprite_rects += numsprites; velocities = sprite_rects; sprite_rects += numsprites; sprite_w = sprite->w; sprite_h = sprite->h; srand((unsigned int) time(NULL)); for ( i=0; iw - sprite_w); positions[i].y = rand()%(screen->h - sprite_h); positions[i].w = sprite->w; positions[i].h = sprite->h; velocities[i].x = 0; velocities[i].y = 0; while ( ! velocities[i].x && ! velocities[i].y ) { velocities[i].x = (rand()%(MAX_SPEED*2+1))-MAX_SPEED; velocities[i].y = (rand()%(MAX_SPEED*2+1))-MAX_SPEED; } } background = SDL_MapRGB(screen->format, 0x00, 0x00, 0x00); /* Print out information about our surfaces */ printf("Screen is at %d bits per pixel\n",screen->format->BitsPerPixel); if ( (screen->flags & SDL_HWSURFACE) == SDL_HWSURFACE ) { printf("Screen is in video memory\n"); } else { printf("Screen is in system memory\n"); } if ( (screen->flags & SDL_DOUBLEBUF) == SDL_DOUBLEBUF ) { printf("Screen has double-buffering enabled\n"); } if ( (sprite->flags & SDL_HWSURFACE) == SDL_HWSURFACE ) { printf("Sprite is in video memory\n"); } else { printf("Sprite is in system memory\n"); } /* Run a sample blit to trigger blit acceleration */ { SDL_Rect dst; dst.x = 0; dst.y = 0; dst.w = sprite->w; dst.h = sprite->h; SDL_BlitSurface(sprite, NULL, screen, &dst); SDL_FillRect(screen, &dst, background); } if ( (sprite->flags & SDL_HWACCEL) == SDL_HWACCEL ) { printf("Sprite blit uses hardware acceleration\n"); } if ( (sprite->flags & SDL_RLEACCEL) == SDL_RLEACCEL ) { printf("Sprite blit uses RLE acceleration\n"); } /* Loop, blitting sprites and waiting for a keystroke */ frames = 0; then = SDL_GetTicks(); done = 0; sprites_visible = 0; while ( !done ) { /* Check for events */ ++frames; while ( SDL_PollEvent(&event) ) { switch (event.type) { case SDL_MOUSEBUTTONDOWN: SDL_WarpMouse(screen->w/2, screen->h/2); break; case SDL_KEYDOWN: /* Any keypress quits the app... */ case SDL_QUIT: done = 1; break; default: break; } } MoveSprites(screen, background); } SDL_FreeSurface(sprite); free(mem); /* Print out some timing information */ now = SDL_GetTicks(); if ( now > then ) { printf("%2.2f frames per second\n", ((double)frames*1000)/(now-then)); } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testthread.c0000664000000000000000000000323714214663564014255 0ustar00 /* Simple test of the SDL threading code */ #include #include #include #include "SDL.h" #include "SDL_thread.h" static int alive = 0; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } int SDLCALL ThreadFunc(void *data) { printf("Started thread %s: My thread id is %u\n", (char *)data, SDL_ThreadID()); while ( alive ) { printf("Thread '%s' is alive!\n", (char *)data); SDL_Delay(1*1000); } printf("Thread '%s' exiting!\n", (char *)data); return(0); } static void killed(int sig) { printf("Killed with SIGTERM, waiting 5 seconds to exit\n"); SDL_Delay(5*1000); alive = 0; quit(0); } int main(int argc, char *argv[]) { SDL_Thread *thread; /* Load the SDL library */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } alive = 1; thread = SDL_CreateThread(ThreadFunc, "#1"); if ( thread == NULL ) { fprintf(stderr, "Couldn't create thread: %s\n", SDL_GetError()); quit(1); } SDL_Delay(5*1000); printf("Waiting for thread #1\n"); alive = 0; SDL_WaitThread(thread, NULL); alive = 1; thread = SDL_CreateThread(ThreadFunc, "#2"); if ( thread == NULL ) { fprintf(stderr, "Couldn't create thread: %s\n", SDL_GetError()); quit(1); } SDL_Delay(5*1000); printf("Killing thread #2\n"); SDL_KillThread(thread); alive = 1; signal(SIGTERM, killed); thread = SDL_CreateThread(ThreadFunc, "#3"); if ( thread == NULL ) { fprintf(stderr, "Couldn't create thread: %s\n", SDL_GetError()); quit(1); } raise(SIGTERM); SDL_Quit(); /* Never reached */ return(0); /* Never reached */ } sdl12-compat-1.2.74/test/testtimer.c0000664000000000000000000000361014302162556014112 0ustar00 /* Test program to check the resolution of the SDL timer on the current platform */ #include #include #include "SDL.h" #define DEFAULT_RESOLUTION 1 static int ticks = 0; static Uint32 SDLCALL ticktock(Uint32 interval) { ++ticks; return(interval); } static Uint32 SDLCALL callback(Uint32 interval, void *param) { printf("Timer %d : param = %d\n", interval, (int)(uintptr_t)param); return interval; } int main(int argc, char *argv[]) { int desired; SDL_TimerID t1, t2, t3; if ( SDL_Init(SDL_INIT_TIMER) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return(1); } /* Start the timer */ desired = 0; if ( argv[1] ) { desired = atoi(argv[1]); } if ( desired == 0 ) { desired = DEFAULT_RESOLUTION; } SDL_SetTimer(desired, ticktock); /* Wait 10 seconds */ printf("Waiting 10 seconds\n"); SDL_Delay(10*1000); /* Stop the timer */ SDL_SetTimer(0, NULL); /* Print the results */ if ( ticks ) { fprintf(stderr, "Timer resolution: desired = %d ms, actual = %f ms\n", desired, (double)(10*1000)/ticks); } /* Test multiple timers */ printf("Testing multiple timers...\n"); t1 = SDL_AddTimer(100, callback, (void*)1); if(!t1) fprintf(stderr,"Could not create timer 1: %s\n", SDL_GetError()); t2 = SDL_AddTimer(50, callback, (void*)2); if(!t2) fprintf(stderr,"Could not create timer 2: %s\n", SDL_GetError()); t3 = SDL_AddTimer(233, callback, (void*)3); if(!t3) fprintf(stderr,"Could not create timer 3: %s\n", SDL_GetError()); /* Wait 10 seconds */ printf("Waiting 10 seconds\n"); SDL_Delay(10*1000); printf("Removing timer 1 and waiting 5 more seconds\n"); SDL_RemoveTimer(t1); SDL_Delay(5*1000); SDL_RemoveTimer(t2); SDL_RemoveTimer(t3); printf("Removing bogus timer..."); if (SDL_RemoveTimer(t1)) { printf("UHOH, SHOULD HAVE FAILED\n"); } else { printf("OK!\n"); } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testver.c0000664000000000000000000000146412115006433013562 0ustar00 /* Test program to compare the compile-time version of SDL with the linked version of SDL */ #include #include #include "SDL.h" int main(int argc, char *argv[]) { SDL_version compiled; /* Initialize SDL */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); exit(1); } #ifdef DEBUG fprintf(stderr, "SDL initialized\n"); #endif #if SDL_VERSION_ATLEAST(1, 2, 0) printf("Compiled with SDL 1.2 or newer\n"); #else printf("Compiled with SDL older than 1.2\n"); #endif SDL_VERSION(&compiled); printf("Compiled version: %d.%d.%d\n", compiled.major, compiled.minor, compiled.patch); printf("Linked version: %d.%d.%d\n", SDL_Linked_Version()->major, SDL_Linked_Version()->minor, SDL_Linked_Version()->patch); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testvidinfo.c0000664000000000000000000003124312115006433014422 0ustar00 /* Simple program -- figure out what kind of video display we have */ #include #include #include #include #include "SDL.h" #define NUM_BLITS 10 #define NUM_UPDATES 500 #define FLAG_MASK (SDL_HWSURFACE | SDL_FULLSCREEN | SDL_DOUBLEBUF | \ SDL_SRCCOLORKEY | SDL_SRCALPHA | SDL_RLEACCEL | \ SDL_RLEACCELOK) void PrintFlags(Uint32 flags) { printf("0x%8.8x", (flags & FLAG_MASK)); if ( flags & SDL_HWSURFACE ) { printf(" SDL_HWSURFACE"); } else { printf(" SDL_SWSURFACE"); } if ( flags & SDL_FULLSCREEN ) { printf(" | SDL_FULLSCREEN"); } if ( flags & SDL_DOUBLEBUF ) { printf(" | SDL_DOUBLEBUF"); } if ( flags & SDL_SRCCOLORKEY ) { printf(" | SDL_SRCCOLORKEY"); } if ( flags & SDL_SRCALPHA ) { printf(" | SDL_SRCALPHA"); } if ( flags & SDL_RLEACCEL ) { printf(" | SDL_RLEACCEL"); } if ( flags & SDL_RLEACCELOK ) { printf(" | SDL_RLEACCELOK"); } } int RunBlitTests(SDL_Surface *screen, SDL_Surface *bmp, int blitcount) { int i, j; int maxx; int maxy; SDL_Rect dst; maxx = (int)screen->w - bmp->w + 1; maxy = (int)screen->h - bmp->h + 1; for ( i = 0; i < NUM_UPDATES; ++i ) { for ( j = 0; j < blitcount; ++j ) { if ( maxx ) { dst.x = rand() % maxx; } else { dst.x = 0; } if ( maxy ) { dst.y = rand() % maxy; } else { dst.y = 0; } dst.w = bmp->w; dst.h = bmp->h; SDL_BlitSurface(bmp, NULL, screen, &dst); } SDL_Flip(screen); } return i; } int RunModeTests(SDL_Surface *screen) { Uint32 then, now; Uint32 frames; float seconds; int i; Uint8 r, g, b; SDL_Surface *bmp, *bmpcc, *tmp; SDL_Event event; while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* First test fills and screen update speed */ printf("Running color fill and fullscreen update test\n"); then = SDL_GetTicks(); frames = 0; for ( i = 0; i < 256; ++i ) { r = i; g = 0; b = 0; SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, r, g, b)); SDL_Flip(screen); ++frames; } for ( i = 0; i < 256; ++i ) { r = 0; g = i; b = 0; SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, r, g, b)); SDL_Flip(screen); ++frames; } for ( i = 0; i < 256; ++i ) { r = 0; g = 0; b = i; SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, r, g, b)); SDL_Flip(screen); ++frames; } now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d fills and flips in %2.2f seconds, %2.2f FPS\n", frames, seconds, (float)frames / seconds); } else { printf("%d fills and flips in zero seconds!n", frames); } /* clear the screen after fill test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the generic blit test */ bmp = SDL_LoadBMP("sample.bmp"); if ( ! bmp ) { printf("Couldn't load sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running freshly loaded blit test: %dx%d at %d bpp, flags: ", bmp->w, bmp->h, bmp->format->BitsPerPixel); PrintFlags(bmp->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmp, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } /* clear the screen after blit test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the colorkeyed blit test */ bmpcc = SDL_LoadBMP("sample.bmp"); if ( ! bmpcc ) { printf("Couldn't load sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running freshly loaded cc blit test: %dx%d at %d bpp, flags: ", bmpcc->w, bmpcc->h, bmpcc->format->BitsPerPixel); SDL_SetColorKey(bmpcc, SDL_SRCCOLORKEY | SDL_RLEACCEL, *(Uint8 *)bmpcc->pixels); PrintFlags(bmpcc->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmpcc, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d cc blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d cc blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } /* clear the screen after cc blit test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the generic blit test */ tmp = bmp; bmp = SDL_DisplayFormat(bmp); SDL_FreeSurface(tmp); if ( ! bmp ) { printf("Couldn't convert sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running display format blit test: %dx%d at %d bpp, flags: ", bmp->w, bmp->h, bmp->format->BitsPerPixel); PrintFlags(bmp->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmp, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } /* clear the screen after blit test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the colorkeyed blit test */ tmp = bmpcc; bmpcc = SDL_DisplayFormat(bmpcc); SDL_FreeSurface(tmp); if ( ! bmpcc ) { printf("Couldn't convert sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running display format cc blit test: %dx%d at %d bpp, flags: ", bmpcc->w, bmpcc->h, bmpcc->format->BitsPerPixel); PrintFlags(bmpcc->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmpcc, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d cc blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d cc blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } /* clear the screen after cc blit test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the alpha blit test only if screen bpp>8 */ if (bmp->format->BitsPerPixel>8) { SDL_FreeSurface(bmp); bmp = SDL_LoadBMP("sample.bmp"); SDL_SetAlpha(bmp, SDL_SRCALPHA, 85); /* 85 - 33% alpha */ tmp = bmp; bmp = SDL_DisplayFormat(bmp); SDL_FreeSurface(tmp); if ( ! bmp ) { printf("Couldn't convert sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running display format alpha blit test: %dx%d at %d bpp, flags: ", bmp->w, bmp->h, bmp->format->BitsPerPixel); PrintFlags(bmp->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmp, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d alpha blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d alpha blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } } /* clear the screen after alpha blit test */ SDL_FillRect(screen, NULL, SDL_MapRGB(screen->format, 0, 0, 0)); SDL_Flip(screen); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } /* run the cc+alpha blit test only if screen bpp>8 */ if (bmp->format->BitsPerPixel>8) { SDL_FreeSurface(bmpcc); bmpcc = SDL_LoadBMP("sample.bmp"); SDL_SetAlpha(bmpcc, SDL_SRCALPHA, 85); /* 85 - 33% alpha */ SDL_SetColorKey(bmpcc, SDL_SRCCOLORKEY | SDL_RLEACCEL, *(Uint8 *)bmpcc->pixels); tmp = bmpcc; bmpcc = SDL_DisplayFormat(bmpcc); SDL_FreeSurface(tmp); if ( ! bmpcc ) { printf("Couldn't convert sample.bmp: %s\n", SDL_GetError()); return 0; } printf("Running display format cc+alpha blit test: %dx%d at %d bpp, flags: ", bmpcc->w, bmpcc->h, bmpcc->format->BitsPerPixel); PrintFlags(bmpcc->flags); printf("\n"); then = SDL_GetTicks(); frames = RunBlitTests(screen, bmpcc, NUM_BLITS); now = SDL_GetTicks(); seconds = (float)(now - then) / 1000.0f; if ( seconds > 0.0f ) { printf("%d cc+alpha blits / %d updates in %2.2f seconds, %2.2f FPS\n", NUM_BLITS*frames, frames, seconds, (float)frames / seconds); } else { printf("%d cc+alpha blits / %d updates in zero seconds!\n", NUM_BLITS*frames, frames); } } SDL_FreeSurface(bmpcc); SDL_FreeSurface(bmp); while ( SDL_PollEvent(&event) ) { if ( event.type == SDL_KEYDOWN ) return 0; } return 1; } void RunVideoTests() { static const struct { int w, h, bpp; } mode_list[] = { { 640, 480, 8 }, { 640, 480, 16 }, { 640, 480, 32 }, { 800, 600, 8 }, { 800, 600, 16 }, { 800, 600, 32 }, { 1024, 768, 8 }, { 1024, 768, 16 }, { 1024, 768, 32 } }; static const Uint32 flags[] = { (SDL_SWSURFACE), (SDL_SWSURFACE | SDL_FULLSCREEN), (SDL_HWSURFACE | SDL_FULLSCREEN), (SDL_HWSURFACE | SDL_FULLSCREEN | SDL_DOUBLEBUF) }; int i, j; SDL_Surface *screen; /* Test out several different video mode combinations */ SDL_WM_SetCaption("SDL Video Benchmark", "vidtest"); SDL_ShowCursor(0); for ( i = 0; i < SDL_TABLESIZE(mode_list); ++i ) { for ( j = 0; j < SDL_TABLESIZE(flags); ++j ) { printf("===================================\n"); printf("Setting video mode: %dx%d at %d bpp, flags: ", mode_list[i].w, mode_list[i].h, mode_list[i].bpp); PrintFlags(flags[j]); printf("\n"); screen = SDL_SetVideoMode(mode_list[i].w, mode_list[i].h, mode_list[i].bpp, flags[j]); if ( ! screen ) { printf("Setting video mode failed: %s\n", SDL_GetError()); continue; } if ( (screen->flags & FLAG_MASK) != flags[j] ) { printf("Flags didn't match: "); PrintFlags(screen->flags); printf("\n"); continue; } if ( ! RunModeTests(screen) ) { return; } } } } int main(int argc, char *argv[]) { const SDL_VideoInfo *info; int i; SDL_Rect **modes; char driver[128]; if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); exit(1); } if ( SDL_VideoDriverName(driver, sizeof(driver)) ) { printf("Video driver: %s\n", driver); } info = SDL_GetVideoInfo(); printf( "Current display: %dx%d, %d bits-per-pixel\n", info->current_w, info->current_h, info->vfmt->BitsPerPixel); if ( info->vfmt->palette == NULL ) { printf(" Red Mask = 0x%.8x\n", info->vfmt->Rmask); printf(" Green Mask = 0x%.8x\n", info->vfmt->Gmask); printf(" Blue Mask = 0x%.8x\n", info->vfmt->Bmask); } /* Print available fullscreen video modes */ modes = SDL_ListModes(NULL, SDL_FULLSCREEN); if ( modes == (SDL_Rect **)0 ) { printf("No available fullscreen video modes\n"); } else if ( modes == (SDL_Rect **)-1 ) { printf("No special fullscreen video modes\n"); } else { printf("Fullscreen video modes:\n"); for ( i=0; modes[i]; ++i ) { printf("\t%dx%dx%d\n", modes[i]->w, modes[i]->h, info->vfmt->BitsPerPixel); } } if ( info->wm_available ) { printf("A window manager is available\n"); } if ( info->hw_available ) { printf("Hardware surfaces are available (%dK video memory)\n", info->video_mem); } if ( info->blit_hw ) { printf( "Copy blits between hardware surfaces are accelerated\n"); } if ( info->blit_hw_CC ) { printf( "Colorkey blits between hardware surfaces are accelerated\n"); } if ( info->blit_hw_A ) { printf( "Alpha blits between hardware surfaces are accelerated\n"); } if ( info->blit_sw ) { printf( "Copy blits from software surfaces to hardware surfaces are accelerated\n"); } if ( info->blit_sw_CC ) { printf( "Colorkey blits from software surfaces to hardware surfaces are accelerated\n"); } if ( info->blit_sw_A ) { printf( "Alpha blits from software surfaces to hardware surfaces are accelerated\n"); } if ( info->blit_fill ) { printf( "Color fills on hardware surfaces are accelerated\n"); } if ( argv[1] && (strcmp(argv[1], "-benchmark") == 0) ) { RunVideoTests(); } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testwin.c0000664000000000000000000002160514145137266013600 0ustar00 /* Bring up a window and play with it */ #include #include #include #define BENCHMARK_SDL #define NOTICE(X) printf("%s", X); #include "SDL.h" /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } void DrawPict(SDL_Surface *screen, const char *bmpfile, int speedy, int flip, int nofade) { SDL_Surface *picture; SDL_Rect dest, update; int i, centered; int ncolors; SDL_Color *colors, *cmap; /* Load the image into a surface */ if ( bmpfile == NULL ) { bmpfile = "sample.bmp"; /* Sample image */ } fprintf(stderr, "Loading picture: %s\n", bmpfile); picture = SDL_LoadBMP(bmpfile); if ( picture == NULL ) { fprintf(stderr, "Couldn't load %s: %s\n", bmpfile, SDL_GetError()); return; } /* Set the display colors -- on a hicolor display this is a no-op */ if ( picture->format->palette ) { ncolors = picture->format->palette->ncolors; colors = (SDL_Color *)malloc(ncolors*sizeof(SDL_Color)); cmap = (SDL_Color *)malloc(ncolors*sizeof(SDL_Color)); memcpy(colors, picture->format->palette->colors, ncolors*sizeof(SDL_Color)); } else { int r, g, b; /* Allocate 256 color palette */ ncolors = 256; colors = (SDL_Color *)malloc(ncolors*sizeof(SDL_Color)); cmap = (SDL_Color *)malloc(ncolors*sizeof(SDL_Color)); /* Set a 3,3,2 color cube */ for ( r=0; r<8; ++r ) { for ( g=0; g<8; ++g ) { for ( b=0; b<4; ++b ) { i = ((r<<5)|(g<<2)|b); colors[i].r = r<<5; colors[i].g = g<<5; colors[i].b = b<<6; } } } } NOTICE("testwin: setting colors\n"); if ( ! SDL_SetColors(screen, colors, 0, ncolors) && (screen->format->palette != NULL) ) { fprintf(stderr, "Warning: Couldn't set all of the colors, but SDL will map the image\n" " (colormap fading will suffer - try the -warp option)\n" ); } /* Set the screen to black (not really necessary) */ if ( SDL_LockSurface(screen) == 0 ) { Uint32 black; Uint8 *pixels; black = SDL_MapRGB(screen->format, 0, 0, 0); pixels = (Uint8 *)screen->pixels; for ( i=0; ih; ++i ) { memset(pixels, black, screen->w*screen->format->BytesPerPixel); pixels += screen->pitch; } SDL_UnlockSurface(screen); SDL_UpdateRect(screen, 0, 0, 0, 0); } /* Display the picture */ if ( speedy ) { SDL_Surface *displayfmt; fprintf(stderr, "Converting picture\n"); displayfmt = SDL_DisplayFormat(picture); if ( displayfmt == NULL ) { fprintf(stderr, "Couldn't convert image: %s\n", SDL_GetError()); goto done; } SDL_FreeSurface(picture); picture = displayfmt; } printf("(image surface located in %s memory)\n", (picture->flags&SDL_HWSURFACE) ? "video" : "system"); centered = (screen->w - picture->w)/2; if ( centered < 0 ) { centered = 0; } dest.y = (screen->h - picture->h)/2; dest.w = picture->w; dest.h = picture->h; NOTICE("testwin: moving image\n"); for ( i=0; i<=centered; ++i ) { dest.x = i; update = dest; if ( SDL_BlitSurface(picture, NULL, screen, &update) < 0 ) { fprintf(stderr, "Blit failed: %s\n", SDL_GetError()); break; } if ( flip ) { SDL_Flip(screen); } else { SDL_UpdateRects(screen, 1, &update); } } #ifdef SCREENSHOT if ( SDL_SaveBMP(screen, "screen.bmp") < 0 ) printf("Couldn't save screen: %s\n", SDL_GetError()); #endif #ifndef BENCHMARK_SDL /* Let it sit there for a while */ SDL_Delay(5*1000); #endif /* Fade the colormap */ if ( ! nofade ) { int maxstep; SDL_Color final; SDL_Color palcolors[256]; struct { Sint16 r, g, b; } cdist[256]; NOTICE("testwin: fading out...\n"); memcpy(cmap, colors, ncolors*sizeof(SDL_Color)); maxstep = 32-1; final.r = 0xFF; final.g = 0x00; final.b = 0x00; memcpy(palcolors, colors, ncolors*sizeof(SDL_Color)); for ( i=0; i 1 ) { if ( strcmp(argv[1], "-speedy") == 0 ) { speedy = 1; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-nofade") == 0 ) { nofade = 1; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-delay") == 0 ) { if ( argv[2] ) { delay = atoi(argv[2]); argv += 2; argc -= 2; } else { fprintf(stderr, "The -delay option requires an argument\n"); quit(1); } } else if ( strcmp(argv[1], "-width") == 0 ) { if ( argv[2] && ((w = atoi(argv[2])) > 0) ) { argv += 2; argc -= 2; } else { fprintf(stderr, "The -width option requires an argument\n"); quit(1); } } else if ( strcmp(argv[1], "-height") == 0 ) { if ( argv[2] && ((h = atoi(argv[2])) > 0) ) { argv += 2; argc -= 2; } else { fprintf(stderr, "The -height option requires an argument\n"); quit(1); } } else if ( strcmp(argv[1], "-bpp") == 0 ) { if ( argv[2] ) { desired_bpp = atoi(argv[2]); argv += 2; argc -= 2; } else { fprintf(stderr, "The -bpp option requires an argument\n"); quit(1); } } else if ( strcmp(argv[1], "-warp") == 0 ) { video_flags |= SDL_HWPALETTE; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-hw") == 0 ) { video_flags |= SDL_HWSURFACE; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-flip") == 0 ) { video_flags |= SDL_DOUBLEBUF; argv += 1; argc -= 1; } else if ( strcmp(argv[1], "-fullscreen") == 0 ) { video_flags |= SDL_FULLSCREEN; argv += 1; argc -= 1; } else break; } /* Initialize the display */ screen = SDL_SetVideoMode(w, h, desired_bpp, video_flags); if ( screen == NULL ) { fprintf(stderr, "Couldn't set %dx%dx%d video mode: %s\n", w, h, desired_bpp, SDL_GetError()); quit(1); } printf("Set%s %dx%dx%d mode\n", screen->flags & SDL_FULLSCREEN ? " fullscreen" : "", screen->w, screen->h, screen->format->BitsPerPixel); printf("(video surface located in %s memory)\n", (screen->flags&SDL_HWSURFACE) ? "video" : "system"); if ( screen->flags & SDL_DOUBLEBUF ) { printf("Double-buffering enabled\n"); flip = 1; } /* Set the window manager title bar */ SDL_WM_SetCaption("SDL test window", "testwin"); /* Do all the drawing work */ #ifdef BENCHMARK_SDL then = SDL_GetTicks(); DrawPict(screen, argv[1], speedy, flip, nofade); now = SDL_GetTicks(); printf("Time: %d milliseconds\n", now-then); #else DrawPict(screen, argv[1], speedy, flip, nofade); #endif SDL_Delay(delay*1000); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/testwm.c0000664000000000000000000003002114321057302013402 0ustar00 /* Test out the window manager interaction functions */ #include #include #include #define TEST_SYSWM 0 #include "SDL.h" #ifdef TEST_SYSWM #include "SDL_syswm.h" #endif /* Is the cursor visible? */ static int visible = 1; static Uint8 video_bpp; static Uint32 video_flags; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } int SetVideoMode(int w, int h) { SDL_Surface *screen; int i; Uint8 *buffer; SDL_Color palette[256]; screen = SDL_SetVideoMode(w, h, video_bpp, video_flags); if ( screen == NULL ) { fprintf(stderr, "Couldn't set %dx%dx%d video mode: %s\n", w, h, video_bpp, SDL_GetError()); return(-1); } printf("Running in %s mode\n", screen->flags & SDL_FULLSCREEN ? "fullscreen" : "windowed"); /* Set the surface pixels and refresh! */ for ( i=0; i<256; ++i ) { palette[i].r = 255-i; palette[i].g = 255-i; palette[i].b = 255-i; } SDL_SetColors(screen, palette, 0, 256); if ( SDL_LockSurface(screen) < 0 ) { fprintf(stderr, "Couldn't lock display surface: %s\n", SDL_GetError()); return(-1); } buffer = (Uint8 *)screen->pixels; for ( i=0; ih; ++i ) { memset(buffer,(i*255)/screen->h, screen->w*screen->format->BytesPerPixel); buffer += screen->pitch; } SDL_UnlockSurface(screen); SDL_UpdateRect(screen, 0, 0, 0, 0); return(0); } SDL_Surface *LoadIconSurface(const char *file, Uint8 **maskp) { SDL_Surface *icon; Uint8 *pixels; Uint8 *mask; int mlen, i, j; *maskp = NULL; /* Load the icon surface */ icon = SDL_LoadBMP(file); if ( icon == NULL ) { fprintf(stderr, "Couldn't load %s: %s\n", file, SDL_GetError()); return(NULL); } /* Check width and height if ( (icon->w%8) != 0 ) { fprintf(stderr, "Icon width must be a multiple of 8!\n"); SDL_FreeSurface(icon); return(NULL); } */ if ( icon->format->palette == NULL ) { fprintf(stderr, "Icon must have a palette!\n"); SDL_FreeSurface(icon); return(NULL); } /* Set the colorkey */ SDL_SetColorKey(icon, SDL_SRCCOLORKEY, *((Uint8 *)icon->pixels)); /* Create the mask */ pixels = (Uint8 *)icon->pixels; printf("Transparent pixel: (%d,%d,%d)\n", icon->format->palette->colors[*pixels].r, icon->format->palette->colors[*pixels].g, icon->format->palette->colors[*pixels].b); mlen = (icon->w*icon->h + 7) / 8; mask = (Uint8 *)malloc(mlen); if ( mask == NULL ) { fprintf(stderr, "Out of memory!\n"); SDL_FreeSurface(icon); return(NULL); } memset(mask, 0, mlen); for ( i=0; i < icon->h; i++) for (j=0; j < icon->w; j++) { int pindex = i * icon->pitch + j; int mindex = i * icon->w + j; if ( pixels[pindex] != *pixels ) mask[mindex>>3] |= 1 << (7 - (mindex & 7)); } *maskp = mask; return(icon); } void HotKey_ToggleFullScreen(void) { SDL_Surface *screen; screen = SDL_GetVideoSurface(); if ( SDL_WM_ToggleFullScreen(screen) ) { printf("Toggled fullscreen mode - now %s\n", (screen->flags&SDL_FULLSCREEN) ? "fullscreen" : "windowed"); } else { printf("Unable to toggle fullscreen mode\n"); video_flags ^= SDL_FULLSCREEN; SetVideoMode(screen->w, screen->h); } } void HotKey_ToggleGrab(void) { SDL_GrabMode mode; printf("Ctrl-G: toggling input grab!\n"); mode = SDL_WM_GrabInput(SDL_GRAB_QUERY); if ( mode == SDL_GRAB_ON ) { printf("Grab was on\n"); } else { printf("Grab was off\n"); } mode = SDL_WM_GrabInput(mode ? SDL_GRAB_OFF : SDL_GRAB_ON); if ( mode == SDL_GRAB_ON ) { printf("Grab is now on\n"); } else { printf("Grab is now off\n"); } } void HotKey_Iconify(void) { printf("Ctrl-Z: iconifying window!\n"); SDL_WM_IconifyWindow(); } void HotKey_Quit(void) { SDL_Event event; printf("Posting internal quit request\n"); event.type = SDL_USEREVENT; SDL_PushEvent(&event); } static void print_modifiers(void) { int mod; printf(" modifiers:"); mod = SDL_GetModState(); if(!mod) { printf(" (none)"); return; } if(mod & KMOD_LSHIFT) printf(" LSHIFT"); if(mod & KMOD_RSHIFT) printf(" RSHIFT"); if(mod & KMOD_LCTRL) printf(" LCTRL"); if(mod & KMOD_RCTRL) printf(" RCTRL"); if(mod & KMOD_LALT) printf(" LALT"); if(mod & KMOD_RALT) printf(" RALT"); if(mod & KMOD_LMETA) printf(" LMETA"); if(mod & KMOD_RMETA) printf(" RMETA"); if(mod & KMOD_NUM) printf(" NUM"); if(mod & KMOD_CAPS) printf(" CAPS"); if(mod & KMOD_MODE) printf(" MODE"); } static void PrintKey(const SDL_keysym *sym, int pressed) { /* Print the keycode, name and state */ if ( sym->sym ) { printf("Key %s: %d-%s ", pressed ? "pressed" : "released", sym->sym, SDL_GetKeyName(sym->sym)); } else { printf("Unknown Key (scancode = %d) %s ", sym->scancode, pressed ? "pressed" : "released"); } /* Print the translated character, if one exists */ if ( sym->unicode ) { /* Is it a control-character? */ if ( sym->unicode < ' ' ) { printf(" (^%c)", sym->unicode+'@'); } else { #ifdef UNICODE printf(" (%c)", sym->unicode); #else /* This is a Latin-1 program, so only show 8-bits */ if ( !(sym->unicode & 0xFF00) ) printf(" (%c)", sym->unicode); else printf(" (0x%X)", sym->unicode); #endif } } print_modifiers(); printf("\n"); } int SDLCALL FilterEvents(const SDL_Event *event) { static int reallyquit = 0; switch (event->type) { case SDL_ACTIVEEVENT: /* See what happened */ printf("App %s ", event->active.gain ? "gained" : "lost"); if ( event->active.state & SDL_APPACTIVE ) printf("active "); if ( event->active.state & SDL_APPINPUTFOCUS ) printf("input "); if ( event->active.state & SDL_APPMOUSEFOCUS ) printf("mouse "); printf("focus\n"); /* See if we are iconified or restored */ if ( event->active.state & SDL_APPACTIVE ) { printf("App has been %s\n", event->active.gain ? "restored" : "iconified"); } return(0); /* We want to toggle visibility on buttonpress */ case SDL_MOUSEBUTTONDOWN: case SDL_MOUSEBUTTONUP: if ( event->button.state == SDL_PRESSED ) { visible = !visible; SDL_ShowCursor(visible); } printf("Mouse button %d has been %s\n", event->button.button, (event->button.state == SDL_PRESSED) ? "pressed" : "released"); return(0); /* Show relative mouse motion */ case SDL_MOUSEMOTION: #if 0 printf("Mouse motion: {%d,%d} (%d,%d)\n", event->motion.x, event->motion.y, event->motion.xrel, event->motion.yrel); #endif return(0); case SDL_KEYDOWN: PrintKey(&event->key.keysym, 1); if ( event->key.keysym.sym == SDLK_ESCAPE ) { HotKey_Quit(); } if ( (event->key.keysym.sym == SDLK_g) && (event->key.keysym.mod & KMOD_CTRL) ) { HotKey_ToggleGrab(); } if ( (event->key.keysym.sym == SDLK_z) && (event->key.keysym.mod & KMOD_CTRL) ) { HotKey_Iconify(); } if ( (event->key.keysym.sym == SDLK_RETURN) && (event->key.keysym.mod & KMOD_ALT) ) { HotKey_ToggleFullScreen(); } return(0); case SDL_KEYUP: PrintKey(&event->key.keysym, 0); return(0); /* Pass the video resize event through .. */ case SDL_VIDEORESIZE: return(1); /* This is important! Queue it if we want to quit. */ case SDL_QUIT: if ( ! reallyquit ) { reallyquit = 1; printf("Quit requested\n"); return(0); } printf("Quit demanded\n"); return(1); case SDL_SYSWMEVENT: #ifdef TEST_SYSWM #ifdef _WIN32 printf("Windows syswm event: hwnd=%X msg=%X wparam=%X lparam=%X\n", (unsigned int) (size_t) event->syswm.msg->hwnd, (unsigned int) (size_t) event->syswm.msg->msg, (unsigned int) (size_t) event->syswm.msg->wParam, (unsigned int) (size_t) event->syswm.msg->lParam); #elif defined(SDL_VIDEO_DRIVER_X11) printf("X11 syswm event: %d\n", event->syswm.msg->event.xevent.type); #else printf("Generic syswm event: data=%d\n", event->syswm.msg->data); #endif #endif return(1); /* This will never happen because events queued directly to the event queue are not filtered. */ case SDL_USEREVENT: return(1); /* Drop all other events */ default: return(0); } } static char testtitle[] = "Testing 1.. 2.. 3..."; int main(int argc, char *argv[]) { SDL_Event event; char *title; SDL_Surface *icon; Uint8 *icon_mask; int parsed; int w, h; if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return(1); } /* Check command line arguments */ w = 640; h = 480; video_bpp = 8; video_flags = SDL_SWSURFACE; parsed = 1; while ( parsed ) { if ( (argc >= 2) && (strcmp(argv[1], "-fullscreen") == 0) ) { video_flags |= SDL_FULLSCREEN; argc -= 1; argv += 1; } else if ( (argc >= 2) && (strcmp(argv[1], "-resize") == 0) ) { video_flags |= SDL_RESIZABLE; argc -= 1; argv += 1; } else if ( (argc >= 2) && (strcmp(argv[1], "-noframe") == 0) ) { video_flags |= SDL_NOFRAME; argc -= 1; argv += 1; } else if ( (argc >= 3) && (strcmp(argv[1], "-width") == 0) ) { w = atoi(argv[2]); argc -= 2; argv += 2; } else if ( (argc >= 3) && (strcmp(argv[1], "-height") == 0) ) { h = atoi(argv[2]); argc -= 2; argv += 2; } else if ( (argc >= 3) && (strcmp(argv[1], "-bpp") == 0) ) { video_bpp = atoi(argv[2]); argc -= 2; argv += 2; } else { parsed = 0; } } /* Set the icon -- this must be done before the first mode set */ icon = LoadIconSurface("icon.bmp", &icon_mask); if ( icon != NULL ) { SDL_WM_SetIcon(icon, icon_mask); } if ( icon_mask != NULL ) free(icon_mask); /* Set the title bar */ if ( argv[1] == NULL ) title = testtitle; else title = argv[1]; SDL_WM_SetCaption(title, "testwm"); /* See if it's really set */ SDL_WM_GetCaption(&title, NULL); if ( title ) printf("Title was set to: %s\n", title); else printf("No window title was set!\n"); /* Initialize the display */ if ( SetVideoMode(w, h) < 0 ) { quit(1); } #ifdef TEST_SYSWM { SDL_SysWMinfo syswm_info; SDL_VERSION(&syswm_info.version); if (SDL_GetWMInfo(&syswm_info) != 1) { printf("Failed to get syswm info: %s\n", SDL_GetError()); } else { #ifdef _WIN32 printf("Windows syswm info: hwnd=%X hglrc=%X\n", (unsigned int) (size_t) syswm_info.window, (unsigned int) (size_t) syswm_info.hglrc); #elif defined(SDL_VIDEO_DRIVER_X11) printf("X11 syswm info: display=%p window=%X lock_func=%p unlock_func=%p fswindow=%X wmwindow=%X gfxdisplay=%p\n", syswm_info.info.x11.display, (unsigned int) (size_t) syswm_info.info.x11.window, syswm_info.info.x11.lock_func, syswm_info.info.x11.unlock_func, (unsigned int) (size_t) syswm_info.info.x11.fswindow, (unsigned int) (size_t) syswm_info.info.x11.wmwindow, syswm_info.info.x11.gfxdisplay); #else printf("Generic syswm info: data=%X\n", syswm_info.data); #endif } } { typedef SDL_Window* (SDLCALL *fnSDL12COMPAT_GetWindow)(void); fnSDL12COMPAT_GetWindow pfnSDL12COMPAT_GetWindow = (fnSDL12COMPAT_GetWindow) SDL_GL_GetProcAddress("SDL12COMPAT_GetWindow"); printf("SDL12COMPAT_GetWindow address is %p%s\n", pfnSDL12COMPAT_GetWindow, pfnSDL12COMPAT_GetWindow ? "" : " (probably using classic SDL 1.2)"); if (pfnSDL12COMPAT_GetWindow != NULL) { printf("SDL 2.0 window: %p\n", pfnSDL12COMPAT_GetWindow()); } } SDL_EventState(SDL_SYSWMEVENT, SDL_ENABLE); #endif /* Set an event filter that discards everything but QUIT */ SDL_SetEventFilter(FilterEvents); /* Loop, waiting for QUIT */ while ( SDL_WaitEvent(&event) ) { switch (event.type) { case SDL_VIDEORESIZE: printf("Got a resize event: %dx%d\n", event.resize.w, event.resize.h); SetVideoMode(event.resize.w, event.resize.h); break; case SDL_USEREVENT: printf("Handling internal quit request\n"); /* Fall through to the quit handler */ case SDL_QUIT: printf("Bye bye..\n"); quit(0); default: /* This should never happen */ printf("Warning: Event %d wasn't filtered\n", event.type); break; } } printf("SDL_WaitEvent() error: %s\n", SDL_GetError()); SDL_Quit(); return(255); } sdl12-compat-1.2.74/test/threadwin.c0000664000000000000000000002052714145137266014072 0ustar00 /* Test out the multi-threaded event handling functions */ #include #include #include #include "SDL.h" #include "SDL_thread.h" /* Are we done yet? */ static int done = 0; /* Is the cursor visible? */ static int visible = 1; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } SDL_Surface *LoadIconSurface(const char *file, Uint8 **maskp) { SDL_Surface *icon; Uint8 *pixels; Uint8 *mask; int mlen, i; *maskp = NULL; /* Load the icon surface */ icon = SDL_LoadBMP(file); if ( icon == NULL ) { fprintf(stderr, "Couldn't load %s: %s\n", file, SDL_GetError()); return(NULL); } /* Check width and height */ if ( (icon->w%8) != 0 ) { fprintf(stderr, "Icon width must be a multiple of 8!\n"); SDL_FreeSurface(icon); return(NULL); } if ( icon->format->palette == NULL ) { fprintf(stderr, "Icon must have a palette!\n"); SDL_FreeSurface(icon); return(NULL); } /* Set the colorkey */ SDL_SetColorKey(icon, SDL_SRCCOLORKEY, *((Uint8 *)icon->pixels)); /* Create the mask */ pixels = (Uint8 *)icon->pixels; printf("Transparent pixel: (%d,%d,%d)\n", icon->format->palette->colors[*pixels].r, icon->format->palette->colors[*pixels].g, icon->format->palette->colors[*pixels].b); mlen = icon->w*icon->h; mask = (Uint8 *)malloc(mlen/8); if ( mask == NULL ) { fprintf(stderr, "Out of memory!\n"); SDL_FreeSurface(icon); return(NULL); } memset(mask, 0, mlen/8); for ( i=0; itype) { case SDL_ACTIVEEVENT: /* See what happened */ printf("App %s ", event->active.gain ? "gained" : "lost"); if ( event->active.state & SDL_APPACTIVE ) printf("active "); if ( event->active.state & SDL_APPMOUSEFOCUS ) printf("mouse "); if ( event->active.state & SDL_APPINPUTFOCUS ) printf("input "); printf("focus\n"); /* See if we are iconified or restored */ if ( event->active.state & SDL_APPACTIVE ) { printf("App has been %s\n", event->active.gain ? "restored" : "iconified"); } return(0); /* This is important! Queue it if we want to quit. */ case SDL_QUIT: if ( ! reallyquit ) { reallyquit = 1; printf("Quit requested\n"); return(0); } printf("Quit demanded\n"); return(1); /* Mouse and keyboard events go to threads */ case SDL_MOUSEMOTION: case SDL_MOUSEBUTTONDOWN: case SDL_MOUSEBUTTONUP: case SDL_KEYDOWN: case SDL_KEYUP: return(1); /* Drop all other events */ default: return(0); } } int SDLCALL HandleMouse(void *unused) { SDL_Event events[10]; int i, found; Uint32 mask; /* Handle mouse events here */ mask = (SDL_MOUSEMOTIONMASK|SDL_MOUSEBUTTONDOWNMASK|SDL_MOUSEBUTTONUPMASK); while ( ! done ) { found = SDL_PeepEvents(events, 10, SDL_GETEVENT, mask); for ( i=0; i to quit the app */ if ( events[i].key.keysym.sym == SDLK_ESCAPE ) { done = 1; } /* skip events now that aren't KEYUPs... */ if (events[i].key.state == SDL_PRESSED) break; if ( events[i].key.keysym.sym == SDLK_f ) { int rc = 0; printf("attempting to toggle fullscreen...\n"); rc = SDL_WM_ToggleFullScreen(SDL_GetVideoSurface()); printf("SDL_WM_ToggleFullScreen returned %d.\n", rc); } if ( events[i].key.keysym.sym == SDLK_g ) { SDL_GrabMode m; m = SDL_WM_GrabInput(SDL_GRAB_QUERY) == SDL_GRAB_ON ? SDL_GRAB_OFF : SDL_GRAB_ON; printf("attempting to toggle input grab to %s...\n", m == SDL_GRAB_ON ? "ON" : "OFF"); SDL_WM_GrabInput(m); printf("attempt finished.\n"); } break; } } /* Give up some CPU to allow events to arrive */ SDL_Delay(20); } return(0); } int main(int argc, char *argv[]) { SDL_Surface *screen; SDL_Surface *icon; Uint8 *icon_mask; int i, parsed; Uint8 *buffer; SDL_Color palette[256]; Uint32 init_flags; Uint8 video_bpp; Uint32 video_flags; SDL_Thread *mouse_thread; SDL_Thread *keybd_thread; /* Set the options, based on command line arguments */ init_flags = SDL_INIT_VIDEO; video_bpp = 8; video_flags = SDL_SWSURFACE; parsed = 1; while ( parsed ) { /* If the threaded option is enabled, and the SDL library hasn't been compiled with threaded events enabled, then the mouse and keyboard won't respond. */ if ( (argc >= 2) && (strcmp(argv[1], "-threaded") == 0) ) { init_flags |= SDL_INIT_EVENTTHREAD; argc -= 1; argv += 1; printf("Running with threaded events\n"); } else if ( (argc >= 2) && (strcmp(argv[1], "-fullscreen") == 0) ) { video_flags |= SDL_FULLSCREEN; argc -= 1; argv += 1; } else if ( (argc >= 3) && (strcmp(argv[1], "-bpp") == 0) ) { video_bpp = atoi(argv[2]); argc -= 2; argv += 2; } else { parsed = 0; } } /* Initialize SDL with the requested flags */ if ( SDL_Init(init_flags) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError()); return(1); } /* Set the icon -- this must be done before the first mode set */ icon = LoadIconSurface("icon.bmp", &icon_mask); if ( icon != NULL ) { SDL_WM_SetIcon(icon, icon_mask); } if ( icon_mask != NULL ) free(icon_mask); /* Initialize the display */ screen = SDL_SetVideoMode(640, 480, video_bpp, video_flags); if ( screen == NULL ) { fprintf(stderr, "Couldn't set 640x480x%d video mode: %s\n", video_bpp, SDL_GetError()); quit(1); } printf("Running in %s mode\n", screen->flags & SDL_FULLSCREEN ? "fullscreen" : "windowed"); /* Enable printable characters */ SDL_EnableUNICODE(1); /* Set an event filter that discards everything but QUIT */ SDL_SetEventFilter(FilterEvents); /* Create the event handling threads */ mouse_thread = SDL_CreateThread(HandleMouse, NULL); keybd_thread = SDL_CreateThread(HandleKeyboard, NULL); /* Set the surface pixels and refresh! */ for ( i=0; i<256; ++i ) { palette[i].r = 255-i; palette[i].g = 255-i; palette[i].b = 255-i; } SDL_SetColors(screen, palette, 0, 256); if ( SDL_LockSurface(screen) < 0 ) { fprintf(stderr, "Couldn't lock display surface: %s\n", SDL_GetError()); quit(2); } buffer = (Uint8 *)screen->pixels; for ( i=0; ih; ++i ) { memset(buffer,(i*255)/screen->h, screen->w*screen->format->BytesPerPixel); buffer += screen->pitch; } SDL_UnlockSurface(screen); SDL_UpdateRect(screen, 0, 0, 0, 0); /* Loop, waiting for QUIT */ while ( ! done ) { if ( ! (init_flags & SDL_INIT_EVENTTHREAD) ) { SDL_PumpEvents(); /* Needed when event thread is off */ } if ( SDL_PeepEvents(NULL, 0, SDL_PEEKEVENT, SDL_QUITMASK) ) { done = 1; } /* Give up some CPU so the events can accumulate */ SDL_Delay(20); } SDL_WaitThread(mouse_thread, NULL); SDL_WaitThread(keybd_thread, NULL); SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/torturethread.c0000664000000000000000000000344312115006433014761 0ustar00 /* Simple test of the SDL threading code */ #include #include #include #include #include "SDL.h" #include "SDL_thread.h" #define NUMTHREADS 10 static char volatile time_for_threads_to_die[NUMTHREADS]; /* Call this instead of exit(), so we can clean up SDL: atexit() is evil. */ static void quit(int rc) { SDL_Quit(); exit(rc); } int SDLCALL SubThreadFunc(void *data) { while(! *(int volatile *)data) { ; /*SDL_Delay(10);*/ /* do nothing */ } return 0; } int SDLCALL ThreadFunc(void *data) { SDL_Thread *sub_threads[NUMTHREADS]; int flags[NUMTHREADS]; int i; int tid = (int)(uintptr_t)data; fprintf(stderr, "Creating Thread %d\n", tid); for(i = 0; i < NUMTHREADS; i++) { flags[i] = 0; sub_threads[i] = SDL_CreateThread(SubThreadFunc, &flags[i]); } printf("Thread '%d' waiting for signal\n", tid); while(time_for_threads_to_die[tid] != 1) { ; /* do nothing */ } printf("Thread '%d' sending signals to subthreads\n", tid); for(i = 0; i < NUMTHREADS; i++) { flags[i] = 1; SDL_WaitThread(sub_threads[i], NULL); } printf("Thread '%d' exiting!\n", tid); return 0; } int main(int argc, char *argv[]) { SDL_Thread *threads[NUMTHREADS]; int i; /* Load the SDL library */ if ( SDL_Init(0) < 0 ) { fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); return(1); } signal(SIGSEGV, SIG_DFL); for(i = 0; i < NUMTHREADS; i++) { time_for_threads_to_die[i] = 0; threads[i] = SDL_CreateThread(ThreadFunc, (void *)(uintptr_t)i); if ( threads[i] == NULL ) { fprintf(stderr, "Couldn't create thread: %s\n", SDL_GetError()); quit(1); } } for(i = 0; i < NUMTHREADS; i++) { time_for_threads_to_die[i] = 1; } for(i = 0; i < NUMTHREADS; i++) { SDL_WaitThread(threads[i], NULL); } SDL_Quit(); return(0); } sdl12-compat-1.2.74/test/utf8.txt0000664000000000000000000005203712115006433013353 0ustar00UTF-8 decoder capability and stress test ---------------------------------------- Markus Kuhn - 2003-02-19 This test file can help you examine, how your UTF-8 decoder handles various types of correct, malformed, or otherwise interesting UTF-8 sequences. This file is not meant to be a conformance test. It does not prescribes any particular outcome and therefore there is no way to "pass" or "fail" this test file, even though the texts suggests a preferable decoder behaviour at some places. The aim is instead to help you think about and test the behaviour of your UTF-8 on a systematic collection of unusual inputs. Experience so far suggests that most first-time authors of UTF-8 decoders find at least one serious problem in their decoder by using this file. The test lines below cover boundary conditions, malformed UTF-8 sequences as well as correctly encoded UTF-8 sequences of Unicode code points that should never occur in a correct UTF-8 file. According to ISO 10646-1:2000, sections D.7 and 2.3c, a device receiving UTF-8 shall interpret a "malformed sequence in the same way that it interprets a character that is outside the adopted subset" and "characters that are not within the adopted subset shall be indicated to the user" by a receiving device. A quite commonly used approach in UTF-8 decoders is to replace any malformed UTF-8 sequence by a replacement character (U+FFFD), which looks a bit like an inverted question mark, or a similar symbol. It might be a good idea to visually distinguish a malformed UTF-8 sequence from a correctly encoded Unicode character that is just not available in the current font but otherwise fully legal, even though ISO 10646-1 doesn't mandate this. In any case, just ignoring malformed sequences or unavailable characters does not conform to ISO 10646, will make debugging more difficult, and can lead to user confusion. Please check, whether a malformed UTF-8 sequence is (1) represented at all, (2) represented by exactly one single replacement character (or equivalent signal), and (3) the following quotation mark after an illegal UTF-8 sequence is correctly displayed, i.e. proper resynchronization takes place immageately after any malformed sequence. This file says "THE END" in the last line, so if you don't see that, your decoder crashed somehow before, which should always be cause for concern. All lines in this file are exactly 79 characters long (plus the line feed). In addition, all lines end with "|", except for the two test lines 2.1.1 and 2.2.1, which contain non-printable ASCII controls U+0000 and U+007F. If you display this file with a fixed-width font, these "|" characters should all line up in column 79 (right margin). This allows you to test quickly, whether your UTF-8 decoder finds the correct number of characters in every line, that is whether each malformed sequences is replaced by a single replacement character. Note that as an alternative to the notion of malformed sequence used here, it is also a perfectly acceptable (and in some situations even preferable) solution to represent each individual byte of a malformed sequence by a replacement character. If you follow this strategy in your decoder, then please ignore the "|" column. Here come the tests: | | 1 Some correct UTF-8 text | | (The codepoints for this test are: | U+03BA U+1F79 U+03C3 U+03BC U+03B5 --ryan.) | | You should see the Greek word 'kosme': "κόσμε" | | | 2 Boundary condition test cases | | 2.1 First possible sequence of a certain length | | (byte zero skipped...there's a null added at the end of the test. --ryan.) | | 2.1.2 2 bytes (U-00000080): "€" | 2.1.3 3 bytes (U-00000800): "ࠀ" | 2.1.4 4 bytes (U-00010000): "𐀀" | | (5 and 6 byte sequences were made illegal in rfc3629. --ryan.) | 2.1.5 5 bytes (U-00200000): "" | 2.1.6 6 bytes (U-04000000): "" | | 2.2 Last possible sequence of a certain length | | 2.2.1 1 byte (U-0000007F): "" | 2.2.2 2 bytes (U-000007FF): "߿" | | (Section 5.3.2 below calls this illegal. --ryan.) | 2.2.3 3 bytes (U-0000FFFF): "￿" | | (5 and 6 bytes sequences, and 4 bytes sequences > 0x10FFFF were made illegal | in rfc3629, so these next three should be replaced with a invalid | character codepoint. --ryan.) | 2.2.4 4 bytes (U-001FFFFF): "" | 2.2.5 5 bytes (U-03FFFFFF): "" | 2.2.6 6 bytes (U-7FFFFFFF): "" | | 2.3 Other boundary conditions | | 2.3.1 U-0000D7FF = ed 9f bf = "퟿" | 2.3.2 U-0000E000 = ee 80 80 = "" | 2.3.3 U-0000FFFD = ef bf bd = "�" | 2.3.4 U-0010FFFF = f4 8f bf bf = "􏿿" | | (This one is bogus in rfc3629. --ryan.) | 2.3.5 U-00110000 = f4 90 80 80 = "" | | 3 Malformed sequences | | 3.1 Unexpected continuation bytes | | Each unexpected continuation byte should be separately signalled as a | malformed sequence of its own. | | 3.1.1 First continuation byte 0x80: "" | 3.1.2 Last continuation byte 0xbf: "" | | 3.1.3 2 continuation bytes: "" | 3.1.4 3 continuation bytes: "" | 3.1.5 4 continuation bytes: "" | 3.1.6 5 continuation bytes: "" | 3.1.7 6 continuation bytes: "" | 3.1.8 7 continuation bytes: "" | | 3.1.9 Sequence of all 64 possible continuation bytes (0x80-0xbf): | | " | | | " | | 3.2 Lonely start characters | | 3.2.1 All 32 first bytes of 2-byte sequences (0xc0-0xdf), | each followed by a space character: | | " | " | | 3.2.2 All 16 first bytes of 3-byte sequences (0xe0-0xef), | each followed by a space character: | | " " | | 3.2.3 All 8 first bytes of 4-byte sequences (0xf0-0xf7), | each followed by a space character: | | " " | | 3.2.4 All 4 first bytes of 5-byte sequences (0xf8-0xfb), | each followed by a space character: | | " " | | 3.2.5 All 2 first bytes of 6-byte sequences (0xfc-0xfd), | each followed by a space character: | | " " | | 3.3 Sequences with last continuation byte missing | | All bytes of an incomplete sequence should be signalled as a single | malformed sequence, i.e., you should see only a single replacement | character in each of the next 10 tests. (Characters as in section 2) | | 3.3.1 2-byte sequence with last byte missing (U+0000): "" | 3.3.2 3-byte sequence with last byte missing (U+0000): "" | 3.3.3 4-byte sequence with last byte missing (U+0000): "" | 3.3.4 5-byte sequence with last byte missing (U+0000): "" | 3.3.5 6-byte sequence with last byte missing (U+0000): "" | 3.3.6 2-byte sequence with last byte missing (U-000007FF): "" | 3.3.7 3-byte sequence with last byte missing (U-0000FFFF): "" | 3.3.8 4-byte sequence with last byte missing (U-001FFFFF): "" | 3.3.9 5-byte sequence with last byte missing (U-03FFFFFF): "" | 3.3.10 6-byte sequence with last byte missing (U-7FFFFFFF): "" | | 3.4 Concatenation of incomplete sequences | | All the 10 sequences of 3.3 concatenated, you should see 10 malformed | sequences being signalled: | | "" | | 3.5 Impossible bytes | | The following two bytes cannot appear in a correct UTF-8 string | | 3.5.1 fe = "" | 3.5.2 ff = "" | 3.5.3 fe fe ff ff = "" | | 4 Overlong sequences | | The following sequences are not malformed according to the letter of | the Unicode 2.0 standard. However, they are longer then necessary and | a correct UTF-8 encoder is not allowed to produce them. A "safe UTF-8 | decoder" should reject them just like malformed sequences for two | reasons: (1) It helps to debug applications if overlong sequences are | not treated as valid representations of characters, because this helps | to spot problems more quickly. (2) Overlong sequences provide | alternative representations of characters, that could maliciously be | used to bypass filters that check only for ASCII characters. For | instance, a 2-byte encoded line feed (LF) would not be caught by a | line counter that counts only 0x0a bytes, but it would still be | processed as a line feed by an unsafe UTF-8 decoder later in the | pipeline. From a security point of view, ASCII compatibility of UTF-8 | sequences means also, that ASCII characters are *only* allowed to be | represented by ASCII bytes in the range 0x00-0x7f. To ensure this | aspect of ASCII compatibility, use only "safe UTF-8 decoders" that | reject overlong UTF-8 sequences for which a shorter encoding exists. | | 4.1 Examples of an overlong ASCII character | | With a safe UTF-8 decoder, all of the following five overlong | representations of the ASCII character slash ("/") should be rejected | like a malformed UTF-8 sequence, for instance by substituting it with | a replacement character. If you see a slash below, you do not have a | safe UTF-8 decoder! | | 4.1.1 U+002F = c0 af = "" | 4.1.2 U+002F = e0 80 af = "" | 4.1.3 U+002F = f0 80 80 af = "" | 4.1.4 U+002F = f8 80 80 80 af = "" | 4.1.5 U+002F = fc 80 80 80 80 af = "" | | 4.2 Maximum overlong sequences | | Below you see the highest Unicode value that is still resulting in an | overlong sequence if represented with the given number of bytes. This | is a boundary test for safe UTF-8 decoders. All five characters should | be rejected like malformed UTF-8 sequences. | | 4.2.1 U-0000007F = c1 bf = "" | 4.2.2 U-000007FF = e0 9f bf = "" | 4.2.3 U-0000FFFF = f0 8f bf bf = "" | 4.2.4 U-001FFFFF = f8 87 bf bf bf = "" | 4.2.5 U-03FFFFFF = fc 83 bf bf bf bf = "" | | 4.3 Overlong representation of the NUL character | | The following five sequences should also be rejected like malformed | UTF-8 sequences and should not be treated like the ASCII NUL | character. | | 4.3.1 U+0000 = c0 80 = "" | 4.3.2 U+0000 = e0 80 80 = "" | 4.3.3 U+0000 = f0 80 80 80 = "" | 4.3.4 U+0000 = f8 80 80 80 80 = "" | 4.3.5 U+0000 = fc 80 80 80 80 80 = "" | | 5 Illegal code positions | | The following UTF-8 sequences should be rejected like malformed | sequences, because they never represent valid ISO 10646 characters and | a UTF-8 decoder that accepts them might introduce security problems | comparable to overlong UTF-8 sequences. | | 5.1 Single UTF-16 surrogates | | 5.1.1 U+D800 = ed a0 80 = "" | 5.1.2 U+DB7F = ed ad bf = "" | 5.1.3 U+DB80 = ed ae 80 = "" | 5.1.4 U+DBFF = ed af bf = "" | 5.1.5 U+DC00 = ed b0 80 = "" | 5.1.6 U+DF80 = ed be 80 = "" | 5.1.7 U+DFFF = ed bf bf = "" | | 5.2 Paired UTF-16 surrogates | | 5.2.1 U+D800 U+DC00 = ed a0 80 ed b0 80 = "" | 5.2.2 U+D800 U+DFFF = ed a0 80 ed bf bf = "" | 5.2.3 U+DB7F U+DC00 = ed ad bf ed b0 80 = "" | 5.2.4 U+DB7F U+DFFF = ed ad bf ed bf bf = "" | 5.2.5 U+DB80 U+DC00 = ed ae 80 ed b0 80 = "" | 5.2.6 U+DB80 U+DFFF = ed ae 80 ed bf bf = "" | 5.2.7 U+DBFF U+DC00 = ed af bf ed b0 80 = "" | 5.2.8 U+DBFF U+DFFF = ed af bf ed bf bf = "" | | 5.3 Other illegal code positions | | 5.3.1 U+FFFE = ef bf be = "￾" | 5.3.2 U+FFFF = ef bf bf = "￿" | | THE END | sdl12-compat-1.2.74/REVISION.txt0000644000000000000000000000003215140471502012732 0ustar00release-1.2.74-0-g8cb4550 sdl12-compat-1.2.74/.git-hash0000644000000000000000000000005115140471502012441 0ustar008cb4550f9aff307e3df6ce628c2bb1287c6c105b