rar/0000755000175000017500000000000013143334065007150 5ustar zzrar/order.htm0000644000175000017500000000611013143334065010773 0ustar zz How to buy WinRAR and RAR license

How to buy WinRAR and RAR license.

If you wish to use WinRAR and RAR after the evaluation period of 40 days, you need to purchase its license from one of the regional dealers listed here. You can also check the latest price list and buy on-line at www.rarlab.com.

Upon receipt of your registration fee you will receive an email containing a registration key file corresponding to the user name string which you have chosen. Please specify a valid email address when buying the licence, as it will be used to send you the key file.

The registration email will also contain all necessary instructions, so please just follow them. Below, we provide a brief explanation of the typical registration procedure, but instructions in the email are more up to date than this file and should thus have a higher precedence.

If you use WinRAR, you will need to copy the registration key file (rarreg.key) to a WinRAR folder or to %APPDATA%\WinRAR folder. By default WinRAR folder is "C:\Program Files\WinRAR", but it can be changed by a user when installing WinRAR. You can also drag rarreg.key file and drop it to WinRAR window to register.

If the key is archived in a .rar or .zip file, please extract rarreg.key from the archive before copying it. If archive name is rarkey.rar, another way to install the key file is to open such archive in WinRAR and answer "Yes" to confirmation prompt.

If you use RAR/Unix and RAR for OS X, you should copy rarreg.key to your home directory or to one of the following directories: /etc, /usr/lib, /usr/local/lib, /usr/local/etc. You may rename it to .rarreg.key or .rarregkey, if you wish, but rarreg.key is also valid.

WinRAR, RAR for Unix and OS X now use the same registration key format, so you can use the same key with current WinRAR and RAR versions for all mentioned platforms. It is not guaranteed for WinRAR and RAR versions that are not equal to version included to this distributive. For example, versions prior to 2.60 used different keys.

Please send your further questions about sales and licensing to . English, French, German or Spanish please.

rar/acknow.txt0000644000175000017500000001013413143334065011172 0ustar zz ACKNOWLEDGMENTS * We used "Screaming Fast Galois Field Arithmetic Using Intel SIMD Instructions" paper by James S. Plank, Kevin M. Greenan and Ethan L. Miller to improve Reed-Solomon coding performance. Also we are grateful to Artem Drobanov and Bulat Ziganshin for samples and ideas allowed to make Reed-Solomon coding more efficient. * RAR text compression algorithm is based on Dmitry Shkarin PPMII and Dmitry Subbotin carryless rangecoder public domain source code. You may find it in ftp.elf.stuba.sk/pub/pc/pack. * RAR encryption includes parts of code from Szymon Stefanek and Brian Gladman AES implementations also as Steve Reid SHA-1 source. --------------------------------------------------------------------------- Copyright (c) 2002, Dr Brian Gladman < >, Worcester, UK. All rights reserved. LICENSE TERMS The free distribution and use of this software in both source and binary form is allowed (with or without changes) provided that: 1. distributions of this source code include the above copyright notice, this list of conditions and the following disclaimer; 2. distributions in binary form include the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other associated materials; 3. the copyright holder's name is not used to endorse products built using this software without specific written permission. ALTERNATIVELY, provided that this notice is retained in full, this product may be distributed under the terms of the GNU General Public License (GPL), in which case the provisions of the GPL apply INSTEAD OF those given above. DISCLAIMER This software is provided 'as is' with no explicit or implied warranties in respect of its properties, including, but not limited to, correctness and/or fitness for purpose. --------------------------------------------------------------------------- Source code of this package also as other cryptographic technology and computing project related links are available on Brian Gladman's web site: http://www.gladman.me.uk * RAR uses CRC32 function based on Intel Slicing-by-8 algorithm. Original Intel Slicing-by-8 code is available here: http://sourceforge.net/projects/slicing-by-8/ Original Intel Slicing-by-8 code is licensed under BSD License available at http://www.opensource.org/licenses/bsd-license.html Copyright (c) 2004-2006 Intel Corporation. All Rights Reserved Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * RAR archives may optionally include BLAKE2sp hash ( https://blake2.net ), designed by Jean-Philippe Aumasson, Samuel Neves, Zooko Wilcox-O'Hearn and Christian Winnerlein. * Useful hints provided by Alexander Khoroshev and Bulat Ziganshin allowed to significantly improve RAR compression and speed. rar/readme.txt0000644000175000017500000000126413143334065011151 0ustar zz RAR archiver: * RAR introduces an original compression algorithm. It provides high compression ratios on executable files, object libraries, large text files, etc. * RAR provides functionality for creating a 'solid' archive, which can raise the compression ratio by 10% - 50% over more common methods, particularly when packing large numbers of small files. * RAR offers the ability to create and change SFX archives using default and external SFX modules. * RAR offers the ability to create a multi-volume archive as SFX. * RAR offers a number of service functions, such as encrypting files, adding archive comments and repairing physically damaged archives. rar/default.sfx0000755000175000017500000053600013143334065011325 0ustar zzELF>#@@@8 @@@@@@88@8@@@ii bbK   b bTT@T@DDPtdMMBMBQtdRtdbb/lib64/ld-linux-x86-64.so.2GNUGNU@5'&fcM7-cA 1cfjȁ Ҝc)fUa&x 9BxIk%XsJ  3LlW@5_/g;^th( B4nI9 @Il,#9'P`RkfZ`!bX#!`bX.b}سb!b@! b(bL( @#@!blibstdc++.so.6__gmon_start___Jv_RegisterClasses_Znam_ZdaPv__cxa_throw_ZNSt9bad_allocD1Ev_ZTVN10__cxxabiv117__class_type_infoE__cxa_begin_catch_ZTVN10__cxxabiv116__enum_type_infoE__gxx_personality_v0_ZTVSt9bad_alloc_Znwm_ZTISt9bad_alloc__cxa_allocate_exception__cxa_end_catch_ZTVN10__cxxabiv120__si_class_type_infoE_ZdlPvlibm.so.6libgcc_s.so.1_Unwind_Resumelibc.so.6putwchar__vswprintf_chkfflushexitsetlocalembrtowctowlower__vfwprintf_chkwcsncpy__swprintf_chkwcscatwcrtombwcspbrk__open64_2ftruncate64mbsrtowcsclosedirstrncpysignal__wcsncpy_chk__stack_chk_failmkdirreallocfsyncclocktowupperstdintolowergetpidchmodflockfgetws__ctype_get_mb_cur_maxisattylchownsymlinkgetpwnamstrlenwcschrmemsetutimensat__errno_locationmemcmptoupper__fxstat64getgrnamstdout__wcscpy_chkmemcpyfclosewcscmpmallocgetpassumaskremove__strncpy_chk__lxstat64opendirwcsncat__wcscat_chk__xstat64stderrwcscpydupstrncatfilenogetcwdfreadrename__memcpy_chklocaltimelseek64strchrmktimereaddir64memmovefopen64wcsrtombsaccess__libc_start_mainwritewcslenwcsncmpfreewcsrchrGCC_3.0CXXABI_1.3GLIBCXX_3.4GLIBC_2.7GLIBC_2.6GLIBC_2.3.4GLIBC_2.4GLIBC_2.2.5 ] P&y t0ӯk|t)zii ii ti ii ui bbcسbfbg bh`bdbiblbebbbb b(b0b8b@b Hb Pb Xb `b hbpbxbbbbbbbbbbȰbаbذbbb b!b"b#b$b%b& b'(b(0b)8b*@bjHb+Pb,Xb-`b.hb/pb0xb1b2b3b4b5b6b7b8b9b:ȱb;бb<رb=b>b?b@bAbBbCbDbE bF(bG0bH8bI@bJHbKPbLXbM`bNhbOpbPxbQbRbSbTbUbVbWbkbXbYȲbZвb[زb\b]b^b_b`babbHs-H5R"%T"@%R"h%J"h%B"h%:"h%2"h%*"h%""h%"hp%"h`% "h P%"h @%"h 0%"h %"h %"h%ڑ"h%ґ"h%ʑ"h%‘"h%"h%"h%"h%"h%"hp%"h`%"hP%"h@%z"h0%r"h %j"h%b"h%Z"h%R"h %J"h!%B"h"%:"h#%2"h$%*"h%%""h&%"h'p%"h(`% "h)P%"h*@%"h+0%"h, %"h-%"h.%ڐ"h/%Ґ"h0%ʐ"h1%"h2%"h3%"h4%"h5%"h6%"h7p%"h8`%"h9P%"h:@%z"h;0%r"h< %j"h=%b"h>%Z"h?%R"h@%J"hA%B"hB%:"hC%2"hD%*"hE%""hF%"hGp%"hH`% "hIP%"hJ@%"hK0%"hL %"hM%"hN%ڏ"hO%ҏ"hP%ʏ"hQ%"hR%"hS%"hT%"hU%"hV%"hWp%"hX`%"hYP%"hZ@%z"h[0%r"h\ %j"h]%b"h^%Z"h_%R"h`%J"ha1I^HHPTIBH BH0(@?HHً"HtHÐUHSH="uKbH"HbHHH9s$fDHH"bH"H9rk"H[fff.H="UHtHtbÐfGGGGGHG HG(HG0HG8fDLd$L H\$Hl$HHHL CHHLHǃ Hǃ( Hǃ0 Hǃ8 ƃ@ =H( LH( HtH H WHHl$H$Ld$HÐSHH @Hx C1NHǃH HǃX HǃP ƃ ƃ ƃ Cǃ ƃ ƃ ƃ ƃ ǃ ƃ ƃ Hǃ!ƃ!ƃ !ƃ ƃ ƃ !ǃ!ƃAƃA[ÐSHH?Ht HHCHC[ÐH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^HHIH3HtUHSHHsH;zH;JL#HkH\$Hl$Ld$ H(H;H=HIt]L#Hk@(B1 5c/ 5cUHCHsA 5cHD$1HD$M 5c뗐H9wr HwDH+wATAUH~BSH 軦 5c蜳H}Hj'HHHdBA~HmHtuH%HHH8ƃ(`4v$`H4u 4H߈ #.HH'HP&H%H$H$HbHB # #H []A\Ð}E1Ht H}AńEtrH\$ HAHXtHH$tHSZ/DHH HHD$H Hiʚ;H)Ѻ?HL$HT$1HH޿H$(dH3%(H$8H$@L$HL$PHXÐH\$ HAEuUH$HD$?LsLHD$sHSZ/DHH HH Hiʚ;H)HBHLsHH$sʚ;1HHT$뗐fffff.H GfDSHHHwHLHt$XHsHĐ[fffff.H\$Hl$HLd$HHP(HH1HP HHP(IHHH1P LH$Hl$Ld$HIHH1HP LSHHHt@HE1uz8H$dH3%(u H[]l@AWE1AVAUAATIUSH H?LE11AHL)HHIQtuI9spLLHE1JHu=BA5jHH1{LBj\BH1{H}YEtH D[]A\A]A^A_L8uѺLSAff.H1ffff.HHdH%(H$1<1HH$dH3%(uHf.SHHP@t|H$@ H$@ H?Ht$H$@ 1HDŽ$ HDŽ$( HDŽ$0 H$@ D$D$HP@[HHP@[H$@ HH@Átt øf.ÁHdH%(H$1HtHd;HoH$dH3%(uH/HH$dH%(H$1;H$H1DD$H$dH3%(uHĨ@SHHdH%(H$1:HH$dH3%(u H[^fDSHHH$dH%(H$10:HH :H$HH$dH3%(u H[f.HHdH%(H$19HIH$dH3%(uHAWIAVIAUMATUHSHHMD$XL$Ld$PD$t AH(tTE1HMALLHLvt2uľ 5cEHuf|$EAHt/DHHtmH[]A\A]A^A_fH߾#HH[]A\A]A^A_D1H<$tH$H[]A\A]A^A_fH߾HHH[]DA\A]A^A_AVIAUATIUSH LH+HHIHDIM)I@@BtgH|$ EApB1Hl$\$L$$H|$ uHt$ LL~H []A\A]A^H 1[]A\A]A^Ð1Ht?RtfHvauru!uuހuWt΀t1Ðfffff.HHp1H@ fffff.tHH؃HHpHxHEÐ@USHH:HBtH:HtH~HHP HZ H8'nH$ UHH[]HPHn HZb H8mH$ UHHHHHHfDSH'H[fffff.AVAUATUHSHL$ HBLRL8LjHHǃ :HǃZHǃZHǃ[Hǃ[ƃ[Hǃ[Hǃ [Hǃ([HǃPHǃXHǃ`HǃhƃpHǃxHǃHǃHǃ::tHHIHr|HX:H:ǃxHH:ƃ|ƃ}ƃ~C1ƃHHƃƃƃHǃHǃ :ƃƃƃƃǃ(:HǃhHǃpHHǃ:ǃ:Hǃ}Hǃ}Hǃ~Hǃ~ǃHǃHǃHǃǃƃƃƃ0:[]A\A]A^HHHLHQHP]HZQLjLRHH@H\$Hl$HLd$HH1HHH$HD$HD$HD$D$ 1HLd$~It$Hx|L~uKHSH3H<$3H;HHxH{Hl$8H\$0Ld$@HHDH3H<$IL5H;B멐1@HSH3H<$7HHH{fH\$Hl$HLl$Ld$E1H(~Hu&DH\$Hl$Ld$Ll$ H(f.HP(t:IuFHHLh / 1HHAվBH.E1HuGH1LHP HH1HHP H.H}AHHAHHH1LP Htfff.H\$Hl$HHH:^tH\$8Hl$@HHHH$HD$HD$HD$D$ t=H,$H\$HnHt HH)H B1 nH<$H_vHwH\$8Hl$@HHHH]H@AWAVAUATAUHH:SHHHXHƇƇP1tHX[]A\A]A^A_ÐHǃH(xGǃP:.,:t-0:ttHHp1HP H-,HuȀt EH1HpHP t:0:~t HHP(HhILpD,:!t|HHp1HP H+Hto,:u1}t ОHs EJHX1[]A\A]A^A_1}t p[HHh1LpD,:LHP }tHs HHX[]A\A]A^A_fH|$ HD$ HD$(HD$0HD$8D$@HHP(HD$HT$(HHHt$ HPHL$ LcE1E1HH+D$L@DAIID9HL)?RuLT$HL$L$T$HL$L$txu7E~2~-H|$%A8RuAxSuAxFuAxXuf.IcHt$H1HHP xvHt.H|$ xHHHPfDH|$ 1oHHO:HPO:ǃP:HHHh P(1HpHՋxLHs :/1H|$ HKH;HHH1LP H"f.SH1u[D1H^¸uHs 7H1[ÐS@H#ut[ 5c6vfD[fDHs 7Z[ 5c vSHH?Ht,{ u[Hs׌H;[馸fD[ÐHx|$hHD$dH4$D$`HxÐSHH?Ht,{ u[PHsgH;[6fD[ÐH\$Hl$HH3HHC@lH\$Hl$HÐH9wr HwDH+wH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^H޶HIH3HtUHSH莸HsH;jH;:L#HkH\$Hl$Ld$ H(H;H-HIt]L#Hk@(B1 5cu 5cEtHCHsA 5cHD$!tHD$M 5ct뗐SHHpH:,tHp[fHw H,{tH:,u>HHD$`D$dD$h蟑 5c@sH:ƀ1Hp[fff.[=YI"SH[u%:uCtW1I"%$:[ft[uj I"%:[DH"%:[H"%:[ljH"ٸ]@H"%A:[Ðfx !tzV tSHF D/tR\tDHt2\u僿xu܋ !u_Huf.fDxt/ Fof~SFIƆ =H\$Hl$HP:Hxt,d::Hl$HH\$Hd:Hl$HH\$HÐfDSHw H.ƃ 5c[gofDSH7H;htHs 6[ 5c0oH;pu[Ð@HHw H $ 5cHnH\$Hl$HLd$Ll$ILt$HHdH%(H$1'J~xI~2E9Hu ўL8L[H|$0Ld5H0H|$01$H@ӞtjH:1,E1؞Hٞ$HHLLE‹ԞH,H|$Ht$L1$U`L9L{Hƃ@9HHLH89_ўƄ$MJ~HHǃh99H0~H$MH`9L&1ҀHHLHE裮¸H|$0D$(f6D$(Hs z1H$dH3%(H$H$L$L$L$HĸÐHw " 5ccl1뉐I~H|$01hHP~Hs  " 5c l1M LD$(5D$(HH%Mt5LkHI4$L^Hs U1ƃA9j襱H|$0H5HPAWAVAUIATIUSHH HN0dH%(H$ 1HH)H;F8r@H)HF8Hv3H$ M$ L$ HD$fHhGHu3H$ dH3%(Hĸ []A\A]A^A_f.HS0Hk8H9tH)H9HH,(GAt$HHS8t&FvfHC0Hk8H)Hqy@HuAD$HH$HL$FH$HL$At$FwfHH)HHw$8Bf.HLH$舶I$ H$HGIH0FAƄ$BA$AAƄ$AA$AA$AA$AAƄ$AfHEHA$!EHA$AEH=Ƅ$L$I$!L$iHYHGEH?EAH|$0AAƄ$ AB1I:Ht$0DHHDЉщЃD$ t.0H߉$L$DI$H QL$$ЃD$(t.@H߉$L$CI$P PL$$ЃD$,OF|$ Ft$(L$,"HC%?=ɚ; I$X R@HCI$| ADŽ$x  HwDfHCHCH߃A$ A$ BA$ I$ HDI$ HCA$ AƄ$ ADŽ$ AƄ$ It$ LcfDHH$HL$BHH$HL$&IhID$0@H߉D$BHH$HL$t$IhID$ LHHLD$HD$%CHL$Ƅ LD$HFBA$CbH1BA$C>HBH=I$BHFHHHL$BHL$AƄ BH߉D$AAH=I$ALFHLLD$nBLD$CƄAL$HC0H)HHH߉$@I$X M$I$ HHHD$ ALHAL$LLD$2LD$Ht$ L[LD$H$ L֕H|$LA$ A|$Ht$ (BAƄ$ rIt$ L'H߉$L$<@I$H HLL$$H@I$X HwLLH߉$L$?I$P HSLL$$H~?%?=ɚ;I$P NHR?%?=ɚ;I$H sNaH\$Hl$HLd$Ll$HLt$L|$H H|$01dH%(H$ 1>)HHH9hHyHH$ HHPtkHC1H|$0H$ dH3%(HH$ H$ L$ L$ L$ L$ H DL$ H:L$ HD$L:ILl$:H,1L$8:tH:L{Ld$pfH|$0!AHH|$0ƃD:v=H|$04:a>H|$0A=HEAtEdAH|$0Hc@DH9D$`{H|$0?H|$0A=H|$08:o=‰<:D:D;4:8:D@:,:AE1E1t H|$0=Iċ@:HHhH,(8:LHp=$xB@HHs ƃ 5c4`Hƃ 5c`@<:3H|$0c<Iŋ@:I9y<:H4:H|$0H:H<:H:D::< H|$0<H|$0:;:H:H|$0<:zHpƃ@H9hH\$`HX:HbH4:H|$0HX:H<:H`:D:h:P;ƃƃ|}?ǃ1t DEM툃/Hp2H:H0~HE1H蛨H4:H|$0HEH<:HED:ED8:ƅ !L` }:H|$0 m: Hh „҈ tIHLh H` H|$0H9HLHp :E Džx tH|$0Džx U9| H|$0Dž!9AH|$0ED?2E9H|$0E9<:@UDž !!#u Dž !UAD$/   !1Ҁ|$/tA@‹ 1҃Ɉ uD H‽ H!AL$H|$0L҃H=LF L9BƄ$Le LL3M |$/BLjuƃ~EHs LrH4:H|$0H}H<:H}D:~&8ƃ~ƃ ~ ~ƃ~Hs HgHs Haƃ1H|$07}Ht$0HLHHHTHt$0HLHH|$06HH C MDž !H:H|$0H7L$ H|$0L7L$LHLMH$ LHʋHL:H|$0HHfDH\$Lt$HHl$Ld$HLl$L|$HX!H|$PE1dH%(H$!15HHH9hHhHL$HLPtjH21H|$PH$!dH3 %(Hv H$(!H$0!L$8!L$@!L$H!L$P!HX!@H:H$ E1M1HHD$HD$H,$/H$AH|$P98H$ H|$P`4H|$PƃD:4:&4H|$P:4H|$P@<:D:4@@:8:9tsAu,:H|$P7@:HLhVŋ8:LHp2AH:H0~EHD1HH4:HEH<:HED:EEƒ    Eƅ ‰ !@1@@ u HcҨH|$PH!  2H|$PE2H|$PA2H|$PEDžx 2H|$P| 2H|$PD$4K2H|$PE>20H|$PEN2H|$PAq2 EDž t+E<i< |Dž EDž !<t<jDž !HH#EHDž!H9y1EuEE ! !A11 EEN$ MHLl$(AH|$PIDH|$(L$LFl$(Hh H LH` L2EBƄ,E E Hu LݩHHRD}AtH H|$P/2t$4HH o>E H|$P0H[H$HDŽ$D$LHT$8H$H [HL$@D$4 H$H([D$(H$L$4D|$LAAH|$8D\$(EtH|$P"0H|$8=H|$8H$d;At$ADŽ$AE1E)AH|$Pv/DA $AE9牄$AdAH|$8H$$;D$(l$4|$(+HD$@HD$@HHD$8ǃ8:,:HH#8:HH9 @:H|$P2Hy=:QfH|$P1194:t98:yt.vt)ƃ 5cREHhH9ptH$z{-ǃ8:fH4:D:H}H<:~H} ~¨~ ~҈~u@H|$P-~@Yƅ 1YH|$P-~~H|$Pw-H,(HpHs Hdƃ1fDH`  H|$PHpa/9EEƃ 5cQE&HU Hs ǃ8:@ǃ8:k<Dž !DHX:H4:H|$PHX:H<:H`:D:h:,H|$Pfl:8,`:p:у|}@€u fl:t:@~ HHP(IHHP(H Hp1HQ AE1fHAEAuH1LHP @Lm LLDe D}A D+d$(AAD$DEE~?McH L贛H H|$PL0,BLKJD}BL2ƃ~H|$P*H|$PD$(*t$(AH !H Dž!Dž!nƅ 1H$.L H!%tDHJHDHL)HI9wLDm E<t<Dž Dž Dž wLLE H$H)IAL#.H HN F HVvBH H:HP(H:HI:H ףp= ףLHLLH?J<"HH)H:ɷ:9 :1= HH1LHP H|$PFH覔HH\$Hl$H1퀿HtHH\$Hl$HfHP(Hhxt8uH+HHtHhH9pH1HHːfAVIAULP~ATE1USHHHHHu[H]A\A]A^@,:tEIAu ,:t H뱐LL u[H]A\A]A^D1fff.H\$Hl$HLd$Hv:t H:u'HHl$H$Ld$BHHP(HH1H:HP H]HItu ,:tH1HHP HP~B7uLH$Hl$Ld$HÐ@ATE1USHHHHuH[]A\f.t ,:t2IAuHD$~ HD$;,:tHH1[]A\ÐHx|$hHD$dH4$HT$D$`iHxÐHx|$hHD$dH4$HT$D$`iHxÐAWAVIAUIATIUSHHdH%(HD$81HA1E1C4ASL$T$ L$LH)I9D$ AttvOHT$ HD$ LL$膎HHD$ DD諍L$HL$ H1L赋NASHL$0Ht$LLHD$0Ll$E1HtHAuAEAMtCD&HT$8dH3%(DuHH[]A\A]A^A_Cl@AWILAVIAUATUSHHH<$HL$0dH%(HD$81Ht$H|$LHD$0GHtHHH$:I1E1D$f.AM9DH$;O,HD$ :HL$ HHLGHyD|$uAEI9v+M,D$AAEAM9v1CDHT$8dH3%(HH[]A\A]A^A_@1MtCDfDHD$ zHL$ H1H舉NƒAM{CV葌fHHt:ND1Eu"4@4H4@tH4t HH9wfff.HHt8O7ɉt&1ftODODƅ4t HH9wfffff.H@u fDHxHwH=w)HHt?ȀFHfD-=w\DA~ A~7HxU ȃ?ɀ?NȀFHO HA$v$H ?ȀFȃ?ɀ?NȀFHf.t20HHt~HHuHÐ0w:H~~HfDHH@HH{HHAAAAAAAAABDEAA*DGEAA€DWEAAÀA?A?A A?D AHD D Ht Hv*Ht Hv1HHDEAAudA?HD 뀐DEAAuOHTH$H$HfDSH`ceU"[HH=!NOH=!"NeOH=!"NIO؅"H=΅"5̅"SHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$b"HvSH=!S=D"H$H=!HE=!HHHD$HD$ $D$0HD$PH[SHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$="HtDH=!!RH$H=!HH$D$0HD$HD$ HD$H[ff.USHH$0H$8L$@L$Ht@)$P)$`)$p)$)$)$)$)$ 5cH 1M0HHfH$L$IH$H$ `UcDŽ$DŽ$0H$L`UcdB1B޿ 5cF H[]fff.H\$Hl$HHH=p!HhQH!HPHt$H<_H\$Hl$H 5cA ffffff.SHHdH%(H$1=k"t9OǃH^H$dH3%(uCHĐ[Ð~BMH纀HaHH纀H :NfATIUSHHց"N@ńu"@P Bq BH1H$@,="@ B,H1rH$tH$HNtw BH1;H$H"[@9 BHH1H$@?H[H$L; H$9H[]A\-o"f.$1ffff.AWAVAUATUSHHx,HL$@Lt$0H1M@HcHT$0LxHLLHH (HHL$"_HL$_HHLHtAD$,ɉL$HDHHD4HD$ #|$ u|fHD$ D$,HD$ D$t`1҅H$@tHcMHcHH|0T$|$D$9D$T$9iu|$ tT$,_LIƠAUIkKH1A Bf4 Bu BIO1A $HcHD$ɉL$~6L2PHH9u8tH[f.ڿHL$ B1HL$H t9u9ZuHv BfUSHH@tvtJHUHmH߉>HSH߾ $H[]H߾D$D$H[ ]fHHH߾H[]H9tH)H9HFHufHP>ωDAD DAE FAD ȉѺ )!f.ȉϹ D)AASAA1D DÃAN AA" A9u[Ðf.AWAVAUATUSHHhwz$ BDGDWAG A1EtIE11E9v#D1fDH3σ*>DA9>wAAE9wHh[]A\A]A^A_HDG 1wڃ@19wt9s H@8u F +́iH뺋GLDw LT$D$1|$bT$QALIfExKHD BEt3cT$33cAT$8D$=c3cT$23cT$73cAT$<D$1c3cT$63cT$;3cA GLiLa L $ADIcAHHT8HBR3T$0PA3UP3QP 3Q ADT$0D$5HcҋcB3cDT$:B3c3cT$4D$9c3cT$>3cT$33cAT$8D$=c3cT$23cT$73cAT$<D$1c3cT$63cT$;3cA GD9HHHD8HP@3D$0A3BEAE3BA$3B AD$0cD$5cAD$:cAD$?cAD$4cAD$9cAD$>cAD$3cAD$8cAD$=cA D$2cA D$7cA D$<cA D$1cA D$6cAD$;cAHcGHHT8HBR1PA1IPA1U@ A1$It4HHH?D$@FD$DFD$HF D$L%HD$ HT$(HHDH$GG AEGA$GHD$XdH3%(u2Hh[]A\A]A^A_L $LiLa HW LoLgH$1AWAVAUATUSHdH%(H$1HH4$u)L$dL3%( HĘ[]A\A]A^A_HGHHHD$`HGHD$h7LD$dLL$hLT$lHT$HG(HWLd$tHl$xH\$|L|$TLt$XLl$\@t$OLD$@LL$8LT$0HD$HT$DWH4$L$L $Ic‹6HHT8t$ HBR1T$PE@PDD$$D1AEIPDL$(D1AH$DH R A1щT$,LEMDD$TT$PDȋ4c34cT$Z34cT$W34cT$QcB3c3cD$[t$p3cA$DD$XD$UcB3cDD$RB3cEEAMcB3cEDD$YFcF3cDL$VF3cDL$SF3cEJAD!@McAIM\:A3st$PA3S AA3CAE3CLEEDT$TT$PD4c34cT$Z34cT$W34cT$QcB3c3cD$[t$p3cA$DT$XD$UcB3cDT$RB3cEAMcB3cEЉED\$YFcF3cDT$VF3cDT$SF3cADLL$A31t$PA3QAA3AAE3A EET$PLDcT$p@ccT$qT$ZD$vD$[ccT$rT$WD$wD$XccT$sT$TcT$tT$QcT$uD$xD$UHT$cD$yD$RcD$zDEHcD${AcIЈD$|D$YcD$}D$VcD$~D$ScD$23t$pt$pRA3$A$A@3EEE@ D3|$ODuXDL$ LT$@DL$`DL$$E DL$(LT$8E DL$,LT$0E Hl$1QADA tBH$HD3t$`LT$@LL$8t$pA3LT$0A$A3EE3DyHD$`HGHD$hHG,fff.ATDgE1U1EL$SHEHD$HFHD$HFHD$HFHD$~tExoD1AQLcICDHcIcAtIA@tt@tt@tTTA9AyA9bEYD9廀cMc:DBDc2T$T$BD2c0D$BDc0D$BDT$c0D$AHt$AHA~GIcAHHDHc0HHLH9tH0HH9uAHE9~VE~o1AJLcIA9~>HcIcAtIA@tt@tt@tLL~AEA9~D9~fHD9[]A\fDHt$AHfIcAHHDHc0HHLH9tH0HH9uAHAt VD$Ht$AHcD$2L$c0D$D$L$c0D$D$c0D$DIcAPHDHc0HHTH9t H0HH9uAHANA9+E0|E0fff.AUATAUSf.Mc1LNHHl8LD$HcLM1IHcEJDIHtFcB2cDVvB2c2cAIuuHD$IAIJD/HD$JD/D9gT[]A\A]Ðfff.USHH(tKMHIHAIPHI9uHH@uHH([]G A1fDH<:ɃA9HL @|wvfDGA fG AHCHC`fff.S1HdH%(H$1$Ƅ$HL$Ƅ$6@HcЍ<@ƒHҁ11Ѓu"c0$1Ȉ %H%HcuۿcAc11E11A@QHcHccccc AʈccD ccD11ʉ1ʀD)Hc AHcDAJhHc cccc c c c cAHc cccc c c c cAAHcMc cccc c c c cB cccc c c c c}1@At@D)HcHHI AA111D1ىc1ʄ҈ccccccccƀcƀc1ƀcƀcA1Hcƀcƀcƀcƀc1ccccƀcƀcƀcƀcccccƀcƀcƀcƀccccc@H$dH3%(u H[#f.="SHu[Ð@SHGuHG[fHC1[HJfuHHt "@fDwwÐfffff.HcHO4DT+O  %ÐH\$Hl$HHHHHt {up"HkCHl$H\$HÐAWAVAUATUSHHG /DGDOO LgHD$WHGLoLVPHD$HDADByZAE1HE!AA1DL9EËXAE1AA!E1ByZAE1A!DE1GyZDXAىXXGyZDXAA1AA!AA1EDXAAىXEByZDXDAA1E!AAA1DDf.F 3F4ADvAD^$D3^8D13D3v<UHSHHHdH%(H$1f!H21u&H$dH3%(H[]DH1H$HnoHH^oH$H¸tHD 5cܺ 5c1` H\$Hl$HLd$H(HHHdH%(H$1n{|us}}Ht Hs YH2n 5ccH$dH3%(H$H$L$ H(@L|LHtLB贈\BH1%H{ƃ=!LHH{H([1H [HDȅHHDH[HEL3B6LH1詙LB\BH1萙H$ H$( L$0 H8 LhLHC:Lâ@SH|$L)LL LHC:Lâ@Hu LZ 5c| 5c蝤=!H{}Lht-H{âu:LH{ƃ=!8fL8[H{H[L$ L1D$H$ fDATIUSHH0HH$HD$HD$HD$D$ -*H4$H9LHNHNHH)HHIHT$H4$L萓PvH.H0[]A\HH.H,@AULIATILULSHLHh HAHHuBLHLL.1HHh []A\A]H$0 HDŽ$0 HDŽ$8 HDŽ$@ HDŽ$H Ƅ$P /@H$0 HcHxbH$8 H$0 HPuH$0 .EHHHH$0 H-H\$Hl$HLd$Ll$HLt$L|$H(dH%(H$1H0[H8[HEHDu}E1䀽uZH$dH3%(D{ H$H$L$L$L$L$ H(HuDH ,:  E1䀻 ~^Hu1DH7HHh1HAP (fH8[Hdž0[Hǃ8[H}ƅ=!DhEu@$H90H:L$ЀH$ߢAƄ$ߢ藴At$ߢfHx.H:H$`[HEL$ߢ>H$`DD1 HU9q[Hp1H+0[ƅH߈HP D|1E\E1HE1@t 1AIƒH$`@耾nE1 5cr@=!tH}H@!H@HA ;DE1䀽9&Uƅ9H$`Dq[Hp1H+0[ƅHE1䈅HP 1E 5cID$@LlH$ O [D$0sj|$@UAP:HEEƅ=!AuAH H(AIt6EVHE B+H$`H1虑HEPuB1耑HEHH[HDžHDžHT$`H|$`HEH[HH0[H|$(H$ HHEPhEDuYDeZH0[H8[H H9H1 H$ H}$ ED$ou APD$o|$0[ȉL$@3 D$@|$oD$XxD$@1|$ot|$X=!H91q[u%1Ҁ[H|$`HET$8HH[~[ƅ;E|$@XAIt@APt:H[tB+ HUBBPBHDH1s1Eu)AEtAXu|$0Q[4H$ D$ ED$ tH0B|O@H()8HE"H@!AHHHT$XHH$`ED$@u!D@!Dd$@Etp[L$@t$@HE_u `tAXHAE>H$`HHjH[H[H$L$РHD$8HT$0HL$`HuH,@LHLy[HULL$0x[HT$(t[LDH$1[HL$HL$8H|$($HL$L!s[0[#H|$`H[ H$`x$rHL1豃 5c蒏E1H$p`H$8FdH3%(DumHHF[]A\A]fDL@b1HL0dHH+$0@AH$ H)HpH$p`HjHfUSHH<H8 Ƈ@AHHDŽ$ HDŽ$ HDŽ$ 1HHH{HʤuH{HP&&fDH{H蟤tYHC1u>fDH@t1HHtH$ HfH,4HC1H u4It+=g! t"@Ata 5c蝍H8 []ÀRu탸Its/!tP(BoH1qH$ HHBH,耥HCVBoH1#qBoH1 XHx|$hHD$dH4$HT$HL$D$`肬HxÐAWL0~AVAUATUHSHH(@,:L:L$T$D$ xD$ L:aHD$s|$HS H$tdxtAvTA| tJ1A I Ix HHEHS H$uH4$IW A@HHP(LHHD$N$ LHH4$H$ H$ CAE1AEE1AAtff.H$ CHDH4$HPH1Ht$HP 1H(@[]A\A]A^A_H$ 許tHDH$ HP"Ht HDžEt#AtiA[fH4$H|$ H|$ 9HDHt$ HPAAuH$ 3fH$ ΰ@A D$H@HHP(HD$HC H$ Ht$ H$ |$T|$X{c@BlH4$H1}Hv|$t$ H>,:|$H|$ A I` HE@HAAx HHHDžH;,:iHHHp1H+0[HP |$HBjH:H1m|APB1S|fDƅ'@BfDu|$EyAWL~ AVAUATIUDSHH+DxdH%(H$*1EɈL$kDT$l:Hh HH9CL$@"L~H` H$!e{ !DSh7L$@!DL$@!DEAARDDD$(ABHD|$ LSDɃ t$DD%L$AA T$CAEɉ$1AAI f H$" BHHD$`LEr|$k8BHT$Xh`BH1zXB1yHT$X0D!L$@!AtBLE1AAI 2 UL$" BLLT$`~HH H$p @ͺ2)o@ LLB1*/y|$kH$p B1yLdB1yH$*dH3%( H+[]A\A]A^A_Hh H` L$"AAB  L1LT$`fBfLHƿ@B1dx{2I$P~BB(hBfBHfHHƿB1xHt$pLBvfHT$pHƿB1w }HH HP 9HX B!fLHƿB1wx p|$l|$l B|EaH!TBII H=v IƺBI|$lDk<BDc B,BHT$XHE~eHT$XHM1EDPBH$Hv u t3B>eBH1v b - A# B1ovif.L$@"|BLNL B3v-fD 8BBHDdHŋ!t BndHHƿB1u!|$lB9dH!HƿB1ufDHT$`H$!1 BuH$p 1Bkux < B1Gu2fH$" BHHD$`)@L$@!|BLJfDҁ@-lD‰$@!AA-tD%EAAtDЃD綃w滃rAD%EAAsDЃDɃ ᶃw҃⻃rA@D%EAAsDL$@!DL$ %|$0t$(L$T$ADD$ABwAE҉$A1D\$8DT$LDL$LMULArfDxBHT$Xb`BH1rs0B1fsHT$Xg@1BBGsABAAu AB1rAtCB1rAYCB1rBD } X B| 1rf1Lf0B`HƿhB1ar@B`LHƿB19@ǃ@A.HuULcSfD&HcHJHDHtH0HtBtL)4qLcƉFL.HMcFTD9t0AIHcLANLL JTLD)AELLcBL.HHtH2HT[]HH;ƇtLT$H0IILT$LT$LfIIHu>HHHIILP HHHHA HD$fAKfHuIII9tHL$M9uM@M9tAHIf:uDJEA=HB LZDfAHLXHRHB If:uDJED=~M@M9u@LD$M9f.I@ IPEXHPIPAHB ~_AHHH M L fDHHHHH L9uHDH E\+IACHT.HcLA9t<DHcT)A)ˍQGHcB HLLI L HLHHTILDLD$M9 LcIPHDHHHL[]BTH1IL+ RHcI9ekH)HHHHH@@HLJJHLJHHLJXHLJPÐfATH1 USHHHHJHt NtЉ|HhKH;`KHHhKtHHHXH@ pf@fUKLHHcHl HDH1HHTID$H`1ҋ|HHƃ x1HIHHHIDHHHqHDH uE1ADIcEп %B1E)H@A1f@D @McM3@fBD[uHuAAuHSC 1Hcƍ HHD@fH@HH9uH@u[]A\JH`KHkHH;hKH`KH)HH`K+HpKHtHHpK1Hfff.SHƇ tHHƃHƃ@ƃ@@HHt Ht fHtHƃƃƃHؾuHH9uH 1ƃCHH HHHױH[Hƃ@ fH@Hfff.AVAUATUHSH`HHGDH9t5:rHJH H@:@rHB BHJfBHCH9uـ@E1AADCHL\B AfDCrEpA)HAA42@rfs DsH AA)DAfCy@:yv5D)LaHH H0Hp pfpH;Ct@:xwD(@xL`L9uAAHDHBx1DH xtFf)ffDAAA)fDCA9PAHKMcHcF JJIA9tRHcHl LlMIULHTHΉUIcHl HTI$LdMLcL`[]A\A]A^D1AHu#ǂǂ@HǂHAf.AUHATE1USHH踁SAŃу ASt;1H舁 AċCƒA9CwHD[]A\A]U1SHHO))@~&tHHcHcH47CtfH;)HcHsHc5M~V¸stL9NʉH[]뽃믐fff.H\$Hl$HLd$Ll$H(~HIu;HHAGHHAD$71=@HBAT$ HA$A<$u H H߃AD$ DH\$Hl$Ld$Ll$ H(f;E1Xfffff.AU1ATAUHSHHHsGGUAA~ HUHMHcƒUD ACtHkH[]A\A]Ð@H\$HHl$Ld$Ll$H(HHHLH9wH\$Hl$Ld$Ll$ H(fHLH9wf?H` DJ x WHO  HcHHc O J4pJJHcL@D)1FTCA9F JǃJ@ǃh fA)fFTCI A?A%BlGƃ Hǃ`A@)DJȉJhDJHJA}~HDJUHMAHcƒJUDJD JJB D1=vwD%Jt@pHHHLH H9TH;LG;ht؉pHHH'`JJJ)ADDJH`HDJJ6Dp(EH@H;LHXHHJJjDDJLJAA|$~LsJAL$It$HcуAL$JD ꉓJJJ 1vځJmDpHH|HGE11H`WЈGBDCxJǃJƃ f耍Q Jf)ЋJfBDCH`)AHDJJ|fHOH9H9H"\JJH`JJAD놃HU :H]`-H\$Lt$HHl$Ld$ILl$H8F=~HHt$Ht$FHVHcȃD$ FA A1HJt&A@HJ,Eu/HHH\$Hl$Ld$ Ll$(Lt$0H8fDAAA~jGdduHJDH{f=YHcȃ, FA@jF=hHcȃ FAKAuHJ1KHHt$sHt$FHVHcȃ, FHHt$CHt$FHVzfH\$Hl$HHHMHMHH9}H)H?H9HMGCHMH\$Hl$HÐAVH9IAUATIUSHtƇMsƇMA$MI)M#$PI$fLLHH9LLI9vI)M9MGI9$LvjHI$KLLM)I$PI\H!I9rZLHLH)I$K[]A\A]A^H ttH9LvƒHI+ĐLIԐK{I$HHI$KLH)p[]I$KLLA\A]A^U[]A\A]A^@E1I$K fAWAVAUATUHSH(HHLPeE1L)D!f.CIL93HN4JH?{uD+AKD)H#PL9D9t*HD $HLPD $D)D!9HB)D!D$t A9DHK1LYHMHsLC,`HC0K8HD$HJ<0 $ID$H;H $J2HL4HD9T$;K{N,I5J(HD$9K;L$u~{IEutMIHT$1LI1XHMHsLC,_HHS0[8J<0HT$\$3L;HJ0g\$Ht$H}HS?HLPHMƅMt$+|$D!L9DHHHH([]A\A]A^A_ÐIHHDHK1LD)HH$+WH$L$LHKHW@IĉL$$HL9v0HJHHt xt@IHI9rHH([]A\A]A^A_@uƇfAWAVAUIATUHSHH(~B u;C+sH߃rHrAƾHAErD1DbADH߃AU AErH߈D$Or1D$ DH߉$Ur$ D$ C A9ԉC wŋD$ DZ1AE1‹D$ 11:T$tH([]A\A]A^A_ËD$ AML9OA@AEAEuH([]A\A]A^A_fDS1떐@HGxÐfD1 HHHHױ HÐfUHSHHH;Ht ۑHHH9uH[]fff.f.AWIAVIAUATUSHMA E1D$ DL1L)HI@H=@HCH9H$spHHH)H9$w`H蠐HHt1IHHI脏MI.ID$ M9v |$ M9wH[]A\A]A^A_D辒( @H0bbHE1H9Hv/DH t,H;sуHH+HHHHfff.SL L˃H)GLIHM!M9LAAL IM!L HLHM9wL9wH tTL9vƒL+L xDH t4L;sƒL+LbDL;LE[fffff.Ht{E1fDLABIL9v\M L9IwM9wfDI t$M9vAL+N Lfffff.LHL9tHH9vH)HH9HFD1Ð@H\$Hl$HLd$Ll$H(HHAHHFH;Hv{HHH=wlEMxHHKHtHDžKHKHLkƅMDHHLPH\$Hl$Ld$Ll$ H(f 5cJF@HKMAH谌HIMtLkjf.1HH{EtVHHHtJHKLLkLFLH)HHL!L!H9A sfDHKLkHt蛌LKE18MtU( @H0bbH蜎EuBf.@SHtoHLJHGxG GHLJMLJLJHLJLJLJ[DHLJHLJ1LJLJJLJHHH@@HǃHFHHǃHH#PHǃ1HCxC CHǃMǃǃHKHǃǃǃƃ[ÐfAU1IATUSHH Ld$@LHt 1ATHD@H9rH H 1D$@ψCDC1DA4TATT@TDHHuڅHsDH*1f.AUt ΃fs I9wՍHHHǃ AAIHE1ɸAAA))fAǂAIHE9v_wDD;Trf.w;TsH+TD)TD9vS fAHĈ[]A\A]ǃ-fAWAVAUIATIUSHHdH%(H$1z~1fDDwiHgAƾHA gAuHg HDpgEAf.vI$;H$LE1AH {BA39HKHc֋{E$4<DDTD)AD D%A;;EAAD;DsD;DAAuAA<8EAA{A403C+;A;A;$;C‰AD8Hw]DADAL 1H$dH3%(H[]A\A]A^A_DOHe H߃ D$ eEtDL$ EjAAƅ{u1A9[Ht$2LL$I$H$B@LI$H$LI$,H$,L3fD)A8<AD8@<:{423hf.EHD)Hwd H߃ $Ad$$AfDDADAHd H߃D$ cGHc H߃$c$rD$ fANDAL LrA fEƄ AۉƄ;a1P'DAAxAWAVAUATUSHHdH%(H$1;G1k+s LcLbLbĀ.@ǃǃ ǃ$L1Lbf.DwiLFbAžLA bAuL$b LDaE<A f.vH<H$HE1AHs9HIsHKHc֋{ D=DDTD)AD D%;<"EAAD9DvBfDD;D+AAuAEA<8B+<AA{ A40<;<sC‰CIw(DAAUD L~` LDx J`E EtA#19SƃH+HHHH$+<HHH$gHH$xH-H߹HH渔@b@i@V1Ht t  f HtH$dH3%(H[]A\A]A^A_fDD)=CA<:{ 42s6EHD)L^ LDx ^EA]ADAEAA3Lq^ LDx=^E1LE^ LDx^qAAUDAEYAAfEƄAۉƄfH1@uYHAAkHH(ǃH4뢤ff.WLGw HcE ADALAD ȹ)Āt(Ƈw W@w 1WÐfffff.H\$Lt$HLwLl$LKHl$Ld$HH(LL[LHC HC(HC0HC8C@HCHHCPHCXHC`ChHCpHCxHǃHǃƃQHǃHǃpLHǃHǃx =H [H+HǃHHǃHǃ1HǃƃHǃHǃHǃHǃƃHǃHǃ Hǃ(Hǃ0ƃ8HǃKƃMƃMƃMƃMHǃHHǃPHl$H$Ld$Ll$Lt$ H(HHLH{pCH{H$H{ LZHs~LH;fffff.S1HH!HKHtzH4DHCHCHYHT;HHK\H{pCCH{HjH{ aH{H[SYHHD$bCHD$HHD$LCHD$HHD$YHD$HHD$:HD$HHD$JHKH{pBHD$H{HHD$HD$H{ HD$HD$H{HD$XHD$H|ff.fDff.f.ATUHSHH<<Da HH։T$KHEHT$EthEE1E1DD9v.DD1EDAB* ADB AE)D9wAAE9wH[]A\<1H[]A\<DMH@1Ƀq9vI0H@8t@uDB4 EEAHq9wHH[]A\ÃMHlHtHH9tĀxuPx8)׈P@xDxADiA)D^fff.AWAVAUAHֺATUSHLHhLJLJHNHcYxL8Aŀ_D@HD1H9vHh[]A\A]A^A_H; wDH9ʉ@@AHT$0zEH@8@HT$ A HHT$&>H@L4LyHD$ @8H@1IHE EAHT$LMtVH111H4AA)LN H>tHL9rӅ{I NHHT$X=LHHT$LI)J,HT$L%7HA@HT$Eȍ1#PA E$1H9 v HEH1H9tH)H#PH9‹EAHE$UHEHEE,E$EHT$ BEHh[]A\A]A^A_fHT6At]A@HHDu HD$ WHpsHh1[]A\A]A^A_f1HH11RfDLL$5HHT$EL$HfL5‰D$,1t$,H|$0E1HD$0HD$8HD$@HD$HD$Pz=LL|$0RDALRAD9l$,wHL$ T$,LHt$0HS4H|$0IS@LxRALHRA H1ɾHDtLHT$L$t$r4HT$t$L$BH|$0ƹ1H|$0H貹Hvf.Hl$H(Ll$Lt$H\$ILd$L|$HHxAAAAAAL|$D1HD$HD$LHD$ HD$(D$0yfDHHt+HL$ڃD9rHT$DDL>@HADž1LD$觸D$H\$HHl$PLd$XLl$`Lt$hL|$pHxHtHD$u6DHXADž1fHxD`tE1mHLHdtfff.AVAUATUSHH@wHS HcD D L AD A D)AʼnE{ A40AAs ACH|$DHD$HD$HD$ 1HD$(D$0Et$6wC9~lfDHKHc4DT+K  ЉHL$ĈS ЃCD9S C9Hu.A9v)1H|$D$虶D$H@[]A\A]A^CXHc΃D D T Ds)AD  D`fHc΃D D T Ds){ AD  AAH@1[]A\A]A^HT$DDH=!H|$H軵HrfAWAVAUATUSHHDF"EuuA$B111AA~GED<AAAMcAFcEE9AcuBA<>DDIt뤀MƃM HHPH(H!ы9CHvHHH)H!H=w.H9t)HBHMH9M M DCH{HDK DhIc DT  D)D%;ESAm D9v D;DIAAuG +EAADK G(;DCC‰Cl =w(HHK HHPH=-$B$BDKDS IcDTLLT ȹ D)D%;E]A.D9v4fDDA;DAAuAEGB+EAADS G ;DKC‰CXʋcct/ 7$  $=v =HHωH)HHH-H9H9 LKI<8IH HvoLHAAENL HJHJHJHJHJHJHHJHL9uJHIAGA@GA@wGA@fGA@UGA@DGA@HHPD====-h$B`$BtVDCDK IcDDLAD ȹD))%D‰s FDCHǃ҉HH)HHHH9H9HKHHHH @BHHPqHHHPgD)lClF DADK FDC^HKAc;FHHKD,HHPHArD)HGHPL0 DHHKH!HHHPHH!L9HuZDCDK IcDDLAD  ȹD))D%AAAAEDS DKD)XCXFDADS F DKEEkD)H#HǃHH[]A\A]A^A_-…DtƒuDKDH-DS D,.Ic DT  D)D%;-@AAdD9-vDD;DrAAuGDADS F AK+-DKD)-;-C‰C0:DKDS IcDDDLAE A ȹD)A)ADAуDS F DKqHHH)HHHHH9s H9HPH|0HKH!HHHPHH!H9Huy_y ZHU+pH)HHPDKDS IcDDDLAE A ȹD)A)BTAAADS F DKaD)0.FDADS F C02DK$B$BtXDKDS IcDTLAD ʹD))Ds F DKHHHE‰HHL)H9tH9kHKAH<>HI HHHAAEN\DDDBDADBDADBDADBDADBDADBDADBHDAHL9uJHHAkGFGFuGFeGFUGFEGFHHPHPHxHKH!HHHPHH!H9HuitjHwHPLHHKH!HHHPHH!L9HuH*xHHPHUVH@AAƃMH[]A\A]A^A_@HHѻt@t SHtBDD)PE1E1H|tYAtMAF401AAt ̄~AVAt$ Hw%HHPDHֺǃLKM IH LLHI8@:x@zx@zx@zx@zx@zx@zxH@zHwkHI9I8 JHJHJHrJHbJHRRPHHPDCDK LIcDTL@AD D_ ʹD);sDA;TrAAvAG DADK FAK+DCD);CщSD+tЉ H.LAA)DSD#F DADK FDCAǃ$ ,fffff.AWAVAUATUSHHHHxLHHP/H1L)H!HC HL$ HHKHD$0HL$86DAD$H+H#PH9D$ rAD$ HsxHH9IIMLcpA<$tA|$ uAL$E|$HL)H#PH9sI9t7HLHHD$L$hHHD$L$HIH)H#PEL9EcH|$0E4D#PLHD$L$LD$-dHS EHD$L$LD$HT$(t D9M{Ht$(H|$8LHLD$ENLD$Ht$(DLHLD$AHSpHB*LD$tH;LHLD$HHsxHLMƃMHL)H#PH9E1HtpHKp11HH<9@H@HH9s9HtHHH)HHH41HH9H>HIHNHKpHsx@HHEHHH@@HPHFHHH!H9HKtH9tHH)H)H!H!H9sHKHH[]A\A]A^A_LHI)MHt$(H|$8LHLD$LL$ELL$Ht$(LH|$81LLD$8LHHHHH{pH),&HHKH|$(LLD$LL$EZLL$H|$(LHKLxZLD$fDHHKH|$(LLD$EIZLD$~HsxLAH9HHHCpf8t@ HHH9wAfffff.UHSHHHxwZHH1H9tH)‹MH#PH9EM H{p#PHUEHu%H[]fDH{xvHCx덐fDAVAUATUSHHMƇMEHHPLLcHH!ȋS;HHKHH)H!Hw.H9t)H~HMH9MuM sH{DC DhHc DT  D)D%;yEJA> D;sFfD;D3AAuAEGB+EAADC A41(;sC‰Cl Cc…tƅuDKL-DS D,.Ic4DL ȹD)D%;-cE^A D9-v fDA;D AAuAEGB+-EAADS G -;-DKCC0:@HLLHwt.S90u:LLHYuH[]A\A]A^9t1Hu HHHP D9C |D)lFDADC 42ClsMt?HH;LHHFHs\HKHHPSHHKHHPH+H (H;LsH+ÐLHːKEQD)@oH跱LHkHLHƿiHLHHL?RDKDS rIcDTLLT ȹ D)D%;E^A D;s DA;DAAuAEGB+EAADS G ;DKC‰CXP=AAADAPADKDS IcD@LD\LAD ȹD)D%;E^A D9vC DA;D* AAuAEGB+EAADS G ;DKCCD+v vMHHH)HHHH9s H9AHWHPL2@HHKH!H  HHPHH!L9HuefHLPHKֿHHP6tMHHH)HHHHH9=HPH|2DHKH!H  HHPHH!H9HuDADKADS ADIc4DL  ȹD)G%D)tDADS F DKD)XCXFDADS F DKwHKwHLH训HHhD)0.C02FDADS F DKMHHH)HHHH9H9 LKI<9IHHvnLHAAENDf HJHJHJHJHJHJHHJHL9uJHINA?GAA.GAAGAA GAAGAAGAAHWHPL2@HHKH!H  HHPHH!L9HuADKADS ADIcDDLAD ȹD)D)%EtDADC F DKECD)HD[DS Ic DLA LA LDA DAD)GT$A D)AADEAADS EDK|LKI<9IHHvqLHAAENDD HJHJHJHJHJHJHHJHL9uJHIAGAAGAAGAAGAA{GAAjGAAHHPƃMTD[DS McB BD BL BLB| DD) D) EDADC FD[EsD)=AAD)DCD#FDADS F DK^H9LKIIHHvzLHAAEOL9@8y@xy@xy@xy@xy@xy@xyH@xHL9uJHIABA@BA@BA@BA@sBA@bBA@HHPDEsD)HPnAAED)AA]AArf.t2t@MuH\$Hl$HLd$Ll$Lt$L|$HXH`@HHLxHM Ll$ HMHHjL9M9Ht%UE7If1H9L[H$(H$0L$8L$@L$HL$PHXHM HD$ HHLl$ HMedHf>HVSHV8 DfH : uHjL93I$HV IHCHfDMLJIHhKH;`KI$tUHHhKHHM9fL~Hn DvNHrHLl$ MefHpKHt\HHpKHED:0tH D:0upM҃)э6)9rN49у)D1LHT$L$LD$LD$HL$HT$f4 1ҍ DHf.HAW1AVAUATIUSHHH`hD0H@@HD$0wwHHHH Htgf9%HAD80u0HD8p HP ur@:pr"LHzLD@fDBD0H@pHx@rDA$pHI$LD1HI;$LI$LH|$0H;L$0A$pA$pII$HI$XDxD(DAE)E)H9I$JEEIHD$8Xf9E19AƒFTfKHsHHFD0DPLxf+H[ I9$H1+@T-C D99ȍ D9!ȍ JfKэBD4RA<69H<9E)199ETDfK1AJI$`K<H9I;$hKI$`KvHH)H|$8T$(I$`KDD$DL$LT$ D\$D\$LT$ HDL$DD$T$(HHCL`AƄ$ HH[]A\A]A^A_I$`LKHHCI$XI$HtHH[]A\A]A^A_@rfAWI$XI$H1HL$0H9I)$LfDLSBHEJHcAJA9 HcHl ILHHIDLHHL$(DD$DL$LT$ D\$9BD\$LT$ HL$(DD$DL$McIl KDIOTHHKA$JHcHl IDHHILH^HSHS fPHCHw:ɈH1AfA$lfKBDLg@xxDHD$0I$HI$XHH[]A\A]A^A_@A JI$`K HI;$hKI$`K2H|$8H)DD$I$`KDL$2DL$DD$AHQ<@ƍApH@r1LHL$(HHD$0HL$(2fI$`I$XHHI$HHD$0)SH1HODJDJD+JD񉎜J1HwAJDAA1D9DNE9L`Mƃ fHHV DREE9uA DJ @HHǃ`hHHH)HH H9@u쉋JH[C DJH`9A xDNfGA|ǃJH[f.H蘕ǃJDJBH`A)DJBfGJ:NHLLBD LDVfDRNDLFH`~|HވD$ D$SHHDhщD)f0HE1D HcHHtHO  )BJ9OAE19ѹAA9HN HJ J HHDNA1fA)ЅfDJHWD I1H @H DF8tDRIDуtIDJDJ1DJD+JADA1DJAÉJDAA1E9A9H$BD9!Hf.HHDBDD9~쉃JJ)ȉJNw!FFuf&FNH`BfGz|| xH[DJHL$DJ+h HHQDufDhH[DHAǃJIH芒_HƇ  1HHÐHHH)HHHHH9H9LKIIHHvzLHAAENLfD8@9x@yx@yx@yx@yx@yx@yxH@yHL9uJHIABA@BA@BA@ttBA@tgBA@uZBA@tLHPLD2DHKH!H  HHPHH!L9HuÐHl$H(H\$H(HHtH\$Hl$ H(@HD$謓ǃD$H\$Hl$ H(ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<Y7HIH3HteHSHH9HsH;H H;7L#HkH\$Hl$Ld$ H(f.H;H4:HItXL#Hk(B1 5c 5cHCHs) 5cHD$HD$B 5cv뜐SHH?Ht4{ u[6HsH H;[6f.[ÐSHH?Ht4{ u[6HsH H;[6f.[ÐSHH?Ht4{ u[P6HsHc H;[26f.[ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<)5HIH3HteHSHH6HsH;H H;}5L#HkH\$Hl$Ld$ H(f.H;H4h8HItXL#Hk(B1 5cW 5c}HCHs) 5cHD$aHD$B 5cF뜐H\$Hl$HHHSHlH\$Hl$HÐH\$Hl$HLd$H(HwHGH9HwvzHWHt H9HHHl H9HB{ tfHH3HIH3Ht]HSHHV5HsH;H.H;3L#HkH\$Hl$Ld$ H(H;HH6HItaL#Hk(B1 5c 5cHCHs1 5cHD$HD$A 5c듐H9wr HwDH+wSHHH4$HT$HCH$HHHHHT$HPH[S@$Hu tqEt)Xt$P€tu!Vu(Bt-[ÐfVƃt؃Lu܃Buƃ[DH$pBw?yfHu Qt HD0%BvHH1US1HH'BHAH1H u B1H 5c[]fAWAVAUEATA1USHHH@ LHIL|$>Bf.tEH$ 1K8*HLDHuXH$ Hs=tDH$ rK8H8NEutH$ pBxFfDH@[]A\A]A^A_fxMfLL$.D$/EHBH\$Ld$HLl$DDH$Hl$Lt$HH(HEDAD¸u1Eu%H$Hl$Ld$Ll$Lt$ H(%tH%ADHD+fDLd$Ll$ILt$L|$AH\$Hl$HXMH|$HT$D$EMEt|$uDIl$ 1H=.H=v=Hl$0H\$(Ld$8Ll$@Lt$HL|$PHXAA$ H|$1AHuHD$H$HHD$;fDHLuH|$;HIu1UfH|$tHLCHD$|$+DLLzC@SHHPAEwGHHHxEH@HHy#.pu B1 HPA[þHӐHHeƇHo)HPHHHHl$H\$AAH+@Ƈu>1HuH\$Hl$HfDH\$Hl$HfHƇ B/fffff.H\$Hl$HHHuH\$Hl$HfDIHE1ɺHRDH\$Hl$HÐf.SHHH$sHHcH$Hk,H$H$fDHH9uH$HHH9uH[Ðf.HHH'H$HfHH9uHÐ@="AVI1AUEATIԺ0 UHSHHp"H&1HH&rH$ H$ " ?H$ H$!1ɺ2HtHI9 B1(BRHH1AA8(B@@'BIDHtt!tfDHp"[]A\A]A^fDH$!L+>H$0 1ɺ2H(BL$0 L$!H$!H$ "HH1#0҃m@_V*B4H1LHO<҃(H\$Hl$HLd$Ll$HLt$L|$HX HT$<IME̸tTt}L|$ L3;LELLt]tYt{H$( H$0 L$8 L$@ L$H L$P HX H0\1@HD$T$\T$D$tǃ<1DL?L9t\HT$LHk:HSZ1THT$EMLHH6fǃ<HT$LH@ffff.@B@BSHDHHSHH1[Df.HHHAK*BH1ffffff.HHHK*BH1_fffff.H\$Hl$HLd$HhvH$Hl$Ld$HfDGh$PIBfD;B~HH$Hl$1Ld$HH=BUHHH$Hl$1Ld$H_@EB)HH$Hl$Ld$1H_@EBӿDBHtHoHDBLd$H1HHHl$H$HBlLd$H1HHl$H$H=BAH;HH=B)HHo =BH;HH HfSHGB»HH1@HB諻H[ff.S1H B/BvHH11wHB]HU[ffff.U1SH BH@0BHBHDHH11HBHH[]ÐHl$Ld$H- L% Ll$Lt$L|$H\$H8L)AIHIHt1@LLDAHH9rH\$Hl$Ld$Ll$ Lt$(L|$0H8ÐUHSHH( HtbDHHHuH[ÐH HMaximum allowed array size (%u) is exceededbB8RAR_EXIT*?/.rarexesfx00?*<>|"?*?*<>|"?*B0K@`K@F@pM@PR@F@4FilebB Creating %-56s OK %s%.*ls(%u)%lsCMTBZ@[@F@pM@PR@F@7ArchivepbBBp@0t@s@r@r@ r@q@pq@8|@O|@}@}@{@@;%uRRr/dev/urandom__rar_%u-%02u-%02u %02u:%02u:%02u,%09u%u-%02u-%02u %02u:%02u????-??-?? ??:?? %s: , %cEnter password (will not be echoed) Enter password (will not be echoed) for %s: Reenter password: ERROR: Passwords do not match [%c]%ls User break Program aborted %s @4@4@@Q@@@@@p@X@@@@@5hW9~<x?i7}],煼/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[                                   UOW\??\/??/ %s - use current password ?_Yes_No_All Testing %-56s Skipping %-56s Extracting %-56s %s is not RAR archive All OK Total errors: %ld ? %s%s Done Testing archive %s Extracting from %s ... %-56sFileCRC32BLAKE23.05.0Unix %ls%cB<-><---->%d%%NameSTMTypeTargetSizeRatiomtimectimeatimeFlagssolid%ls %ls:#%d: %ls RAR 4RAR 5%s%sSFXvolumelockEOFDOSOS/2Mac OSBeOSWinCEServiceDirectoryCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2Windows Attributes Size Packed Ratio Date Time Checksum Name ----------- --------- -------- ----- ---------- ----- -------- ---- Attributes Size Date Time Name ----------- --------- ---------- ----- ----%c%c%c%c%c%c%c%c%c %12s: %sNTFS alternate data stream %12ls: %lsUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referencePacked sizeAttributes %12ls: %8.8XHost OSCompression %12ls: RAR %ls(v%d) -m%d -md=%d%s %12ls: encryptedFile version %12ls: %uUnix owner %c%10ls %9ls %9ls %4ls %8.8X %02x%02x..%02x ???????? RAR 1.4Archive %s: %sDetailsvolume %drecovery recordencrypted headers %21ls %9ls %3d%% %-27ls %u %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu*<-?->YA`A_A_A_A_ABBBLBBBB B B B.... @   (08@P`p  -x Extract from archive (default) -t Test archive files -v Verbosely list contents of archivex%B%BX&B&B_Yes_No_All_nEver_Rename_Quit_Yes_No_All_nEver_Quit Overwrite %s ? Would you like to replace the existing file %s %6s bytes, modified on %s with a new one %6s bytes, modified on %s Enter new name: %3d%% %-20s - checksum error Checksum error in the encrypted file %s. Corrupt file or wrong password. %-20s : packed data checksum error in volume %s The specified password is incorrect.Not enough memory Cannot open %s Cannot create %sCannot close the file %sSeek error in the file %sRead error in the file %sWrite error in the file %s WARNING: Cannot change attributes of %s Cannot copy %s to %s. You need to unpack the entire archive to create file reference entries. Cannot create directory %s Cannot create symbolic link %s Cannot create hard link %s You may need to run RAR as administratorCorrupt archive - use 'Repair' command Corrupt header is found Main archive header is corrupt %s - the file header is corrupt ERROR: Corrupt data header found, ignored WARNING: Unknown data header format, ignored ERROR: Corrupt %s data block Recovery record is corrupt. Unknown method in %s Unknown encryption method in %s ERROR: %s and %s belong to different sets Nothing to reconstruct Reconstructing... Reconstruction impossible Unexpected end of archive ERROR: Bad archive %s The archive comment is corrupt ERROR: Invalid file name %s No files to extract Cannot find volume %s %s switch is not supported for RAR %d.x archive format. %ls%ls%ls ERROR: Path too long ERROR: %s group and owner data are corrupt WARNING: Cannot get owner %s ID WARNING: Cannot get group %s ID WARNING: Cannot set %s owner and group WARNING: Cannot read symbolic link %s WARNING: Symbolic link %s already exists WARNING: Attempting to correct the invalid file name Creating %s Renaming %s to %s Calculating checksums of all volumes. %d recovery volumes found %d volumes missing WARNING: FAT32 file system does not support 4 GB or larger files Testing the recovery record%s Insert disk with %s_Continue_Quit_Retry_Abort ERROR: Not enough disk space for %s.BBOAiBMB.BBBBBBB}BaBOAOAEB"BBAAAAAqA\A@A+AAAAAAOAOAOAOAOAOAOAOAOAOAOAOAOAOAOAxAfAOAxA=AOA(AAAAOAOAOAOAOAOAOAOAAAOAOAOAOAOAOAOAOAOAOAOAOAOAOAAWAOAOA;A"A AAAAOAOAOAOAOAOAOAOAOAOAOAOAOAOAtA\ADAAAAAAxABBOAOAOABOAOAOAOAOAOAOAOAOAOAOAOAOAOAOAOAOA; 0` H@hp0`p0P(0p` H`p @@` 8Ph  p0H`08X`@ `P0@Pp(@hppp   8Ph(@Xp0@ HhPPHh Pp0`Xpp0 P@(@@XPp`0    p 8 (! @! X!P ! !@!"0"@"P###@p!0"H"p"0"P(# $ P$0h$$$@$p%8%h%`"%*%3&AH&Ah&@B&C&C %CP%C0'E'`G'G'H(0I (I8(KP(Kh(L(L)0MX)@Mp)PM)M)M)M)M)N*RX*0X* [+`P+@a+c+`d,d(,fX,f,0g,@h,h-h-0i0-`iH-i`-ix-j-@j-j-k-k.k0.@lP.plh.l.@m.0n.Pn.`p/pp0/pH/p`/r/u/u/Pv0pv00vH0v`0vx0v0w0Pw0w0x1x 1y81PyP1{1{1|1 }1}20h2@2`2p222P3p83ЁP3h33p33404`h4@45Ћ(5@p5H5505`556Ѝ 6 86``66@66667ЏH7h7 7P707`7888X8x88808@8`9p 9077@9X9 p9@9Г9:00:H:h:p:;h;p;;(<X<<<@<`<<=(=pp===p>(>`x>>0>@?`?0???@P@@p@@@`@p@AXA@APApAA BhBpBBBC(CXCCCC D 8D`PDxDpDDDEp0E0`EEE(FXFFE F(GGpGGH(H@xH@ `H H H H Ip!8I"PI0&I`&I(I0*IP-xK-K`.K.K / L/8L00xL 1L2L2M`7`M9MP9M:NP>xN`>N?N@O @(O`@XOp@pOpAOAOBOpCPC(PEPPPGxPPIPpNQ`TXQTQPW@RXhRZS_SPaSc TuTpy8UzhU@UHJ xJ K00K`KЗK`8MЙpQQ`QRR@RTTU UUVP@VV0VV W00W@HWPWФWХ`WW W@XpXHX0pXXXXY` Yp8YPYY Y0Y`Z Z0xZ@ZZдZ Z [H[zRx :4*ACe$T,MI0Q H |LMD PAC$pBACO M Q O AzPLRx#@ <$XBBCFCF G@O  AABB $\8|MN0Do B D SJN0Cx *ACe%AKXHAJ|$4<MI0Q K \gWD K$xBMIPFy K 4BACACGPa AAA h` XGN Fe G L,mBBA CA(CD0| (A ABEK D(C ABBL|qBHBB A(CA0C} (A BBBF D(A BDEDACk A SAAC| 8DM$@DM<HDXTPlX PH4PBBA BA(B  ABBF 4D840L(9N FdlHP;N FfpQHR CsQHR CsDP A Dh A $PJAFB$DAJ_ F SDl(XBGC A(BK  ABJI M  IBJF @JACr J IpACU4pCBCECA CG@  DABJ ,NMI FmL'DV F F$lMI IH I R0&ACa@ D[H@8DM@DP$,H_N Cs L N$TzML@QO$|mMN0IH AC[, BCAA  DBD dBCBB A(BA0C (A BBBK d (A BBBE f (A BBBC \ #D^<t yBBB CA(A0Cc(A BBB< PqBBB CA(A0B\(A BBB = =$ a< 8a$T MLCl H | H @$ 8MI N\ H  GLD v pN F{ A  P/, hD p $\ hDAGG Q G I , M^g B  D X8AGo x1AHO H P$ MLC A 4 @1ACQ K P,T `}ACD h AG | AA  2AFY H E - ACI$ lIN Cw G , 0:MMN@M A 4 @4DR J S,T `>MMNPPk E  p h#D ^ D X AFU $xMQ[ B D $\2ACGeA$ xBMI CE A $hrAHD G AK *ACY K ADZ, |ABABLb AAA L<(5BCBB CB(CA0A8G@I 8D0A(B BBBH VGI A 4HBACG{ AI O AA ,&D\tYGL A lG_ A $`ZAGGD AA $vACL _ AA TGG A $0YBCBCB CB(A0CA8CDP 8A0A(B BBBJ Q 8D0A(B BBBJ T 8A0A(B BBBJ Q8G0A(E BBBTBCBB CA(A0G@ 0F(A BBBA G0C(A BBBpQ,D+$\:ACO M M K A,ͩBAACD ` DAE PACIDPBBBB A(CA0Cc (A BBBA H)Dd$4`:ACO M M K A\x8MD f|$`BMIPp F $X.BMMD0g K ,@KBNPPN D  A $ ,MI0Q H Dv^BBGB B(CA0GA8FDa 8A0A(B BBBB t 8C0A(B BBBA m 8F0A(B BBBC GACN F n$VAGS U A G O, XACDT AC rA<4THCr C b F T D T D tX$iN Ft H XX)AG\h;AC] O J h.Di$p(KX<h.Di,\pxBMMLc% B L'BBB CB(CA0A8CGA 8A0A(B BBBK , BM^AZ F ,  g ԪBM^B[ E 4N B] C TT0BCBGB CA(A0CY (D BBBE @ (D BBBF $xMI Id M zD {BCABA CD0Q  AABK D CABTBBCB CB(CA0A8DXC 8A0A(B BBBD LtBCECB B(A0A8Du 8A0A(B BBBE DB& !$!<8# LT0#cBCBB A(BA0Co (A EEFH A(A BBDLP#sBHBB A(CA0C} (A BBBF A(A EEFL#BBB B(A0A8CDPs8D0A(B BBBD#\#t#^$$##T#BFBB CB(CA0CA8CG 8A0A(B BBBG TD(ABCBCB CB(CA0CA8CG 8A0A(B BBBA Lx-BBB B(A0CA8CG 8A0A(B BBBA L0BHB B(A0CA8Gy  8A0A(B BBBF 4<47BACA CDpx  AABF D|54BBBCA CD(ED0 (A ABBB <7BBHAGA D0a  AABA H8",`8sMMQd_ B LD9BBA CF(CI@t (A ABBD m(A ABB0:J$h: DH D `P;\;D;@;!4<L<+d0clX>SMI Is$>MN@Nv A `?4h? BGA A(F   AFJB  @A 8A4 0A4L 8AHRNPM~ E P E , C[LbI I  @E]0M, ErACACD`cAA!0F!8F4!0F&L!HFd!PF|!HF!PFID@y!F`F@Y$!FMIJb F !G5ACD kA "G$"GD,D!G.BMSN0C1 A l"xI,!0JYBAACD Q HAE $"JMI GD O $"(KM[@GL#KMBIB B(CA0A8CD`f 8D0A(B BBBA T#Ml#M#M,#MoACD0x AG eA#M#MZQ CE$0NAGT$$0N]DX<$xN $T$pNAG]A$|$OAG]A,$OAAG!dAA$PqMD F I $$QACGR AB 4%xQBCABA CGP  AABI LT%RBBB B(A0A8CLo 8A0A(B BBBF L%U3BBB CB(A0CA8G I 8A0A(B BBBI %pVPAJD&VbACY$4&@WBACO M Q O A$d%VOtBAHF \ AE &@WBDs A &pW"&W"&W&W*ACL H Q 'WP$$'W;ACDqAL'WRDf F ]l'8XyN IX A 'X2MD \'XACN'X'XDK'X ABH(X[)Dd4(XACST(X"AGUt(X"AGU(XG!(Z.Di(HY!DX(`YACS)`YACS$)`YACND)`YACSd)`Y |)XYACN)XYACS)XY )PYACS)PY  *HYACN,*YD*Y\*YAGC E N$|*YABF k AK \*ZAACD0g CAD Y AKC h CAD a ACK WCA+Z8+ZV4+@[U[TedT+[wBBB B(A0A8CD 8A0A(B BBBA p 8C0A(B BBBA D+aACACD p AAB q AAE aAAL,aBBB B(A0A8DY 8A0A(B BBBA LT,fSBBB B(A0A8G\^ 8A0A(B BBBA 4,k4BDDBF h ABG 4,nBFFA A(F ABB,-`oABACD@e AAA $D-0pEASp AA l-XtHCK-Xt>DCO J V-xt-t-t/-t?MD mD.tsBDB B(A0A8F 0A(B BBBC \.{+$t.|MNpIO E L.|BBB CB(CA0CA8BD| 8A0A(B BBBA $.h}*MVpH G L/p~BDB B(A0A8GY8A0A(B BBBd/@L|/BBCB B(A0A8CD@p8A0A(B BBB,/HBACA GABL/(BDB B(A0A8DhQ8A0A(B BBB<L0BECB CA(A0C(A BBB0Y,0ЅACACD  AAI $0pARACWA,0MBCAA D~AB,,1jMPQG D <\1HBCBGA CA(BG(A ABB1؈M1v1x1p2ACf F A<2ACD \ AK K AD K AD H AG $D2`wMI H\ F \ L $l2AJ\h AH 2,2[ACACDPG AAA ,2؍BCAA Cz AEF D 3xAACGЀ] AAE  FAD GCA$T3 ML@mg C $|3؏M[@Cw F ,3@ACACJ F AAF $3MLa E 3h4,4MML c J ,D40_ACD d AC fD$t4`MY^ J $4(H[C D ,4_LRQd G ,4MMQPLn K $55$D4BIMD f A $l4XBN Gj E 5ȜfAC]$5MV0M D $5ОNMLPt C 5\AI} I ,68M^@GV H $L6ȡML@J A t6P3Dn<5(BBCAA CIP  AABA D5@«BBFBCD CA(CJAM (C ABBI ,6!BM^a{ I DL6?BBBA CH(G_E (A ABBG ,7HAACN@7 AAA T7HBGBB B(A0CA8CG 8A0A(B BBBA T8BDBB B(CA0CA8CGV 8A0A(B BBBI Tt7ht]BBBB B(CA0A8GЏjz 8A0A(B BBBA 888AHM49mBCFCA CG  AABF L93DnLd9BBCB CA(A0CG 0A(A BBBF 999#$9HVD0l B $:084<:X{HDF AA d AA t:-,:TBOA C ABA :dAC A T:8BBB A(CA0J (A BBBH q (A BBBA ,4;0@M[U D d;BBDB B(CA0A8DK 8A0A(B BBBI r 8A0A(B BBBD  8A0A(B BBBE ,;HACF   AD L AK ,<I{ACG AF Q AF L<HLd<HLI Ck<0L$<U L] B <,<AACD AA =<$=pBECA A(CD0c(D ABB,d=ACCD  AAD $=pMN0J J <=8{BDFA CA(CD0\(A ABB$=xHS0S_ C $$> LaLI0C[ E h$L>MV@J G t>pON C}d>}BFBB CA(A0C (A BBBL Q (A PBBE A (A BBBE d>xBBB B(A0CA8D`b 8A0A(B BBBB 8A0A(B BBBd?d|?BBB CB(A0CA8CD` 8A0A(B BBBA w 8A0A(B BBBG ? ?,@4AGACD aAAD@L\@BCBCB B(A0A8DP 8A0A(B BBBF @T@CI@@X;$A&MN0I J $BHLXPs A H(NH0NH8N",IPN6ACACD gAA$4I`NtP[0F~,\INN E} H q G T D IHO$IPOeN JY G l$IOACLsAIPDG| J8PL$J0PBCDCB CF(CA0CGE 0C(A BBBG ,tJQM^@N D J0S+NGQJ@SJ8S!DVJPS!GST KhSMI IR G q E g E f E J E X E s E  E  E dKY|KYGDM G nKY5ACpKYCAE|,K(Z[ADACI FAA$ LXZQ_@FR4LZqZ %JUJ}}}bBJ[{BSsg, _Fs ,=u#!(s<HT`n$3Fb+Sl([F24 |Er+'Fs+1S}Bj'19HR]kv!hEQc 1,J'Tb D?S>]#$" 5)c"Q  t MNa  6F#,  " =4'3?KWxRA  /k==>~',4CRapxpF@@S]z @ Bo@ @@  b0 P@x@ o@oo@ b@@@@@@@@.@>@N@^@n@~@@@@@@@@@@@.@>@N@^@n@~@@@@@@@@@ @ @. @> @N @^ @n @~ @ @ @ @ @ @ @ @ @!@!@.!@>!@N!@^!@n!@~!@!@!@!@!@!@!@!@!@"@"@."@>"@N"@^"@n"@~"@"@"@"@"@"@"@"@"@#@#@.#@>#@N#@^#@n#@~#@#@#@#@#@v?C2~%t,ȀOGCC: (Ubuntu/Linaro 4.5.2-8ubuntu4) 4.5.2GCC: (Ubuntu/Linaro 4.5.2-8ubuntu3) 4.5.2.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment 8@8T@T !t@t$4o@L> @8 F @ No@[o@jx@xtP@P0  ~@y@0#@#(B B I MBM\B\LLBeb bb b bb( b H bhhE 0hTrar/license.txt0000644000175000017500000001514113143334065011335 0ustar zz END USER LICENSE AGREEMENT The following agreement regarding RAR (and its Windows version - WinRAR) archiver - referred to as "software" - is made between win.rar GmbH - referred to as "licensor" - and anyone who is installing, accessing or in any other way using the software - referred to as "user". 1. The author and holder of the copyright of the software is Alexander L. Roshal. The licensor and as such issuer of the license and bearer of the worldwide exclusive usage rights including the rights to reproduce, distribute and make the software available to the public in any form is win.rar GmbH, Marienstr. 12, 10117 Berlin, Germany. 2. The software is distributed as try before you buy. This means that anyone may use the software during a test period of a maximum of 40 days at no charge. Following this test period, the user must purchase a license to continue using the software. 3. The software's trial version may be freely distributed, with exceptions noted below, provided the distribution package is not modified in any way. a. Nobody may distribute separate parts of the package, with the exception of the UnRAR components, without written permission. b. The software's unlicensed trial version may not be distributed inside of any other software package without written permission. The software must remain in the original unmodified installation file for download without any barrier and conditions to the user such as collecting fees for the download or making the download conditional on the user giving his contact data. c. The unmodified installation file of WinRAR must be provided pure and unpaired. Any bundling is interdicted. In particular the use of any install or download software which is providing any kind of download bundles is prohibited unless granted by win.rar GmbH in written form. d. Hacks/cracks, keys or key generators may not be included, pointed to or referred to by the distributor of the trial version. e. In case of violation of the precedent conditions the allowance lapses immediately and automatically. 4. The trial version of the software can display a registration reminder dialog. Depending on the software version and configuration such dialog can contain either a predefined text and links loaded locally or a web page loaded from the internet. Such web page can contain licensing instructions or other materials according to the licensor's choice, including advertisement. When opening a web page, the software transfers only those parameters which are technically required by HTTP protocol to successfully open a web page in a browser. 5. The software is distributed "as is". No warranty of any kind is expressed or implied. You use at your own risk. Neither the author, the licensor nor the agents of the licensor will be liable for data loss, damages, loss of profits or any other kind of loss while using or misusing this software. 6. There are 2 basic types of licenses issued for the software. These are: a. A single computer usage license. The user purchases one license to use the software on one computer. Home users may use their single computer usage license on all computers and mobile devices (USB drive, external hard drive, etc.) which are property of the license owner. Business users require one license per computer or mobile device on which the software is installed. b. A multiple usage license. The user purchases a number of usage licenses for use, by the purchaser or the purchaser's employees on the same number of computers. In a network (server/client) environment the user must purchase a license copy for each separate client (workstation) on which the software is installed, used or accessed. A separate license copy for each client (workstation) is needed regardless of whether the clients (workstations) will use the software simultaneously or at different times. If for example you wish to have 9 different clients (workstations) in your network with access to RAR, you must purchase 9 license copies. A user who purchased a license, is granted a non-exclusive right to use the software on as many computers as defined by the licensing terms above according to the number of licenses purchased, for any legal purpose. 7. There are no additional license fees, apart from the cost of the license, associated with the creation and distribution of RAR archives, volumes, self-extracting archives or self-extracting volumes. Owners of a license may use their copies of the software to produce archives and self-extracting archives and to distribute those archives free of any additional royalties. 8. The licensed software may not be rented or leased but may be permanently transferred, in its entirety, if the recipient agrees to the terms of this license. 9. To buy a license, please read the file order.htm provided with the software for details. 10. You may not use, copy, emulate, clone, rent, lease, sell, modify, decompile, disassemble, otherwise reverse engineer, or transfer the licensed software, or any subset of the licensed software, except as provided for in this agreement. Any such unauthorized use shall result in immediate and automatic termination of this license and may result in criminal and/or civil prosecution. Neither RAR binary code, WinRAR binary code, UnRAR source or UnRAR binary code may be used or reverse engineered to re-create the RAR compression algorithm, which is proprietary, without written permission. The software may be using components developed and/or copyrighted by third parties. Please read "Acknowledgments" help file topic for WinRAR or acknow.txt text file for other RAR versions for details. 11. This License Agreement is construed solely and exclusively under German law. If you are a merchant, the courts at the registered office of win.rar GmbH in Berlin/Germany shall have exclusive jurisdiction for any and all disputes arising in connection with this License Agreement or its validity. 12. Installing and using the software signifies acceptance of these terms and conditions of the license. If you do not agree with the terms of this license, you must remove all software files from your storage devices and cease to use the software. rar/rarfiles.lst0000644000175000017500000000223113143334065011501 0ustar zz; File order list for solid archiving ; ; Here you may modify the file list which tells RAR the order in which ; to add files to a solid archive. ; ; This file may contain file names, wildcards and a special entry - $default. ; The default entry defines the position in the order list for files not ; matched with other entries in this file. Lines beginning with the semicolon ; symbol ';' are considered as comments and not processed. ; ; Place this file in the same directory as RAR.EXE. ; ; Tips to provide improved compression and speed of operation: ; ; - files containing similar information should be grouped together in the ; archive if possible; ; - frequently accessed files should be placed at the beginning. ; file_id.diz descript.ion read.* readme.* *.nfo *.doc *.txt *.htm *.html *.shtml *.css *.xsl *.xml *.js *.php *.lst *.log *.ini *.bat *.cmd *.h *.hpp *.c *.cpp *.java *.asm *.bas *.bak *.cue *.rtf *.hlp *.inf *.com *.exe *.dll *.obj *.lib *.sys *.drv *.bin *.bmp *.wav $default *.mp3 *.mp4 *.m4a *.mov *.avi *.wmv *.wma *.gif *.tif *.png *.jpg *.chm *.pdf *.cab *.7z *.arj *.ha *.lz *.lzh *.rar *.zip *.gz *.bz2 *.xz *.jar *.fla *.flac *.ape *.bik *.mkv rar/whatsnew.txt0000644000175000017500000004624513143334065011564 0ustar zz RAR - What's new in the latest version Version 5.50 1. RAR uses RAR 5.0 archive format by default. You can change it to RAR 4.x compatible format with -ma4 command line switch. 2. Added support for 1 nanosecond file time precision on Unix platform. 3. You can specify 'f' charset value in -sc switch to use UTF-8 encoding. For example: rar a -scfl arcname @filelist.txt to read contents of filelist.txt as UTF-8 text. 4. RAR "lt" and "vt" commands display file times with nanosecond precision. Such precision is used in RAR5 archives created by RAR/Unix 5.50. Archives created by Windows RAR version have 100ns file time precision. 5. Only '+', '-' and '1' precision modifiers are supported in -ts switch now. Use '+' to store the file time with maximum precision, '-' to omit the file time and '1' to store it with 1 second precision. Intermediate precision modes previously defined with '2' and '3' modifiers are not available in RAR 5.0 archive format and ignored by -ts switch. 6. If a wrong password is entered when unpacking an encrypted file in RAR5 archive, RAR proposes to enter a valid password for same file again instead of aborting extraction. 7. Bugs fixed: a) fixed crashes and security vulnerability when unpacking corrupt RAR archives; b) directory owners were not set when extracting RAR5 archives created with -ow switch; c) if only creation or only last access file time was stored in RAR5 archive with 1 second precision, such as with -ma5 -tsm- -tsa1 switches, this stored time was ignored when extracting. Version 5.40 1. If RAR recovery volumes (.rev files) are present in the same directory as usual RAR volumes, archive test command verifies .rev contents after completing testing .rar files. If you wish to test only .rev files without checking .rar volumes, you can run: rar t arcname.part1.rev 2. Previously "Synchronize archive contents" mode (-as switch) aborted if some of archiving directories could not be read. Now RAR continues performing the operation and preserves archived files matching unreadable directories. 3. If -iver switch is specified, RAR displays the version number and quits. You can run just "RAR -iver". 4. If -p switch is used without optional parameter, a password can be also set with file redirection or pipe. For example: rar -p myarc.rar myfiles < psw.txt 5. RAR treats 'arcname.partN' as 'arcname.partN.rar' if 'arcname.partN' does not exist and 'arcname.part#.rar' exists. For example, it is allowed to run: RAR x arcname.part01 to start extraction from arcname.part01.rar 6. Maximum comment length for RAR archives is increased from 64 to 256 KB. 7. Switch -scul can be used to process big endian UTF-16 list files as well, provided that they have a correct byte order mark. Previously it allowed only little endian file lists. Version 5.30 1. Directory wildcards are allowed in RAR command line in file names to archive. For example: rar a backup c:\backup\2015*\* Recursion is enabled automatically for such directory wildcards even if -r switch is not specified. 2. New 'R' object for -sc switch defines encoding of console RAR messages sent to redirected files and pipes. For example: rar lb -scur data > list.txt will produce Unicode list.txt with archived file names. 3. Console RAR "l" and "v" commands display file time in YYYY-MM-DD format. 4. "Test" command also verifies contents of NTFS alternate data streams in RAR 3.x - 5.x archives. Previously their contents was checked only during extraction command. 5. Bugs fixed: a) console RAR crashed instead of displaying an overwrite prompt when attempting to add files to already existing volumes; b) console RAR "lt" command did not display seconds in file timestamp. Version 5.21 1. While previous versions could produce RAR5 volumes of slightly smaller than requested size sometimes, such situation is less likely now. In most cases volume size equals to specified by user. 2. Now by default RAR skips symbolic links with absolute paths in link target when extracting. You can enable creating such links with -ola switch. Such links pointing to directories outside of extraction destination directory can present a security risk. Enable their extraction only if you are sure that archive contents is safe, such as your own backup. Version 5.20 1. RAR can read the default set of switches from .rarrc file stored in the user's home directory. Previously it was possible to define only the same set of switches for all RAR command with "switches=" string. Now .rarrc also allows to specify separate switch sets for individual RAR commands using the following syntax: switches_= For example: switches_a=-m5 -s switches_x=-o+ 2. File overwrite prompt displays the size and modification time for existing and new files. 3. When archiving from stdin with -si switch, RAR sets the current system time to modification time of archived file. Previous version did not set this time at all. 4. It is possible to use -si and -v switches together. Previous versions did not allow to create volumes when archiving from stdin. Version 5.11 1. Timestamp is set to extracted symlinks. 2. Bugs fixed: a) deleting a file in RAR5 solid archive containing files stored with -ver switch caused such files to lose version information. Version 5.10 1. Switch -ai can be used when creating RAR archive, so predefined values, typical for file and directory, are stored instead of actual attributes. Previously this switch could be used only when extracting. Version 5.00 1. New RAR 5.0 archiving format. You can use -ma command line switch to create RAR 5.0 archives. By default RAR creates archives in 4.x format. 2. Changes in RAR 5.0 compression algorithm: a) maximum compression dictionary size is increased up to 1 GB in 64 bit RAR. 32 bit RAR version can use up to 256 MB dictionary when creating an archive. Both 32 bit and 64 bit versions can unpack archives with any dictionary size, including 1 GB; b) default dictionary size for RAR 5.0 is 32 MB, typically resulting in higher compression ratio and lower speed than RAR 4.x 4 MB. You can use -md switch to change this value; c) -md switch syntax is modified to support larger dictionary sizes. Append 'k', 'm' and 'g' modifiers to specify the size in kilo-, mega- and gigabytes, like -md64m for 64 MB dictionary. If modifiers are not present, megabytes are assumed, so -md64m is equal to -md64; d) RAR 5.0 format includes Intel IA-32 executable and delta compression algorithms, but RAR 4.x text, audio, true color and Itanium algorithms are not supported. These excluded algorithms are not efficient for modern data types and hardware configurations; e) RAR 5.0 decompression can utilize several CPU cores. Though not to same extent as in compression algorithm, it improves the decompression speed on large files with poorly compressible data or when using BLAKE2 checksums. 3. Changes in RAR 5.0 archive format: a) file times are stored as Coordinated Universal Time (UTC) instead of former local time, making file exchange among several time zones more straightforward; b) file names and archive comments use UTF-8 encoding. 4. RAR 5.0 recovery record is based on Reed-Solomon error correction codes. If recovery record size is large enough, 5% and more, the new error correction scheme provides much higher resistance to multiple damages comparing to RAR 4.x recovery record. Smaller record, such as 1 - 2%, or less random damage type would result in less difference between 4.x and 5.0. For single continuous damage 4.x and 5.0 efficiency is about the same. Additionally to usual data erasures, the new recovery record is able to detect deletions and insertions of much larger size than in previous RAR versions. Maximum insertion size is several megabytes. Maximum deletion size depends on the damage type and in some cases can be as large as the recovery record size. Still, the best recovery performance and efficiency is achieved if no deletions and insertions are present, so all data including damaged sectors preserve their original positions. Thus, if you use some special software to copy an archive from damaged media, it is better to choose the mode, when damaged sectors are filled by zeroes or any other data instead of cutting them out completely from resulting file. RAR 5.0 recovery record is more resistant to damage of recovery record itself and can utilize a partially corrupt recovery record data. Note, though, that "Repair" command does not fix broken blocks in recovery record. Only file data are corrected. After successful archive repair, you may need to create a new recovery record for saved files. New recovery record is not based on 512 byte sectors anymore and incorporates more complicated data structures. So it is impossible to specify its size in sectors. For RAR 5.0 archives the parameter of -rr[N] switch and rr[N] command is always treated as a percent of archive size regardless of presence of % character. Typically N% recovery record can repair up to N% of continuously damaged data and increases the archive size by only slightly more than N%. Ability to fix multiple damages is proportional to N. We used "Screaming Fast Galois Field Arithmetic Using Intel SIMD Instructions" paper by James S. Plank, Kevin M. Greenan and Ethan L. Miller to improve Reed-Solomon coding performance. Also we are grateful to Artem Drobanov and Bulat Ziganshin for samples and ideas allowed to make Reed-Solomon coding more efficient. 5. "Test" command verifies validity of RAR 5.0 recovery record. Recovery record is tested after processing all archived files. If corrupt archive contains the recovery record, it might be possible to repair it even if recovery record validity test is failed. "Repair" command attempts to utilize even a partially damaged recovery record. So treat the negative recovery record test result as a reason to re-create the archive if original files are still available, but not as a reason to avoid "Repair" command. 6. Changes in RAR 5.0 encryption algorithm: a) encryption algorithm is changed from AES-128 to AES-256 in CBC mode. Key derivation function is based on PBKDF2 using HMAC-SHA256; b) special password verification value allows to detect most of wrong passwords without necessity to unpack the entire file; c) if archive headers are not encrypted ("Encrypt file names" option is off), file checksums for encrypted RAR 5.0 files are modified using a special password dependent algorithm, to make impossible guessing file contents based on checksums. Do not expect such encrypted file checksums to match usual CRC32 and BLAKE2 values. 7. Switch -htb allows to utilize 256 bit length BLAKE2sp hash ( https://blake2.net ) instead of 32 bit CRC32 as a file checksum. While producing slightly larger archives, BLAKE2 can be used for file contents identification. If two files have the same BLAKE2 value, it practically guarantees that file contents is the same. BLAKE2 error detection property is also stronger than in much shorter CRC32. 8. Features removed: a) authenticity verification feature did not provide the required level of reliability and was removed; b) switch -en (do not add "end of archive" block) is not supported by RAR 5.0 archives, which always have the end of archive block. This block helps RAR to safely skip external data like digital signatures appended to archive; c) old style extension based arcname.rNN volume names are not supported by RAR 5.0 archives, which use only arcname.partN.rar volume names; d) file comments are not supported anymore both in RAR 4.x and RAR 5.0 archives. Console RAR 'cf' command is removed. It does not affect the archive comment support, which is present in both versions of archive format and is not planned for removal. 9. Switch -oh stores hard links as link instead of file. It is available only for RAR 5.0 archive format. 10. Changes in recovery volume processing in RAR 5.0 archive format: a) maximum number of RAR+REV volumes in RAR 5.0 format is 65535 instead of 255; b) recovery volume operations are faster than in RAR 4.x; c) additionally to recovery data, RAR 5.0 REV files also store service information such as checksums of protected RAR files. So they are slightly larger than RAR volumes which they protect. If you plan to copy individual RAR and REV files to some removable media, you need to take it into account and specify RAR volume size by a few kilobytes smaller than media size. 11. Command line RAR returns the exit code 11 if it can detect that user entered a wrong password. This code can be returned only for RAR 5.0 archives. It is impossible to distinguish a wrong password and data damage for RAR 4.x archives. 12. 'v' and 'l' commands display archived file names in the end of line, not in that beginning as before. Also some fields previously available in 'l' and 'v' output are now shown only by 'lt' and 'vt'. 'vt' and 'lt' commands provide the detailed multiline information for every archived file. 'vta' and 'lta' also include service headers into list. 13. UTF-16 little endian encoding is used in RAR log file rar.log, so Unicode file names are stored in the log correctly. You can use -scg switch to change the default log file encoding, such as -scag for native single byte encoding. 14. Command line 'r' (repair) command can include an optional destpath\ parameter defining the destination folder for repaired archive: rar r archive.rar destpath\ Version 4.20 1. Changes in RAR compression: a) Multithreaded RAR compression is enabled by default. You can disable it with -mt1 switch. Comparing to RAR 4.11, some speed gain is possible in single processor mode as well. Speed gain depends on data type and average file size. Several cores are utilized more efficiently when compressing large files. b) we had to increase memory requirements to achieve higher compression speed. General RAR compression algorithm allocates about 120 MB comparing to 40 MB in RAR 4.11; c) RAR text compression algorithm cannot utilize several CPU cores efficiently, so its performance in multiprocessor environment is much lower than for general algorithm. Also its decompression speed is much lower than in general algorithm regardless of CPU number. So we decided to disable the text algorithm by default. If you need maximum possible compression ratio for plain text data regardless of speed, you can enable the text compression with -mct switch. 2. RAR general decompression algorithm speed is slightly improved, though not to same extent as RAR compression. RAR decompression is not able to use several processor cores, so its performance does not depend on a number of cores. Version 4.11 1. Bugs fixed: a) if -x*\somedir\* exclusion mask was specified when archiving and if name of current directory contained 'somedir', RAR could exclude all files and stop creating an archive. Version 4.10 1. Modifications of switch -ag behavior: a) -ag can be used with all RAR commands, not just with archiving only; b) 'N' format character behavior differs in archiving and non-archiving operations. When archiving, it is incremented until the first unused name is found. In non-archiving operations like extracting it selects the existing archive preceding the first unused name; c) 'I' format character allows to specify minutes regardless of presence and position of 'H' (hours) in format string. It can be used instead of 'M' (minutes), when you wish to place minutes before hours or do not need hours at all. 2. New -log[fmt][=name] switch allows to write archive and file names to log file in archiving, extracting, deleting and listing commands. This switch is especially useful, when you need to further process an archive created with -ag or -v switches, because -log provides the archive name generated by RAR. 3. New -@[+] switch allows to process all parameters starting from '@' character either as file names (-@) or as file lists (-@+). 4. Volume size in -v switch can be specified as a decimal fraction. Dot (.) is used as the decimal mark. For example, -v1.5g means 1.5 gigabytes. Version 4.01 1. Bugs fixed: a) "Repair" command failed to properly reconstruct structure of RAR archives, which contained at least one file with packed size exceeding 4 GB. This bug did not affect the recovery record based repair. It happened only if recovery record was not found and RAR performed reconstruction of archive structure; b) RAR could crash when creating a new archive with -agNNNN switch if archive number in generated name was very large, like a thousand or more. Version 4.00 1. RAR decompression speed is improved. Depending on data type, decompression can be up to 30% faster than in previous versions. Both the general RAR algorithm and most of special RAR multimedia methods benefit from this improvement. The only module of RAR algorithm, which is not affected, is "Text compression" method. 2. Changes in -x switch syntax. Now you can specify a wildcard exclusion mask for folders. Such mask must have the trailing '\' character, like -x*tmp*\ or -x*\temp\ 3. Recovery volume processing involves less disk seek operations resulting in higher performance. 4. New error code 10 ("no files") is added to list of error codes. This new code can be returned by archive, extract, delete and repair commands. It means that RAR did not find any files matched the specified file or archive mask. rar/makefile0000644000175000017500000000065413143334065010655 0ustar zz################################################################### # Installing RAR executables, configuration files and SFX modules # # to appropriate directories # ################################################################### PREFIX=/usr/local install: mkdir -p $(PREFIX)/bin mkdir -p $(PREFIX)/lib cp rar unrar $(PREFIX)/bin cp rarfiles.lst /etc cp default.sfx $(PREFIX)/librar/rar0000755000175000017500000204172013143334065007670 0ustar zzELF>0@@<@8 @@@@@@88@8@@@** --h-hh h ..h.hTT@T@DDPtd!!G!G$$QtdRtd--h-h00/lib64/ld-linux-x86-64.so.2GNUGNU. Q]%Jj T tȁ Ҝc)fUa&x ?9BhxIkB7vQD$/8n4  bi{]&aPr?XS,3;FiYB_ n-{eWuHGCg_Xa}Z2Pho9z p  J!@;hX! 1h?1h@1hA2hB2hC2hD2hE 2hF(2hG02hH82hI@2hH2hJP2hKX2hL`2hMh2hNp2hOx2hP2hQ2hR2hS2hT2hU2hV2hW2hX2hY2hZ2h[2h\2h]2h^2h_2h`3ha3hb3hc3hd 3he(3hf03hg83hh@3hiH3hjP3hkX3hl`3hmh3hnp3hox3hp3hq3hr3hs3ht3hu3hv3h3hw3hx3hy3hz3h{3h|3h}3h~3h4h4h4h4h 4h(4h04h84hHZ H5z(%|(@%z(h%r(h%j(h%b(h%Z(h%R(h%J(h%B(hp%:(h`%2(h P%*(h @%"(h 0%(h %(h % (h%(h%(h%(h%(h%(h%(h%(h%(h%(hp%(h`%(hP%(h@%(h0%(h %(h%(h%(h%z(h %r(h!%j(h"%b(h#%Z(h$%R(h%%J(h&%B(h'p%:(h(`%2(h)P%*(h*@%"(h+0%(h, %(h-% (h.%(h/%(h0%(h1%(h2%(h3%(h4%(h5%(h6%(h7p%(h8`%(h9P%(h:@%(h;0%(h< %(h=%(h>%(h?%z(h@%r(hA%j(hB%b(hC%Z(hD%R(hE%J(hF%B(hGp%:(hH`%2(hIP%*(hJ@%"(hK0%(hL %(hM% (hN%(hO%(hP%(hQ%(hR%(hS%(hT%(hU%(hV%(hWp%(hX`%(hYP%(hZ@%(h[0%(h\ %(h]%(h^%(h_%z(h`%r(ha%j(hb%b(hc%Z(hd%R(he%J(hf%B(hgp%:(hh`%2(hiP%*(hj@%"(hk0%(hl %(hm% (hn%(ho%(hp%(hq%(hr%(hs%(ht%(hu%(hv%(hwp%(hx`%(hyP%(hz@%(h{0%(h| %(h}%(h~%(h%z(h%r(h%j(h%b(h%Z(h%R(h%J(h%B(hp1I^HHPTI00FH/FH`4@HH'HtHÐUHSH= (uK.hH (H-hHHH9s$fDHH} (-hHo (H9r[ (H[fff.H=@'UHtHt.hÐfGGGGGHG HG(HG0HG8fDLd$L H\$Hl$HHHL CHHLHǃ Hǃ( Hǃ0 Hǃ8 ƃ@ =H( LH( HtH H ?HHl$H$Ld$HÐSHH @Hx C1辗HǃH HǃX HǃP ƃ ƃ ƃ Cǃ ƃ ƃ ƃ ƃ ǃ ƃ ƃ Hǃ!ƃ!ƃ !ƃ ƃ ƃ !ǃ!ƃAƃA[ÐSHH?Ht ?HHCHC[ÐH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^HHIH3HtUHSHHsH;%H;L#HkH\$Hl$Ld$ H(H;HHIt]L#Hk@0F1@hM@hKHCHsA@hHD$KHD$M@hK뗐H9wr HwDH+wATAUHBGSGr9@hJ1>I)HH1HDH!@uH-H%HD1Hu!<',8H9(H88u 8H߈(HH(IlHhH`HGTHFHH(F<HFH,`h2J[]((A\HIIItR@h6HAHIH!FHHIH(FHH(c@h9H@hGT;0@hGHHHIHFI~HIHG2HhHHIHHIHSHH?Ht4{ u[XHsH"H;[:f.[ÐH\$Ld$HHl$Ll$H(Ho(H;oIr(1HtHH\$Hl$Ld$Ll$ H(ÐL,L/LHDMHC(tM,$@HHt$rHD$HH\$Hl$H(HHt$HB1tHt$HH* H\$Hl$ H(fDAUATIUHSHHHHwHW(HT8HHHC(ALHHZAt:EyHHtHJHT0HHS(H[]A\A]D1@HG(ÐfDATAUHSHHHHwHW(HT8HHHC(Ht$Ht*Ht Ht$HtEtAHyuʸHHtHJHT0HHS(H[]A\fH뽐HHwHW(HT8HHÐfff.HHtHPHD0HHG(fffff.SHG(H/C0Hǃ[Ðf.SHHHGHGHGG HG(C0Hǃ[H\$Hl$pGLd$HHHHLgHDHHpHJ<H;H0C0Hl$H$Ld$HÐH\$Hl$HLd$HHHIHHH$HD$HD$HD$D$ 1HT$H4$LtH9I{S1L@htL9wEH{fDL1@h1CH\$Hl$Ld$Ll$ Lt$(L|$0H8M~HHLx P(L)1HHAfDHH=谽HcH{'@1fofDHt>HfHG1!Hfff.H\$Ld$HLl$L|$E1Hl$Lt$HHIILs LLHvu.{ǃ t{uyKt:HS Hֿ@hH\$Hl$ Ld$(Ll$0Lt$8L|$@HH@L@hLt$6HT$uHP(IZf1MtE1fDHK471HP LLL)HHHGDIM9wAffffff.HHD$Ht$PD$HÐfff.H@t$ Ht$ HÐfSHHP(H{Hڽ[ÐfHGfDfffff.Hl$Ld$HH\$Ll$HXdH%(H$(1HItH>E1Ht H}AńEtrH\$ HPHHH$<HSZ/DHH HHD$H Hiʚ;H)Ѻ?HL$HT$1HH޿0H$(dH3%(H$8H$@L$HL$PHXÐH\$ H螤EuUH$HD$?L0LHD$sHSZ/DHH HH Hiʚ;H)HB脽HHH$0ʚ;1HHT$뗐fffff.H GfDSHHHwHHt$XHHĐ[fffff.H\$Hl$HLd$HHP(HH1HP HHP(IHHH1P LH$Hl$Ld$HIHH1HP LؾSHHHtH|$HcLHIEt6EtHT$f.I)MH|$.HHL[]A\A]A^A_H|$HHSHH?Ht,{ u[ȷHsH;[鮷fD[ÐH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^HFHIH3HtUHSHHsH;jH;L#HkH\$Hl$Ld$ H(H;HeHIt]L#Hk@0F1@h@hE HCHsA@hHD$! HD$M@h 뗐USӺHHdH%(H$1ß@HE1u袸8H$dH3%(u H[]贸@AWE1AVAUAATIUSH H?LE11AHL)HHItuI9spLLHE1袵Hu= 4FAUHH1h4F>GH1OH}YEtH D[]A\A]A^A_L08uѺLSAff.Hh1ffff.SH(H$p HdH%(H$x(1HHН$p QXFH$ HE1uH$ H$ H$x(dH3%(u HĀ([踶HHdH%(H$1I1H߷H$dH3%(uHZf.SHHP@t|H$@ H$@ H/Ht$H$@ 1HDŽ$ HDŽ$( HDŽ$0 H$@ D$ƿD$HP@[HHP@[H$@ H菿H@Átt øf.HH$dH%(H$1ԛH$Hut$H$@wH$dH3%(uHĨǴHdH%(H$1HtHDHH$dH3%(uHWHH$dH%(H$1H$H1DD$H$dH3%(uHĨ@SHHdH%(H$1vH<H$dH3%(u H[膳fDAWAVIAUATIUSHĮH$IHDŽ$H${HHHCxqZ| AHHZ| 1HHKHD$iP))tZH|$Ht$ 衭LtB+H|$ EAp4F2$21HH|$ LL9rE1HL[]A\A]A^A_fffff.SHHH$dH%(H$1HHH$HH$dH3%(u H[f.AU2IATUHHHSH24FH趮Ld$HHt,.LH{2HHkHuHLH[]A\A]fDHHdH%(H$1ٗHH$dH3%(uHfff.HHdH%(H$1yH1H$dH3%(uH茰fff.SHH HtH¸uHnH [DSHH@`H$0 H$@@GHNH$@@H$0 HDŽ$ HDŽ$ HDŽ$ DH$0 1H^t:H4FHHBtξ4FH1t1fH$0 ^H@`[H$0 HCH蛱ff.H\$Hl$HLd$HHAI\HHQHH1t(H$AH$AL$AHĘAfDLHhtH$0 HH$0 Hu&1HlH$0 _zf.LHtƋ$8 H$@#x$8 H$`@xH$`@H9$@vH$h@H9$@`HHH$0 H$Hffffff.UHSHpH$HpL$PpL$Xpt@)$`p)$pp)$p)$p)$p)$p)$p)$pdH%(H$(p1H$qH$0H׺DŽ$@DŽ$@0H$@H$0pH$@L$@L$0  HѨuH$ @0HHcHڋ H!%tHHDHJHDHH)H$(pdH3%(unHp[]t$H$ @0HH|HpH$ @HH (HH$ @Hګf.AWAVAUATIUSLHHdH%(H$81HHt$H$DL$$P(HD$(HH\$H9D$$D$$uI$11LP H$HDŽ$HDŽ$HDŽ$HDŽ$Ƅ$)H$HH$HH$HH$HT$$D$$E1E1IT$D$ dD$ ǛH|$tH$H$HIH<$tH$H$HIHH)L9HEL9t HHNI$H$LPt`HcIIAuT$XHL$LLH LHt$Lƿ&fD$$H|$tH$LHT$H<$tHH$H$}IH$H$HH$HBH$$HBH$,HBH$FH$FH$I$1Ht$(LP H$8dH3%(HH[]A\A]A^A_H|$0DŽ$DŽ$DŽ$>AH|$0DŽ$DŽ$DŽ$LqHD$HI$L1Ht$(P H蛪FH$HFH$EH$HHffffff.ATIUSH0AH$ H$ LH$ H$AHHDŽ$AHDŽ$AHDŽ$AHDŽ$AƄ$ AH$A1zH~+1H$AH$ HH9|H$ H$ 11 H$ H$ H$AEHLt Hu*LH$ H0A[]A\fH$AHH$ \HĨH搐SHH?Ht,{ u[鈣HsH;[nfD[ÐHx|$hHD$`t$@D$dHxÐAWIAVIAUMATUHSHHMD$XL$Ld$PD$t AHtTE1HMALLHL&t2uľ@hHuf|$EAHt/DHHtmH[]A\A]A^A_fH߾SHH[]A\A]A^A_D1H<$tH$H[]A\A]A^A_fH߾HHH[]DA\A]A^A_wAVIAUATIUSH ֟LHHHIHDIM)I@@BtgH|$ EA4F1Hl$\$L$$輞H|$ RuHt$ LLH []A\A]A^H 1[]A\A]A^ÐSHH;HHt$觓tHD$H[HXH[fH\$HH;Hl$Ld$HHA舛tH$Hl$Ld$HÐDHHHl$H$Ld$H H\$Hl$HLd$H(H;HL$HIÜtD$H\$Hl$Ld$ H(LHHƇT@HHHD@ Ðf.Hu 1tHw @hzHH\$Hl$HH:H_ HHHSH߾4FH߾HHH\$Hl$HfDH\$Hl$HHHHH+xuH1HP HxuHHHl$H\$Hff.1Ht?RtfHvWEtIHvS1auruڀ!uԀu΀uWtt1~u^u1Ð@SHHHH H9:rH[f~Ht$SHt$uHH H:H[fDHt HH:HLJ:@HH1H@ fffff.tHH؃HHpHHEHH9HLJfDH)HÐfff.tHH؃HHpHHEÐ@:::Ðfff.St@tK1t8@u2tuu$H_ ,H3SH޿.&S[fDHw + S@hk[@Hw *R[Hw ,R[ÐfUSHH:H7FtH:HtHH諚H:HtHPH]H8uQH;H8H$ ͭHH[]_HHTH輠HH$ 蝭HH8\HH;{HH8uHHfDSHH[Ιfffff.H\$HLt$L$ Hl$Ld$Ll$L|$H8HH7FL譪L8L~L;Hǃ:LHHǃ8uHǃ@uHǃHuHǃPuƃXuHǃ`uHǃhuHǃpuHǃHǃHǃHǃƃHǃHǃȸHǃиHǃ:Hǃ:ǃ:ǃ:ǃ::tΞHIHHTH:ǃHHTƃƃƃC1ƃHHƃƃƃHǃHǃ:ƃƃƃƃǃ:HǃHǃHHǃ:ǃ:Hǃ8Hǃ@HǃHHǃPǃHǃHǃHǃH ǃ ƃƃƃ:ƃxTHl$H\$Ld$Ll$ Lt$(L|$0H8HHH0LH襖HiH8u]LLLHHH@AWHP MAVAUATUHH HX SHH|$PHt$0Hl$HD$ HD$@T$L$(DD$8D$HH|$P1Af$H}H$HA$A u|$AtnD$EtGDQAA~1)DDH|$PADٍ AfD $$AwDAHHl\%H|$PL$I $IfɈPthH|$PH[]A\A]A^A_@$HEAA H|$PD$EEfDL萞H|$PH1HٚH\$Hl$HLd$Lt$HL|$Ll$L~ HHALe H$`LL$H$@LܸH$@H$`觮L$H$ LE1H|$LH|$5F=H|$.HtIHt$Ht8H$ HH$ HDH$H$ L$(L$0L$8L$@HHDE1A9uA{ 膶u} zuHA}DH$ LHJ@h @h7BfUHSHHhHdH%(HD$X1H( HHIH<Ht$@H Ht$@HHJH( H HJHHD$XdH3%(uHh[]HHH=fff.ATIUSH1HHPdH%(HD$H1HHHH$HD$HD$HD$D$ 袛H4$HH3HHHH=Ht$0 H Ht$0HLIH4$HLIHHD$HdH3%(u HP[]A\HHHCfH\$Ld$HLl$Hl$ILt$HhIH"H1AH@ƉBEAEAEQAuhBAAtCHLHLIHH\$@Hl$HLd$PLl$XLt$`HhLALUH!%tHDHUHDHL)HHLHwB?LBLUH!%tHDHUHDHL)H/HLHACHHHH^fffff.H\$Ld$HLl$Hl$Hx IHIdH%(H$H 1!H!HAHwHl$@H! HN}HH!%tHDHSHDHH)HHHHLHL?HH$H dH3%(u(H$X H$` L$h L$p Hx בHHlH@H\$Hl$HLd$HXIHjHHc1HYHOHHLHH\$@Hl$HLd$PHXHHH肓fAW1EAVIAUAATUSHHxHt$:tHH wA:HD$P1tHP 7A:E1HD$XtHX Hl$PLd$`Hu H|$XH|$H|$bHHL$XӃD HЃ IЃ EH|$HLd$XL|$ht'Et9H HSZ/DH|$HHH )M9t$I,$IHtEuH|$HM9u܃t H\$PHSZ/DH3Hu4HL9uHT$Ht$LH|$?Hx[]A\A]A^A_HH|$H HHH Hiʚ;H)fE HHSZ/DH HHH Hiʚ;H9u@HH HHH Hiʚ;H9u#LH HHH Hiʚ;I9fM M1H$@ EHD1H|$ E H$@ H$(dH3%( H$(H$)L$)L$)L$)L$ )H()@2H$(覜H$(H:L$ HD$L$(LTHD$TH0L$љEL$p ADEƃTRǃTar!fǃTƃTǃTuHTHH;HHtH8MIE}EEtEH$@ DeuH$@ H$@ A1H$@ EHD12E *f.HDŽ$ HDŽ$ D$/MHDŽ$ HDŽ$ Ƅ$ |$/Lt}EEDž tE tM tMU12vƒ2DeAA Ā H!HvfHAH9rD@ DE !tM !t |$/Ox  t E H$ HD$ x :H:vHH ht4HH 臰HHSZ/DH HH Hiʚ;H9/ AHE H|$@HHD$8藜 !A_H( 9H$ HHD$0tMuH$@ uH$@ H|$0tHt$0H$@ Hp H` H$@ V H$@ Hp Hh H$@ (uH$@ xE_ t| H$@ H$@ D? !H$@ @@u@|$/t Ht$@H9L$ H|$@LnMA$I!%tH$@ DIT$LDIM)LH$@ LLH|$0|$/1H$ EH$@ HD(TAljE H:D@E~Euy|$.ur|$/uH|$8 5F̄tXH$ tM|$/@xTH$(LH$ 1H;EHEDo@H|$ fqHTMH$@ IEEEEEguH$@ WH$@ 1HH$@ 6uH$@ HLu,LeH$ E1ɺMHEHHE$H:Lt$HD$EH0$:H$@ LH$@ LL$ LLLH$(LH$(H$@ FE1|$/:uhH::AHt$ HHE1f.Dž E@@~AH$@ LHHHDHHHT$0H$ H$@ VH$ H$@ L8HHH>DH$(H @HH 蔪H$@ H4Ht$ HHXHt$ HHHt$ HHgHt$ HT$@H?f R@H$(HfD|$/HxFHU5DH$@ @Ht$ HH HEtLHڃLLzHLEAIHH` DkxTD} E1:Aj~H|$ H/H$@ "HʀH|$ H HfDH\$Hl$؉Ld$Ll$HLt$L|$HIdH%(H$H1IAtzDH$@ GtEu vcH$@ ^H$HdH3%( H$HH$HL$HL$IL$IL$IHI$p7FZfDHDD$ P(DD$ HH8MIE݀{C{CtC@{tK{tK{tK{tKH$@ {sH$@ s H$@ {3{{t ADH$@ 1Au닕1H$@ EHD1C zDAMpELztt{CCǃ t Cf 's s s H!1ҸHvHH9r ։s tK !tK  !{ tK!t EaLk Lu4D$;tKHt$@L4Et Ht$@H0L$@H|$@LaMAUI!%tDIULDIM)EH$ HDŽ$ HDŽ$ HDŽ$ HDŽ$ Ƅ$ Ll$0D$<HD$(H` sH$@ CisH$@ s H$@ sH$@  H$@ 1 !H$@ @H !C| H$@ 1HH tHH qH$@ sH$@ sH$@ 0@Ht$0H$@ sH$@ GC t2d H$@ . H$@ H$@ LLE#|$;0ClE1H$@ EHD1<H|$(C f.HTMH$@ sIECsƒE‰€E‰€ʀE‰ƒ@E‰ƒE‰ƒEC"sH$@ s H$@ sH$@ sH$@ 1@EƅTRDžTar!fDžTDžTHTHfxH:L$ LE1ɺMLHD$H0HD$$KLH苴L$p fDK||$;Ll$0D$<PH$ ::D:HHIHDŽ$ HDŽ$ HDŽ$ HDŽ$ Ƅ$ HD$(H$ KAELHPfDh H$@ @sW@sDsDsDH( HH H$@ \sH$@ PsH$@ xH H$@ CsHH nH$ H$ H$@ ;fDl H$@ C@EHxzHU|H$@ 1HcT$H迆HD$`D$dD$h@hH:ƀ5Hp[fff.SHHH:tt H[HH[:HHt$K:H:Ht$fDv=9Q'SH$vu%4UuCtWQ'%$4U[ftvujP'%4U[DP'%4U[P'%4U[KljP'K]@P'%A4U[Ðf !tzV tSHF D/tR\tDHt2\u僿u܋ !u_Huf.fDt/ Fof~SFIƆ =H\$Hl$HTHt,TTHl$HH\$HTHl$HH\$HÐfDSHw Hnƃ@h[ǘfDSH藊H;tHs 60[@h鐘H;u[Ð@HHw H -@hHXATHUSHH`HdH%(H$X1_HH9HcHTJHt$PHaH_H_Hǃ:HըHTT1H9HO\$0HH$XdH3%(HH`[]A\f.HcHU1KǃUHc_,UHU_ǃuHHu _H牃u^H牃$U_H^H牃4U^H̀ U^<HD@ 1U^HAw^2U UH`uHǃvƒuuuu,UHxu=pAHHaHt$PHH_Ht$PD,PH[H8UH|$PH,HHSH|$0u#Hǃ:HfDHHxu$UHHHODHHHFfff.H\$Hl$HLd$Ll$ILt$HHdH%(H$1'2E9Hظu L8LrH|$0LHxH|$01qH@tjH:10E1 H!lHBHKL1LE‹H0H|$Ht$L1$~L:LHظƃ9HHLH9x}Ƅ$NHHǃ99HxH$MH9L61ҀJHKHLHE¸H|$0D$(D$(Hs 1H$dH3%(H$H$L$L$L$HÐHw b@hÒ1뉐H|$01m%HHs {@hl1M LD$(%GD$(HH%Mt5L[HHI4$L|Hs 1ƃ9j@H|$0H@HCAWAVAUIATIUSHH HN0dH%(H$ 1HH)H;F8r@H)HF8Hv3H$ M$ L$ HD$fH8ZHu3H$ dH3%(Hĸ []A\A]A^A_f.HS0Hk8H9tH)H9HH,(YAt$HHS8t&FvfHC0Hk8H)Hqy@HuAD$HH$HL$YH$HL$At$FwfHH)HHw$8Ff.HLH$xFI$ H$HYIHYAƄ$BA$AAƄ$AA$AA$AA$AAƄ$AfHXHA$!xXHA$AeXH=Ƅ$L$I$!L*iHYHXHXAH|$0AAƄ$ A8F18I8UHt$0UHHWЉщЃD$ t.0H߉$L$VI$H hL$$ЃD$(t.@H߉$L$VI$P gL$$ЃD$,OF|$ Ft$(L$,"HPV%?=ɚ; I$X k@HVI$| ADŽ$x  HGWfHxVHhVH߃A$ A$ hUA$ I$ HVI$ HVA$ AƄ$ ADŽ$ AƄ$ It$ LcfDHH$HL$UHH$HL$&IID$0@H߉D$tUHH$HL$t$IID$ LHHLD$HD$UHL$Ƅ LD$HUA$CbHUA$C>HTH=I$BHFHHHL$UHL$AƄ BH߉D$TAH=I$ALFHLLD$>ULD$CƄAL$HC0H)HHH߉$SI$X d$I$ HHHD$ TLHTL$LLD$LD$Ht$ L+LD$H$ LH|$LA$ A|$Ht$ 8FAƄ$ rIt$ L'H߉$L$ SI$H HcL$$HRI$X HwcLH߉$L$RI$P HScL$$HNR%?=ɚ;I$P gH"R%?=ɚ;I$H sg8H\$Hl$HLd$Ll$HLt$L|$H H|$01dH%(H$ 1P)HHH9HHH$ HHPtkHC1H|$0wH$ dH3%(HH$ H$ L$ L$ L$ L$ H DL$ H:L$ HD$LTILl$TH01L$HTtH UL{Ld$pfH|$0SHH|$0ƃTFPH|$0|T1QH|$0APHEAtEdAH|$0HctSDH9D$`{H|$0\RH|$0AOPH|$0T?P‰TTD;|TTDT:AE1E1t H|$0OIċTHH贕H,(TLH|$X8F@HHs :ƃ @h蔆Hƃ@hq@T3H|$03OIŋTI9yTHTH9H|TH|$0HTHTHTTTNƃƃǃ1t DEM툃Tt"HTtH:D@EkHH9H\$`AH|TH|$0H8HTH@THMƃWƃUTƃVH|TH|$0HTHTHTTTMH|$0MH|$0TLTHTH|$0NTƃHHUHxHE1H8H|TH|$0HEHTHETEDTƅ !L` LH|$0 L Hh „҈ tIHLh H` H|$0H9HLHp oLE QDžx tH|$0Džx K| H|$0Dž!"LAH|$0ED?2ELH|$0EKT@UDž !!u Dž !UAD$/   !1Ҁ|$/tA@‹ 1҃Ɉ uD H‽ H!AL$H|$0L҃H=LF LKBƄ$Le LLM|$/,5FLy2uƃEHs LoHs HCHs Hƃ1H|$0uJHt$0HLHLHHH%HHWHt$0HLHbH|$0sIHH Z Dž !/L;1HLHLD:HTL%LHD:KH UH|$0H+JL$ H|$0LJL$LaHLH$ LHHL/TH|$0H蓈H;1f.H\$Ld$HHl$Ll$HLt$L|$HX!H|$PE1dH%(H$!1EGHHH9HxHL$HLPtjH1H|$PևH$!dH3 %(HH$(!H$0!L$8!L$@!L$H!L$P!HX!@H:H$ E1M1HHD$HD$H0$>H$AH|$PyJH$ H|$PFH|$PƃT|TfFH|$PzFH|$P@TT]F@TTtXs!u:OH|$PITHL薌ŋTLHu+ D$+|$+HUHxHD1H]1H|THEHTHETEEƒ    |$+ &ƅ 1҉ !@1@@ u HcҨH|$PH!  EH|$PEEH|$PADH|$PEDžx DH|$P| DH|$PD$$rDH|$PEeD0H|$PEuDH|$PAD EDž t*E<  <  Dž fDEDž !<t<N Dž !HH#EHDž!H9 1|$+uEE ! ! A1E1 EEEN,)H|$PIƄHIDL` IAL$Hh MFLLD|$+BƄ4m E HU E HT$@ Ht$@L`:Ht$@HcHHDuAtH H|$PEDt$$HH TE  |$+t HHIH`  H|$PHD9Et"ƃ@hTbH|$P@H,(HFfDH|TH|$PHHTHT>@H|$P.@H|$P@H|$P^@ǃT;@ǃT#@H|TH|$PHHTHT?H|$Pf?H|$P}?H|$P?f1H|TTH8HTHH@T¨VU҈W?H|$P?PH|TH|$PHXHTH`Th>lHH|$P>H|$Pfp>rpf-f9$ň8FHXrH|$PH4H`NH<HhHDpfL`>H|$PPP>THXrH|$PHH`.HHhH$pf,=H|$Pf0=f0f2v fǃ0f=v fǃ20H4H|$P>2H4H|$P>0Ƅ42Ƅ4HXrH|$PHXH`rH`HhHhpfp=H|$Pt<H|$Px<H|$Py<|^HXrH|$PHH`HHhHpf<H|$P/<H|$P<H|$P_<H|$P<f=fvfǃHH|$Pp=ƄH|TH|$PHHTHT;H|$Pz;H|$P;H|$Pf;HH|$P<H HH:VHHP(IHHP(H Hp1HQ AE1HbAEAuH1LHP @<Dž !ƅ `HTC%H|TH|$PHTHTHTTTQ:H|$PfTp:TTу@€u fTTtHE LHHD$@Dm DuA E)AAEDEE~AMcH L'H H|$PL:H|$@]F!'DuH|$@,5F!Lƃ@H|$PJ9H|$PA=9AI !H H KH|$P9LWH|$P8H`uH$HDŽ$D$LHT$0H$HhuHL$8D$, H$HpuD$$H$L$,D|$LAAH|$0Dl$$EtH|$PY8H|$0JH|$0H$GAt$ADŽ$mAE1E)AH|$P7DA $AE9$AdH|$0H$AÉ$HD$$l$,|$$HD$8HD$8HHD$0Dž!Dž!aHs H ƃ1ƅ 1H$;L H!%tDHJHDHM HL)HL$@HI9wgDu E@<t<\Dž ]HT$@Hs RDž 6Dž 'LLD$@H$H)ITAL)?nH HN F HVvBH H:HP(H:HISQ:H ףp= ףLHLLH?J<*HH)H:Q:9C:5;1HH|$PuHoHH1LHP fff.H\$Hl$H1퀿HtHH\$Hl$HfHP(HtHt3uHvHHtHH9H1fHHHHfAVIAULATE1USHH8HHu[H]A\A]A^@:tEIAu F :t HSz뱐LLu[H]A\A]A^D1fff.H\$Hl$HLd$HTt HTu'HHl$H$Ld$]FHHP(HH1HTHP HMHItu :tH1HHP H]FuLH$Hl$Ld$HÐ@ATE1USHHHHuH[]A\f.t :t2IAuHD$ HD$;:tHxH1[]A\ÐHx|$hHD$dH4$HT$D$`OHxÐAWAVIAUIATIUSHHdH%(HD$81lHA1E1C4ASL$T$ L$LH)I9D$ AttvOHT$ HD$ LL$nHHD$ DD#L$HL$ H1L}NASHL$0Ht$LLHD$0Ll$E1CHtHAuAEAMtCD&HT$8dH3%(DuHH[]A\A]A^A_C@AWILAVIAUATUSHHH<$HL$0dH%(HD$81Ht$H|$LHD$0/HtHHH$:I1E1D$f.AM9DH$;O,HD$ HL$ HHLHyD|$uAEI9v+M,D$AAEAM9v1CDHT$8dH3%(HH[]A\A]A^A_@1MtCDfDHD$ HL$ H1HPNƒAM{CVfHHt:ND1Eu"4@4H4@tH4t HH9wfff.HHt8O7ɉt&1ftODODƅ4t HH9wfffff.H@u fDHxHwH=w)HHt?ȀFHfD-=w\DA~ A~7HxU ȃ?ɀ?NȀFHO HA$v$H ?ȀFȃ?ɀ?NȀFHf.t20HHt~HHuHÐ0w:H~~HfDHH@HH{HHAAAAAAAAABDEAA*DGEAA€DWEAAÀA?A?A A?D AHD D Ht Hv*Ht Hv1HHDEAAudA?HD 뀐DEAAuMHT$(:HD$0IHD$8IFHD$@IFHD$HIFHD$PIF HD$XIF(HD$`IF0HD$hIF8HD$pIF@HD$xIFHH$IFPH$IFXH$IF`H$ H蒜LHH$dH3%(H[]A\A]A^A_fDIH\$0HD$0IFHD$8IFHD$@IFHD$HIF HD$PIF(HD$XIF0HD$`IF8HD$hIF@HD$pIFHHD$xIFPH$IFXH$IF`H$*IH$IGH$IGH$IGH$IG H$IG(H$IG0H$IG8H$IG@H$IGHH$IGPH$IGXH$IG`H$H$HD$ CH$HD$LT$̚H$HH H$H$H$gLT$HD$H$KH$I ƇƇƇtCE111D1DDȈEEAE DFHuÐfffff.UHSHHH8HHH¿pffǃffǃEt911Ґ11ffEHuH[]Ð@SHHǃfǃeGfǃ!fǃsfǃR[LJƇƇƇMHt.(HHuÐf.HDf4HHAAfD3AfD)EAAfD1E fE1EEAAE D1fDf0HHf@DLVDF3DDNB3DNB3DNHB3L9։ufff.AUAATUSH(D&^dH%(HD$1HDFDN D3H$HFE1D3A1HD$LED˃AADA D1ȉDFHcD D/AD DD1D1ȍ DFHD D/AD 1A,D13FD3DFD3DN H HD$dH3%(u H([]A\A]AUDE1DNDF ATD&D3D3DUE1S^3fDLEDÃAADA D1ȉDFHcD D/AD DD1D1 DFHD D/AD 1A ,D13[]A\FD3A]DND3DF fff.AUATUHSHHHdH%(H$1HH纀1HHHIǃyHǃm?ǃ5u@Liǃ#社`4hu@a@E1Ht t  f HtE1E1MBD BT D)DDD9tMDHcH42%L΁A9D3D@3uIM9xAATAtULLHI9wAHH9v1I4,HHI9wH$dH3%(uHĘ[]A\A]Muإ@fffD Ð@AWIAVE1AUMATIUHSHHxdH%(H$h1@t$DHHi0HD$H<HT$/HT$MA,HLu}HD$H$P1ɾHLi0J#HP H@H$P1H$XH-J#HP H@H$@H$HA,tfAI0AHt$pLYLML4t IEJD4pIH$E1+fAADHt$pH$L DHt$`H$Dd$`D$aDD$bA?uH$Ht$@H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$ H$H$(H$H$0H$H$8H$DT$PAAH@Ht$ H$蹌D$ Hˆ$P$Q$SD$$$RHi0ˆ$T$U$WD$($VH<;ˆ$X$Y$[D$,$Zˆ$\$]@$_$^w1H?*MHi0҈ ,(Hi0H$P1ɾH$PH H$XHHi0H )H$@H|$pHi0HH$HH$a)t$L$@HHlH3)H$@!)H$hdH3%(uZHx[]A\A]A^A_fIUH EHHrffffff.AWAVAUATULSHHH|$ Ht$(H$PHֺ@L$PdH%(H$1H@LD$0Ll$pHFѹDLt$o3Ht$(H|$ H$PHKL$E1ƄPƄQƄRƄSHD$HD$H$#H$D$XHT$0Ld$PLd$nD$dD$hH$H$AD|$`HT$@Hl$HD$oH$H$D$nHD$8H$H$H$1EH$Ht$(H|$ H$L$L$ Ld$Ll$L4$FH$H$H$H$H$H$H$H$H$H$fD H0HH9uD9RH$HT$0HH$HBH$HBH$HBHD$8H|$8 tHD$8HTD@D|`HT$0H$PD&H$ &H$ %H$ %H$dH3%(uH[]A\A]A^A_%@AWIMAVAUATUHSHD$HT$@dH%(H$1LL$8L$AH$@t$OLE1AAHEMixF95 AAuLt$PILߺLT$LE1&AD$v AH}t*t1AwHMT0TQЉT0D$DL$8T$4t$0D$D$@ɉD$D$L)3[]A\A]A^fHbaHxVaHXJaHH{[] HH,aHx aHXaH{HHHH@Lt$LXH\$Hl$Ld$HLl$H8HGHGHGHG G(L}`LxLn`LL_`UHHHHHHmHHC@Hǃ@Hǃ0Hǃ8CXCpHǃƃƃƃƃƃƃHǃHǃHǃHǃƃƃHǃ(Hǃ HǃHǃǃHǃHǃǃHǃPHǃHƃHǃHǃƃHl$H\$Ld$ Ll$(Lt$0H8HH{HQHHD$ļHD$HL^L^L^fHHHŐfffff.H\$Hl$HLd$Ll$H(H?IHI$I$t8ILo8HLI|$I|$8HHqI$Ml$8ƀMA|$ptYI;\$xI$(A$t[A$tE111HH H\$Hl$Ld$Ll$ H(!A$uI$HHbI$HH^I$HH赾I$I)\$xUH\$Hl$HHHHH9HHH߾FH>H$H$HfDSHmi+([HH=&谹艺H=&'蔹mH=n&z'xQX'H=N'5L'SHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$'HvSH=&=Į'H$H=&HE= &HHHD$HD$ $D$0HD$PH[SHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$='HtDH=a&LH$H=%&HH$D$0HD$HD$ HD$H[ff.AWAVAUATUHSHhqH$pH$pL$pL$pt@)$p)$p)$q)$q)$ q)$0q)$@q)$Pq@hHk1AH$P`HFIHHcL$HcHHHHT0t019T1DFH$p2$pڣHc$@;D0tUH$D1Hc9HcHH4H4;D0t39|1Hx[]A\A]A^A_DHG1ҍBѿDF1$H$p2b$pF1fAWAVAUIATUHSH(HHGAAfDIL9IT$LvwIԃxLxux[uL9v׋8HD$"t9LL4$@Cu HD$8;uH$H;,$v;H\$H"uH([]A\A]A^A_E1AHH|$LL)HIGIIH,Ht$1GDL9wh:F1sS1H萬HHCǃ@ǃDǃ8ǃǃHHǃH/ǃ@ƃHǃ[Ðf.SH1HHxH0H[H0HD$HD$HHl$H0H\$HH(HHǃxHǃHHǃHǃƃHǃHǃH\$Hl$ H(HxHD$HGHD$H:SHH?Ht4{ u[HsHCH;[f.[ÐHP>F?'H1_0(S0(wHÿ>fffff.GGG G G G fffff.GGG G G G fffff.t+~t4t7GDutGÃ?w? tGSHHpHD$`D$dD$hH߾{Hp[Ð@H@@wt#`}At`}AHaQH>fffff.H\$Hl$HHuu=H\$Hl$HÃu%H׭1҉`1FHVt׿>F>FH1뼐fDH\$Hl$HH1fHHl$H\$HNfffff.SHH߾[HǬHS踬[@SHH߾[@H脬8uHfDHtHHH1<`H@S Hu HH߾[fDH\$Hl$1Ld$H HHAtH$Hl$Ld$Hf;AH/uC ɐ@H\$Hl$1H HHtH\$Hl$HDHuC Hl$H\$Hfff.S Hu HH߾[fDSHHH$0H$8L$@L$Ht@)$P)$`)$p)$)$)$)$)$H$L$IHH$H$ DŽ$DŽ$0H$虦H<^HH[Ðf.H@hHofffff.SHH߾[D@SH rH:H߾[fff.SHH߾[iSH "HH߾[fff.H1fDSHH߾[ SH HH߾ [lfff.H1fDSHHJH߾[,fff.H1fDSHH߾[iHx|$hHD$dH4$D$`<HxÐHx|$hHD$dH4$HT$D$`HxÐHH?Htfffff.SH?Ht[@֣H[ÐS1Hv{HH|>2PHH9u8tH[f.ڿHL$蟼d?F1HL$H t9u9ZuHvh?FfUSHH@tvtJHUHmH߉>HSH߾ $H[]H߾D$D$H[ ]fHHH߾H[]H9tH)H9HFHufH鈥ωDAD DAE FAD ȉѺ )!f.ȉϹ D)AASAA1D DÃAN AA" A9u[Ðf.AWAVAUATUSHHhwz$>FDGDWAG A1EtIE11E9v#D1fDH3σ*>DA9>wAAE9wHh[]A\A]A^A_HDG 1wڃ@19wt9s H@8u F +́iH뺋GLDw LT$D$1|$bT$QALIfExKHDP?FEt3 iT$33 iAT$8D$= i3 iT$23 iT$73 iAT$<D$1 i3 iT$63 iT$;3 iA GLiLa L $ADIcAHHT8HBR3T$0PA3UP3QP 3Q ADT$0D$5Hcҋ iB3 iDT$:B3 i3 iT$4D$9 i3 iT$>3 iT$33 iAT$8D$= i3 iT$23 iT$73 iAT$<D$1 i3 iT$63 iT$;3 iA GD9HHHD8HP@3D$0A3BEAE3BA$3B AD$0!iD$5!iAD$:!iAD$?!iAD$4!iAD$9!iAD$>!iAD$3!iAD$8!iAD$=!iA D$2!iA D$7!iA D$<!iA D$1!iA D$6!iAD$;!iAHcGHHT8HBR1PA1IPA1U@ A1$It4HHH?D$@FD$DFD$HF D$L%HD$ HT$(HHDH$GG AEGA$GHD$XdH3%(u2Hh[]A\A]A^A_L $LiLa HW LoLgH$QAWAVAUATUSHdH%(H$1HH4$u)L$dL3%( HĘ[]A\A]A^A_HGHHHD$`HGHD$h7LD$dLL$hLT$lHT$HG(HWLd$tHl$xH\$|L|$TLt$XLl$\@t$OLD$@LL$8LT$0HD$HT$DWH4$L$L $Ic‹6HHT8t$ HBR1T$PE@PDD$$D1AEIPDL$(D1AH$DH R A1щT$,LEMDD$TT$PDȋ4 i34 iT$Z34 iT$W34 iT$Q iB3 i3 iD$[t$p3 iA$DD$XD$U iB3 iDD$RB3 iEEAMcB3 iEDD$YF iF3 iDL$VF3 iDL$SF3 iEJAD!@McAIM\:A3st$PA3S AA3CAE3CLEEDT$TT$PD4 i34 iT$Z34 iT$W34 iT$Q iB3 i3 iD$[t$p3 iA$DT$XD$U iB3 iDT$RB3 iEAMcB3 iEЉED\$YF iF3 iDT$VF3 iDT$SF3 iADLL$A31t$PA3QAA3AAE3A EET$PLD iT$p@ i iT$qT$ZD$vD$[ i iT$rT$WD$wD$X i iT$sT$T iT$tT$Q iT$uD$xD$UHT$ iD$yD$R iD$zDEH iD${A iIЈD$|D$Y iD$}D$V iD$~D$S iD$23t$pt$pRA3$A$A@3EEE@ D3|$ODuXDL$ LT$@DL$`DL$$E DL$(LT$8E DL$,LT$0E Hl$1QADA tBH$HD3t$`LT$@LL$8t$pA3LT$0A$A3EE3DyHD$`HGHD$hHGfff.ATDgE1U1EL$SHEHD$HFHD$HFHD$HFHD$~tExoD1AQLcICDHcIcAtIA@tt@tt@tTTA9AyA9bEYD9iMc:DBD i2T$T$BD2 i0D$BD i0D$BDT$ i0D$AHt$AHA~GIcAHHDHc0HHLH9tH0HH9uAHE9~VE~o1AJLcIA9~>HcIcAtIA@tt@tt@tLL~AEA9~D9~fHD9[]A\fDHt$AHfIcAHHDHc0HHLH9tH0HH9uAHAt VD$Ht$AH iD$2L$ i0D$D$L$ i0D$D$ i0D$DIcAPHDHc0HHTH9t H0HH9uAHANA9+E0|E0fff.AUATAUSf.Mc1LNHHl8LD$HcLM1IHcEJDIHtF iB2 iDVvB2 i2 iAIuuHD$IAIJD/HD$JD/D9gT[]A\A]Ðfff.USHH(tKMHIHAIPHI9uHH@uHH([]G A1fDH<:ɃA9HL @|wvfDGA fG AHCHC`fff.S1HdH%(H$1$Ƅ$HL$Ƅ$6@HcЍ<@ƒHҁ11ЃuV(i0$1Ȉ %H%Hiuۿ iA i11E11A@QHcHc#i"i!i i Aʈ"i!iD i#iD11ʉ1ʀD)Hc AHcDAJhHc "i!i i#i "i !i i #iAHc i#i"i!i i #i "i !iAAHcMc !i i#i"i !i i #i "iB #i"i!i i #i "i !i i}1@At@D)HcHHI AA111D1ىc1ʄ҈!i i#i i#i"i"i!iƀ#iƀ"i1ƀ!iƀ iA1Hcƀ"iƀ!iƀ iƀ#i1"i!i i#iƀ iƀ#iƀ"iƀ!i i#i"i!iƀ!iƀ iƀ#iƀ"i!i i#i"i@H$dH3%(u H[苊f.= (SHu[Ð@SHGuHG[fHC1[HBfuHHt 鬊@fDwwÐfffff.HcHO4DT+O  %ÐH\$Hl$HHHHHt {u(HkCHl$H\$HÐAWAVAUATUSH|$AHHD$D~Dv DnDfx DPHAADHD1!A1E1EyZFA!E1AAFyZE1G:yZAD!AA1AEAB1yZDE1AD!EA1EA͍ DE1B+yZE!E1ˉDAADՉD1G!yZ!D1AAnE1AA!E1DE(yZEA~EAω|$E:yZ1D!A1ADED^ 1D!A1AByZ<9D ~$ω|$č;yZDD1D!AD1ύ<;ߋ^(EyZ\$ЉDL$EE1A!E1DL$Aً^,EyZ\$DDD$AE1A!E1DD$A؋^0ˉ\$EyZ1D!A1AEAF^4ˉ\$؍yZD1D!A1D ^8ˍyZ\$܉|$DD1D!AD1|$ߋ^<EyZ\$DL$EE1A!E1D1DL$D13T$D13D$3D$E1D3|$AD3|$AyZAE1A!AE1EyZFDA؉1D!A1B9yZAEAFD1D!A1DE1D3t$ԍ DA1D1D3l$D3d$D!AD3d$A1D1D1A3l$B7yZA1AE1G)nAD1<;DD1G n1AAAF D1E*n1AEAF1D1AAEAF\$3\$3\$D3\$D1A1E1㍌nAÉL$D1BnD1L$AL$DL$ȋL$L$ȉ|$DD1D1|$A|$|$ȋ|$|$DT$DT$D3T$A1A1AGnDL$DL$E1A1DL$DL$AADL$DL$DL$ĉL$DL$DL$D3L$E1A1ACnDD$D3D$A1FL$ĉ|$A DD$D3D$ԉL$ЋL$E1E1ABnL$3L$3L$č |$<9L$3L$̉|$ԋ|$D1D1щ|$ċ|$L$nL$3L$3L$Ѝ<9L$ϋL$3L$؉|$̋|$D1D1ɉ|$L$|$nL$ԉ|$ȋ|$3|$3|$ԉL$|$ȋL$ĉ|$؋|$|$؉|$؋|$11D1D1D1lj|$܍9n|$3|$3|$ϋL$|$ċ|$1D1|$1D1Љ|$ċ|$|$̋|$1|$L$n|$ȋ|$3|$3|$|$ȉ|$Ћ|$3T$L$3D$|$‰L$|$Ћ|$ԍn|$ȋ|$13|$ċL$|$L$ĉ|$ԋ|$|$ԉ|$ԋ|$̍n|$ȋ|$13|$E1|$E1D3|$L$E1A1E1A1։|$̋|$AAƉL$|$̉|$̋|$B?n|$ȋ|$13|$|$ȉ|$؋|$̋L$D3l$|$A1ʼnL$Aʼn|$؋|$B7n|$ȋ|$13|$̋L$|$L$̉|$ċ|$|$ĉ|$ȋ|$B/n|$Ћ|$13|$؋L$|$Љ|$ċ|$|$A1D3d$D1݉L$D1E1ˉ|$|$E1AB'n|$Ћ|$13|$|$Љ|$ċ|$L$|$ĉl$L$ȋL$̋l$3l$؉|$ԋ|$1|$3l$D1t$D$ċ|$č9n|$͋L$|$L$L$1D1É\$Ѝn\$3\$3\$ˋL$č<;\$ԉ|$؋|$A1E1E1A1AA1D\$BܼAA D#\$A‰|$̉!A |$D\$DT$D3L$L$A|$E1A1ɋL$BܼDT$A|$ȋ|$A A!!A DT$DA<:DT$DL$F ܼDۉ|$DAAD D!! |$ADL$ADD3D$3L$DD$D1t$D11|$DD$D$ȋ|$DL$E E!1B ܼDL$E ܼE!E DL$L$FD݋L$AAD D!D! A<:EADDT$D3T$E1A1DA!DT$GܼEA AE!A ʋL$GAAED\$A1D1A1ˋL$A1ACܼAD\$E AE!A!ًl$E D\$F DAɋL$A1A1ˋL$A1DA D\$BܼEA!D!AD Eˍ A\$DD\$1ڋ\$D1EE!ӉT$EܼDD !D AAЋT$AEAD1D\$E1E11Љ1D!ʋ\$E1߉D$ܼD A1D!Ћ\$ DNjD$D!AA1DAA AG:ܼD!D|$ ADT$D!DE1AAAE AG1ܼA!Dt$A CAADD3l$D3d$D3l$D3d$D3l$A A!E!3l$E A3l$AE1D\$AAB)ܼG ܼD1DADA AA!A!E Aʍ/ܼEAAEA AA!A!E 3\$D3\$3\$ED3\$DAEDEA A!AD1A!E AܼAE1ADABܼDE AE!A!E AADAAF<DT$D3T$D3T$A A1AE!A!BܼE DF DA L$DL$DD3L$!Dt$D3L$A1AGܼDD$ED|$A A!A ȋL$DD$A!A DD$D3D$D3D$L$E1ABܼ|$ċ|$ !D |$AAFHIHL$tH>I9H$uHDAX)AEt[E1HEhtNHLLZA}|3EuVDH\$Hl$ Ld$(Ll$0Lt$8L|$@HHDE1H^LHLoZA}&3EtA}_A}_uA}_uAE/AE/@I$ ^LHLZL1L`LLbHUHH @^D8DaHUHDh:yaAEAfDLHLHD$eXHL$tlHUHfA}aZ@AE:}DD`GLL-a7HEB,HL$`HL$tNJHI9HCH DH;u`ut HMfAEN1U11Hvо HT$XHs ED$PD$8BFK7ƅAE1ATAX*E1D$PHL$XHt$0HgD$P|$PD$8aJH$@H,vAHHHHD$06|$g$@|$8LD$0HL$XHS H$ AHNrv1U |$g҃|$gT$8HiH;xuHuHs H$`}4FJ4UH$ VrH$ Hs 8H$ HbHK(Ht$0H|$XHL'RH(fffff.AWAVAUATUSHLH`HwH$`dH%(H$`1葇H$`L_yH$`$Y@Q1퀼$E@$I@L$p@H$`L1" fH$@@$J@LNH$@ 1LHDŽ$P@HDŽ$X@HDŽ$`@.uH`H$`HfDHt1HH)tH$ HXfH0KHC5Hu4It+=w& t"Ata @h-pH8 []ÀVu탸Its?&tP@DF-CH1A`H$ H`HB^H0KHCV DFBH1_qDFBH1_XAWHAVIAUATUHSHH9L:2HLNLHHE~}ALtkLAAfAw-EH)ALHLHHHH)HxH~uHDH?HHINH)@HHEHP(H)ÀTHt A@u9H HDžH[]A\A]A^A_fDHL)H렐H|u"H먐H eILHHBHxAWAVIAUATIUHSHHT$ HH:ƇD$.HD$/HDŽ$`ƅE1(EF1Lx]TTHHEHH1P E111H赝H _ CI@LHǀ Hǀ( Hǀ0 Hǀ8 Hƀ@ HǀH HǀP HǀX H$H謩H$LELe t3H$`dH$`H~XLe fL1`hjL濋1|$.IH HHEJzH$`LƅƅƅHDžHDžTHDžTH$`VDH;sHxHHpH$` cHH9pH$`bH;pf.E1111H诛t E111ҾH腛HpHvApGt EF >IſPEF>HLL1[|$/tHEHP(HT$ H|$.tmAv Idž` HAƆ AƆ xTt@AvA1LH˚EFq=Iv H1ZH$ƅHtH rHHĸ[]A\A]A^A_ƅƅHƅHpHt Hx1HH9HOHH9rHHHLe L$`1Lf0H9rH$``DFDŽ`;/H$``L/H$``EF/H$`@LH$`@1F6H$`@6H$` HIH$``L[H$` H$`@H$`@H$`AaH H$` |$.H HH` tƆ M$XIx AƆ LHL$ HE1HH1P AvLHE11_Ax LIDŽ$辴f1uLH ףp= ףLpHLI?HL)IHT$@H$`^H='H"`H$0DŽ$DŽ$DŽ$vtL_@hXh$tyH$`ƃM^H='HrHpL9fHH ףp= ףHHH?HH)H9;LpH$`IE1HHD$H$+oLw @hzg$tuƃ{HpH$H$` _$$ƃ H$H$`L^wfDH$H$`L^9%fDH;D$Le H ƅE1L@hgf0H|$0ML$H$`Ht$0IHD$H$mH|$0A_PALe H$`LL9@hfHO @heAv HHsH)HE111ҾH蚔H$`@1F2H$`@|1F1H$``H$`@g*H$`@1FP*HHH%I$I$IL$`HH?HHH)HH?Hx*(40HH$HmH|$0HNfffff.AWAVAUATUHSHH8@:L:L$ T$'D$D$HUHL$HD$&|$&HS HT$HHP(LHHHD$(lT|$ TN,(LHHnMHt$H$0 GH$0 :A$1A$EE1E1AAtmf.H$0 C~HDHt$HPH1Ht$(HP 1H8@[]A\A]A^A_H$0 '[tAHDH$0 HP"Ht HDžPEt$EtkA$t|A$MHt$H|$0$ H|$09HDHt$0HPEAuHt$LBDH$0 SXjfDtHL$y| HL$HD$1HXH HHEHx 訲HS HT$HT$Ht$H ?f.H$0 Y@HxHT$HD$D$& H@HHP(|$ THK HD$(HL$@fD- |$HH;Ht$0H$0 O |$ T|$ XtphFFj2Ht$H1{OHT$1`h]H|$&t$H:|$'H|$HT$ H` HHL$A$HXHDž x {HH:rHSHH1H+xuHP |$'QFFN1H8UH1]NA$T DG1BNDƅ7@t FF|$ EvSHHtH fH[Bf[ÐAWL~ AVAUATIUDSHH+DdH%(H$*1EɈL$kDT$l:Hh HH9CL$@"L$H` H$!${ !DSh7L$@!DL$@!DEAARDDD$(A(OFHD|$ LSDɃ t$DD%L$AA T$CAEɉ$1AAI f H$" GFHHD$`Er|$k`KFHT$X.GFH1KLF1KHT$X0D!L$@!AGFLE1AAI 2 UL$" GFLLT$`HH H$p @ͺ2I5@ LLSF1*J|$kH$p $IF1JLGF1JH$*dH3%( H+[]A\A]A^A_Hh H` =L$"AAGF  L1LT$`fGF-LHƿhOF1$J{2I$HF8 @JF(OF,HFH,HHƿPF1IHt$pLЭ(HF,HT$pHƿPF1I }HH HP 9HX QFA,LHƿPF1OIx p|$l|$lpG|EaH!4FII H=v Iƺ HFI|$lDkdGFDcHRFTGFHT$XHE+HT$XHM1EDxRFH$HH u t3HF^+SFH1oH b - A#h:F1/Hif.L$@"DFLL>FG-fD `JF GFHD*Hŋ!t HF*HHƿPF1G!|$l(HFY*H!HƿPF1cGfDHT$`H$!10TF?GH$p 1$IF+Gx <TF1G2fH$" GFHHD$`@L$@!DFL^JfDҁ@-lD‰$@!AA-tD%EAAtDЃD綃w滃rAD%EAAsDЃDɃ ᶃw҃⻃rA@D%EAAsDL$@!DL$ %|$0t$(L$T$ADD$AOFwAE҉$A1D\$8DT$LDL$LMULArfDMFHT$X!(GFH12EXNF1&EHT$Xg@1SFSFEABAAu APG1DAtCIF1DAYCIF1DBD } TF| 1WDf1L2XSF'HƿSF1!D@DHF&LHƿPF1CQF&H$!HƿPF1CXHF&HT$`HƿPF1C#(RF&HHƿPF1C~H$p HX 2-HF@&H$p HƿPF1IC@H$p HP 2R-HF%H$p HƿPF1C@pHF%H$p HƿPF1BKf | JF1QFBx aC< xH,XFh@ !pGP@KFtGFHE;D%EAASZDD%EAASDBEfD$WFA$uH$"WFHHt$pH JF GFHDPQF\$H(QFJ$HPF8$HPF&$H0PF$Ht@0SF#HFH1Af.HF#HFH1@f| `TF1@fDŽ$@!d/H| HL$p1Ҿ AAB JFu KF8GFHDHT$pPF1^@"fHAHFH15@6HBtGFH1@#H` I$HF` H$"LHHcщL$XPL$X1IHƄ"Mffff.AWAVAUATIUSH"dH%(H$!1D$?TAEt AD$?BH$"D$\AA$VD$8HD$PHD$HHD$@D$7Ht$`LpTA$5H$!L_Ht$`H$!7HT$@1`hLAŻD$0H$!_EƄ$!&H$wDŽ$` D$$HD$E1H$vHD$(H$!*\H$!H|$\uE1E11HLw1ۅtHT$(`hLL$7DL$0AH$!H$!E!H$uH$`D$$HD$L$X=@1E(E|$?L$7H$XH$!H$!E1A`$7t$Etc|$?t\@JFHƺIFPF1<$` t!HFH$` HƿPF19@ǃ@A.HuULcSfD&HcHJHDHtH0HtBtL)4qLcƉFL.HMcFTD9t0AIHcLANLL JTLD)AELLcBL.HHtH2HT[]HH;ƇtLT$H0IILT$LT$LfIIHu>HHHIILP HHHHA HD$fAKfHuIII9tHL$M9uM@M9tAHIf:uDJEA=HB LZDfAHLXHRHB If:uDJED=~M@M9u@LD$M9f.I@ IPEXHPIPAHB ~_AHHH M L fDHHHHH L9uHDH E\+IACHT.HcLA9t<DHcT)A)ˍQGHcB HLLI L HLHHTILDLD$M9 LcIPHDHHHL[]BTH1IL+ RHcI9ekH)HHHHH@@HLJJHLJHHLJXHLJPÐfATH1 USHHHHJHt NtЉ|HpKH;hKHHpKtHHHXH@ pf@f]KLHHcHn HDH1HHTID$H`1ҋ|HHƃ x1HIHHHIDHHHqHDH uE1ADIcEп\F1E)H@A1f@D @McM3@fBD[uHuAAuHSC 1Hcƍ HHD@fH@HH9uH@u[]A\JHhKHkHH;pKHhKH)HHhK+HxKHtHHxK1Hfff.SHƇ tHHƃHƃ@ƃ@@HHt Ht fHtHƃƃƃHؾuHH9uH 1ƃCHH HHHױH[Hƃ@ fH@Hfff.AVAUATUHSH`HHGDH9t5:rHJH H@:@rHB BHJfBHCH9uـ@E1AADCHL\B AfDCrEpA)HAA42@rfs DsH AA)DAfCy@:yv5D)LaHH H0Hp pfpH;Ct@:xwD(@xL`L9uAAHDHBx1DH xtFf)ffDAAA)fDCA9PAHKMcHcF JJIA9tRHcHn LlMIULHTHΉIcHn HTI$LdMLcL`[]A\A]A^Xy?\=iE1ĀDADtAAt$Al$AAA!LD>XLD)ЉXF>X(T A6h6hHXHD$)ʉXCQƒVҍN@VHVHQHD$HL$u?HT$Ht$H>HD$CQƒV҈Vt‰HL$LH(DsfKQfTs$G=$L $=EX$Y9ȃ=MFwA?X)ǃYуH)MtOHHxHKHH)H!  HHxHH!HuH([]A\A]A^A_ÐǃY ^EYt JXDA`7h 7hHfA5h5hHA7h7hHvAAƃAl$A!%fY9ȉOr)XLA`8h 8hfDL$;$hAAƃA!Afff.AVAUATLgUSHHLJXL:X11탻X$`\F1ƃt1\FAHADхt,`\F1ƃu׋XAHADхuԃ4\FL:p LǃX )D9A`8h 8hH=VADD;YDH)MtLHHxEHKHL)H!  HHxHH!HuH[]A\A]A^ \FAHADхt,[F1ƃu׋XAHADхuԃ2L4 \F8XLǃX)ЉX85hHA5hG%HcȃH'TKtHH'tCftKfTCUH)MHxHHKHƒH)H!HHxHH!ȃHuH[]A\A]A^XYfXDH)M;HHxEf.HKHL)H!HHxHH!HuH[]A\A]A^LD$6D$=rDH)MHHxEfHKHL)H!HHxHH!HuC XH[]A\A]A^LǃX>6A7h7hHLAAm6AƾLA5AH)M퉫DHHxAEHKHAL)H!HHxHH!AHuH[]A\A]A^ǃX@AL)MHHHH)HHpHH9 H9LKIIIHvzLHAAENLfD8@9x@yx@yx@yx@yx@yx@yxH@yHL9uJHIABA@BA@BA@ttBA@tgBA@uZBA@tLHxLD2DHKH!H  HHxHH!L9HufDSHHHH9tYƇMsPHKHcH#xH?HHKH;}HƃMH[fDH)HKH;NHH[fffff.Ht HИƇƇLJ̘LJȘ1LJĘ.HHH@u>1HuH Y1;zf.ǂH@0f.AWAVAUATA\USȘIHD$MD̘J7DDИH(L DD$ED+DADEҋؘD$AҋԘAҋAADܘEF@AAAAA)D1D)qD)FAAD1D)DA1A)D),*AAD1D)1))ލAAD1D) 1)D)FAAD1D)DA1A)DD)DAAD1D)1) DA*QADEQ҉Q̘BJ7DAE1Af2D9sAAH uA v []A\A]A^A_EB$`XFHT$A\IH׋̓HT$A\IH׋|HT$\HHИJ xJ mHT$\HHИJ KJ @HT$A\IHИJJHT$A\IHИJJHT$A\IHИJJHT$A\IHИJJHT$\HH׋ИhИZHT$\HH׋И:И,fDH\$Hl$1Ld$HwH)xE@LcNLHsH;)Hc%~a‰H$Hl$Ld$HÐE1tHHcLcLH47öCfHMHǰFJf.USHH@uJHHLJHLJht 1HHD1AHu#ǂǂ@HǂHAf.AUHATE1USHH,SAŃу ASt;1H+ AċCƒA9CwHD[]A\A]U1SHHO))@~&tHHcHcH47腴CtfH;)HcHsHce~V¸stL9NʉH[]뽃믐fff.H\$Hl$HLd$Ll$H(~HIu;HHAGHHAD$71=@HBAT$@* HA$ *A<$u H* H߃AD$ )DH\$Hl$Ld$Ll$ H(f;E1Xfffff.AU1ATAUHSHHHs GGUAA~ HUHMHcƒUD ACtHk H[]A\A]Ð@H\$HHl$Ld$Ll$H(HHHLH9wH\$Hl$Ld$Ll$ H(fHLH9wf?H` DJ x WHO  HcHHc O J4pJJHcL@D)1FTCA9F JǃJ@ǃh fA)fFTCI A?A\FlGƃ Hǃ`A@)DJȉJhDJHJA}~HDJUHMAHcƒJUDJD JJB D1=vwD%Jt@pHHHLH H9TH;LG;ht؉pHHHJJJ)ADDJH`HDJJ6Dp(EH@H;LHXHHJJjDDJLJAA|$~LsJAL$It$HcуAL$JD ꉓJJJ 1vځJmDpHH|HGE11H`WЈGBDCxJǃJƃ f耍Q Jf)ЋJfBDCH`)AHDJJ|fHOH9H9HJJH`JJAD놃H• :H=-H\$Lt$HHl$Ld$ILl$H8F=~HHt$Ht$FHVHcȃD$ FA A1HJt&A@HJ,Eu/HHH\$Hl$Ld$ Ll$(Lt$0H8fDAAA~jGdduHJFDH+f=YHcȃ, FA@jF=hHcȃ FAKAuHJ讼1KHHt$sHt$FHVHcȃ, FHHt$CHt$FHVzfH\$Hl$HHHMHMHH9}H)H?H9HMHMH\$Hl$HÐAVH9IAUATIUSHtƇMsƇMA$MI)M#$xI$fLLHH9LLI9vI)M9MGI9$LvjHI$KLLM)I$xI\H!I9rZLHLH)I$K[]A\A]A^H ttH9LvƒHI+İLI԰K{I$pHI$KLH)p[]I$KLLA\A]A^U[]A\A]A^@E1I$K fAWAVAUATUHSH(H HLxeE1L)D!f.CIL9 3HN4JH?{uD+AKD)H#xL9D9t*HD $HLxD $D)D!9HB)D!D$t A9DHK1LhHMHsLC, HC0K8HD$HJ<0 $sID$H; H $J2HL4HD9T$;K{N,I5J(HD$9K;L$u~{IEutMIHT$1LIHMHsLC, HHS0[8J<0HT$\$苤L; HJ0g\$Ht$H}HHLxHMƅMt$+|$D!L9 DHHHH([]A\A]A^A_ÐIHpDHK1LD)HH${H$L$LHKHa@IĉL$$H L9v0HJHHt xt@IHI9rHH([]A\A]A^A_@uƇfAWAVAUIATUHSHH(~B u;C+sH߃H AƾHAED1DbADH߃AU AEH߈D$1D$ DH߉$$ D$ C A9ԉC wŋD$ DZ1AE1‹D$ 11:T$tH([]A\A]A^A_ËD$ AML9OA@AEAEuH([]A\A]A^A_fDS1떐@HLJ@1 HHHHױ HÐfUHSHHH;Ht 賢HHH9uH[]fff.f.AWIAVIAUATUSHMA E1D$ DL1L)HI@H=@HCH9H$spHHH)H9$w`HHHt1IHHI̟MI.ID$ M9v |$ M9wH[]A\A]A^A_D薤*@H;hpHHHÐHHHÐHmHYfffff.H\$L|$HLLt$LKHl$Ll$HLd$H8LL LHC@HCHHCPHCXC`HChHCpHCxHǃƃHǃHǃHǃHǃƃ0HǃHǃLHǃHǃtHL9rӅ{I NHHT$ZL HHT$LI)J,HT$LHA@HT$Eȍ1#xA E$1H9Hv H@EH1H9tH)H#xH9‹EAHE$UHEHEE,E$EHT$ BEHh[]A\A]A^A_fH$At]A@HHDu HD$ WHHaHh1[]A\A]A^A_f1HH11RfDLL$蔽H@HT$EL$HfLh‰D$,1t$,H|$0E1HD$0HD$8HD$@HD$HD$Pj=LL|$0DALhAD9l$,wHL$ T$,LHt$0H#H|$0ٽS@LHALA H1ɾHDtLHT$L$t$BHT$t$L$BH|$0V1H|$0HBHef.Hl$HHLl$Lt$H\$ILd$L|$HHx@HADž1LD$7D$H\$HHl$PLd$XLl$`Lt$hL|$pHxH@tH.D$u6DHHADž1fHD`tE1mHL蔻HDDIt뤀MƃM HHxHHH!ы9CHvHHH)H!H=w.H9t)H³HMH9M M DCH{HDK DIc DT  D)D%;ESAm D9v D;DIAAuG +EAADK GH;DCC‰C =w(HHK HHxH=-pZFPZFDKDS IcDtLLT ȹ D)D%;E]A.D9v4fDDA;DAAuAEGB+EAADS G 4;DKC‰Cxʋ`i it/ 7D @D=v =HHωH)HpH-H9H9 LKI<8IH HvoLHAAENL HJHJHJHJHJHJHHJHL9uJHIAGA@GA@wGA@fGA@UGA@DGA@HHxD====-YFYFtVDCDK IcDDLAD ȹD))%D‰s FDCHǃ҉HH)HpHH9H9HKHHHH @BHHxqH9HHxgD)CF DADK FDC^H˥Ac;FHHKD,HHxHArD)HGHxL0 DHHKH!HHHxHH!L9HuZDCDK IcDDLAD  ȹD))D%AAAAEDS DKD)xCxFDADS F DKEEkD)He#H脃ǃHH[]A\A]A^A_t-…DtƒuDKDH-DS DL.Ic DT  D)D%;-@AAdD9-vDD;DrAAuGDADS F AK+-DKD) .;-C‰CP:DKDS IcDDDLAE A ȹD)A)ADAуDS F DKqHHH)HHpHH9s H9HxH|0HKH!HHHxHH!H9Huy_y ZHHpH GHHxDKDS IcDDDLAE A ȹD)A)BTAAADS F DKaD)P.FDADS F CP2DKpZFPZFtXDKDS IcDTLAD ʹD))Ds F DKHHpE‰HHL)H9tH9kHKAH<>HI HHHAAEN\DDDBDADBDADBDADBDADBDADBDADBHDAHL9uJHHAkGFGFuGFeGFUGFEGFHHxHxHxHKH!HHHxHH!H9HuitjHwHxLHHKH!HHHxHH!L9HuHJxHHxHUVH@AAƃMH[]A\A]A^A_@H虱HQt@t SHtBDD)PE1E1HtYAtMAF401AAt ̄~AVAt$ HBHHxDH|ǃLKM IH LLHI8@:x@zx@zx@zx@zx@zx@zxH@zHwkHI9I8 JHJHJHrJHbJHRRPHHxDCDK LIcDTL`AD D_ ʹD);sDA;TrAAvAG DADK FAK+DCD) ;CщSd+tЉ@H.LAA)dSd#F DADK FDCAǃD@,fffff.AWAVAUATUSHHHHLHHxLH1L)H!HC@HL$ HHKHD$0HL$86fAD$H+H#xH9D$ rAD$ HHH9IIMLA<$tA|$ uAL$E|$HL)H#xH9sI9t7HLHHD$L$HHD$L$HIH)H#xEL9E]H|$0E4D#xLHD$L$LD$7THS@EHD$L$LD$HT$(t D9MHt$(H|$8LHLD$EȩLD$Ht$(DLHLD$;HHB*LD$tH;LH觋LD$HHHLMƃMHL)H#xH9@E1H|H11HH<9@H@HH9sAHtHHH)HHH41HH9H>HIHNHHfDHHEHHp@@HxHFpHH!H9HKtH9tHH)H)H!H!H9sHKHH[]A\A]A^A_LpI)MHt$(H|$8LHLD$LL$ELL$Ht$(LH|$81LLD$&fLHEHHHHH)iC@HHKH|$(LLD$LL$ElILL$H|$(LHKLPILD$fDHHKH|$(LLD$E!ILD$dHLAH9HHH@8t@ HHH9wAfDUHSHHHwWHH1H9tH)‹MH#xH9EM H#xHUEHuLBH[]HvHǃ느AVAUATUSHHMƇMEHHxLLcHH!ȋS;HHKHH)H!Hw.H9t)H^HMH9MuM sH{DC DHc DT  D)D%;yEJA> D;sFfD;D3AAuAEGB+EAADC A41H;sC‰C Cc…tƅuDKL-DS DL.Ic4DL ȹD)D%;-cE^A D9-v fDA;D AAuAEGB+-EAADS G  .;-DKCCP:@HLLH׬t.S90u:LLH蹞uH[]A\A]A^9t1Hau HHHx D9C |D)FDADC 42CsMt?HH;LHHFHs\HKHHxSHHKHHxH+H (H;LsH+ðLH˰KEQD)@ϤHLHkHLH&iHLHHL?RDKDS rIcDtLLT ȹ D)D%;E^A D;s DA;DAAuAEGB+EAADS G 4;DKC‰CxP=AAADAPADKDS IcD`LD\LAD ȹD)D%;E^A D9vC DA;D* AAuAEGB+EAADS G  ;DKCCd+v vMHHH)HpHH9s H9AHWHxL2@HHKH!H  HHxHH!L9HuefHLxHK6HHx6tMHHH)HHpHH9=HxH|2DHKH!H  HHxHH!H9HuDADKADS ADIc4DL  ȹD)G%D)tDADS F DKD)xCxFDADS F DKwHKwHLHHHhD)P.CP2FDADS F DKMHHH)HpHH9H9 LKI<9IHHvnLHAAENDf HJHJHJHJHJHJHHJHL9uJHINA?GAA.GAAGAA GAAGAAGAAHWHxL2@HHKH!H  HHxHH!L9HuADKADS ADIcDDLAD ȹD)D)%EtDADC F DKECD)HD[DS Ic DLA LA LDA DAD)GT$A D)AADEAADS EDK|LKI<9IHHvqLHAAENDD HJHJHJHJHJHJHHJHL9uJHIAGAAGAAGAAGAA{GAAjGAAHHxƃMTD[DS McB BD BL BLB| DD) D) EDADC FD[EsD)=AAD)dCd#FDADS F DK^H9LKIIHHvzLHAAEOL9@8y@xy@xy@xy@xy@xy@xyH@xHL9uJHIABA@BA@BA@BA@sBA@bBA@HHxDEsD)HxnAAED)AA]AArf.AWAVAUATUHSHH(~8 E$U0DEA9 E,HUHxAHT$DxJA9Aʼn$HENE1H!E9H/E94"D9$ J D9J HKHH)H!Hw%H9t HHMH9M DEHEIcDM DH}<4TL DD)Dف;T@kESA D;T@sD;T{AAuAEG B+T@DADM F;UHHAHvtAHHEAEND JHJHJHJHJHJHJHHHL9uJHHAAGAFGAFpGAF_GAFNGAF=GFHHx,AϹD)AϹD)AAfDATUSHHJHJH@LdL9HxHKHH#HH)HH!H=w!H9tHHMH9MEuhf}LHLzHH#xHKHH@<uD)H9sH I9NH[]A\Ã7fuEHH߈$ED$ED$ EH H D$I9HpLHI9/UHKH BII9LLf.Et …t H@HHpDMHHH)H9D(H9LKDIIHAHv}ALHEAEJ|@0@1p@qp@qp@qp@qp@qp@qpH@qHH9uJAG HIEAA BAA@BAA@BAA@BAA@BAA@BA@EAHxJ| HKH!H  HHxHH!H9HuH I9J'HHH)HHpHH9EHxH|2fDHKH!H  HHxHH!H9HuDEDEDHUHH)HpHH9sH9rjE;HWAHxNHHKH!H  HHxHH!L9HuH I9:LKDI<9IHAHv{ALHEAEJtf. HJHJHJHJHJHJHHJHH9uJAGHIE4AA$GAAAGAAAGAAAGAAAGAAAGAAH9LKIIHH}LHAAEOD9@8y@xy@xy@xy@xy@xy@xyH@xHL9uJHI ABAABAABAABAABAABAADH1[]A\Ð@AWAVAUATUSHH8N@HYC0H{(HiJHJHH  fDHJH9ƂJƂJHuHJE1E1HG$HHG,G4HHHVSHV8 DfH : uHjL93I$HV IHCHfDMLJIHpKH;hKI$tUHHpKHHM9fL~Hn DvNHrHLl$ MefHxKHt\HHxKHED:0tH D:0upM҃)э6)9rN49у)D1LHT$L$LD$*LD$HL$HT$f4 1ҍ DHf.HAW1AVAUATIUSHHH`hD0H@@HD$0wwHHHH Htgf9%HAD80u0HD8p HP ur@:pr"LHzLD@fDBD0H@pHx@rDA$pHI$LD1HI;$LI$LH|$0H;L$0A$pA$pII$HI$XDxD(DAE)E)H9I$JEEIHD$8Xf9E19AƒFTfKHsHHFD0DPLxf+H[ I9$H1+@T-C D99ȍ D9!ȍ JfKэBD4RA<69H<9E)199ETDfK1AJI$hK<H9I;$pKI$hKvHH)H|$8T$(I$hKDD$DL$LT$ D\$'D\$LT$ HDL$DD$T$(HHCL0+AƄ$ HH[]A\A]A^A_I$`LKHHCI$XI$HtHH[]A\A]A^A_@rfAWI$XI$H1HL$0H9I)$LfDLSBHEJHcAJA9 HcHn ILHHIDLHHL$(DD$DL$LT$ D\$D\$LT$ HL$(DD$DL$McIn KDIOTHHKA$JHcHn IDHHILH^HSHS fPHCHw:ɈH1AfA$lfKBDLg@xxDHD$0I$HI$XHH[]A\A]A^A_@A JI$hK HI;$pKI$hK2H|$8H)DD$I$hKDL$%DL$DD$AHQ<@ƍApH@r1LHL$(HHD$0HL$(2fI$`I$XHHI$HHD$0)SH1HODJDJD+JD񉎜J1HwAJDAA1D9DNE9L`Mƃ fHHV DREE9uA DJ @HHǃ`hHHH)HH H9@u쉋JH[C DJH`9A xDNfGA|ǃJH[f.Hh*ǃJDJBH`A)DJBfGJ:NHLLBD LDVfDRNDLFH`~|HވD$)D$SHHDhщD)f0HE1D HcHHtHO  )BJ9OAE19ѹAA9HN HJ J HHDNA1fA)ЅfDJHWD I1H @H DF8tDRIDуtIDJDJ1DJD+JADA1DJAÉJDAA1E9A9H$BD9!Hf.HHDBDD9~쉃JJ)ȉJNw!FFuf&FNH`BfGz|| xH[DJHL$DJ+h HHQDufDhH[DHAǃJIHZ'_HƇ  1HHÐHHH)HHpHH9H9LKIIHHvzLHAAENLfD8@9x@yx@yx@yx@yx@yx@yxH@yHL9uJHIABA@BA@BA@ttBA@tgBA@uZBA@tLHxLD2DHKH!H  HHxHH!L9HuÐHl$HHH\$H(HH0YtH\$Hl$ H(@HD$<8ǃD$H\$Hl$ H(ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<HIH3HteHSHH HsH;H7H;L#HkH\$Hl$Ld$ H(f.H;H4 HItXL#Hk0F1@h_@h]HCHs)@hHD$]HD$B@h]뜐SHH?Ht4{ u[HsH#7H;[f.[ÐSHH?Ht4{ u[HsH6H;[zf.[ÐSHH?Ht4{ u[HHsH6H;[*f.[ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<HIH3HteHSHHmHsH;H5H;uL#HkH\$Hl$Ld$ H(f.H;H4 HItXL#Hk0F1@hw]@h[HCHs)@hHD$[HD$B@hf[뜐H\$Hl$HHHSHlH\$Hl$HÐH\$Hl$HLd$H(HwHGH9HwvzHWHt H9HHHl H9HB{ tfHH2HIH3Ht]HSHHHsH;HN4H;L#HkH\$Hl$Ld$ H(H;HHI HItaL#Hk0F1@h[@h%ZHCHs1@hHD$ZHD$A@hY듐H9wr HwDH+wSHHH4$HT$HCH$HHHHHT$HPH[SXFHu tqEt)Xt$P€tu!Vu(Bt-[ÐfVƃt؃Lu܃Buƃ[DH(FGgyfS^FHR*HH1eG[@huX@SHHPuUu =,&t HP[ÐH$1AA^FPP&$2(WQ4_FH)H$HA1Iع FHT$1iL=&u8P`FV)H1lF&4i1RF#D`F)Ht$H1/FH$G1F1fffff.AUAATE1USHI$F aFHt51DH@FHtHHPuPbFHu:IIuh:F1EHD@h[]A\A]Vf.H8(H1NEfff.AWEAVA1AUAATUHSHHH(`V HH$DŽ$ @?HD$HD$DH$ H+tgH$ 8I"EtctA$EuzH$ 18*IH4$DL)tH(`[]A\A]A^A_fDtH$ GEtH$ 1q$ @L$ @uLH0H$ DL)cA|$!/H4$H|$D$.D$/KHt$H\$Ld$HLl$DDHFHl$Lt$HH(HEDAD¸u1Eu%H$Hl$Ld$Ll$Lt$ H(GtHGADHDfD1Ðfff.UHSH(IHH H Ht#1HH'tH[]fDH1[]ÐfDHHt H;v"HHtH;fDfDHHH9t H9~HH1H9tH9DGEu?DGEu3Hu)HuHH9u H9t fDDEuuafH\$Hl$HLt$L|$LLd$Ll$HXMIHT$D$ EɉL$ Et|$ uELk E1LH=v>DH\$(Hl$0Ld$8Ll$@Lt$HL|$PHXA 1ALLЈD$/uHH LuL;1u1f VDH;tVDuH@;uH[]H11tH[]ÐSHH-tQu H[DHhdH߾]FD$T$HEH[f.1H[fDHOfH9tHuHG@1f.ATUSHHt(txcFH@D(&EH(&HHIDFHC[]FHHhHH Bv=Hu h:F1k=H[]A\$`FփH61H$0H$0HlH$0E1H&HDŽ$HDŽ$HhHHDŽ$fH$HH$H`tH4H$0fA|$ H6DL$HL1FLtLCILH4FUH$HH׀H蟦Ht3WD `EuH `<5F,HHH$ЁHrH$ЁH$Ё(ƃHH$HHH~H\HozN9R?V>HHHhHH$PH$H8H1ɾHZ+BH=Bu41FHwuKHFƃd;H]DCCƃcHsCUHhHH$!IH$1HW2HZHHHLHH#H$0H>HH}H+H$ЁHHHHx}HH먐f.SHFH(Fǃǃ(&ƃǃƃƃ(HFHGH(IHhHHx[!f.H\$HL|$L(FHl$Ld$Ll$Lt$HHOFLLFLLGLLhHLH(IHHH\$Hl$ Ld$(Ll$0Lt$8L|$@HHHHEHHHD$ HD$HLLLLHHHHfSHt'uuT[f.Ht(]FRc u:@t[H]FR< @[h]FR# 8]FR f.X]FRRfDHl$Ld$IH\$Ll$HLt$L|$HH0>?vFHLH$0H$ 0L$(0L$00L$80L$@0HH0É$ FEHu I$ `<5FAƄ$zfIHuL{ L.Qf}LmN+  -f E A$}H AE11,IcEHOF<2]FHAƄ$WAUATIUHSHLfDII)IIJ<HHt4HLHGHHt;-t*Hb11H&HuH[]A\A]fDHsLfAUATUHSHH|$Ht$E1E11ɺ^FD$$ZLp@H|$.HHu UH;u eFH?tH$PLX$P$TAALAIASAMAVARL$PH$ A8eF 1eH$H$HHIrJ4HfHs$HARDŽ$TiVt R[DŽ$XKH|$HĘ[]A\A]H|$HHOfffff.USHFH8}HHthHHpHH$HD$HD$HD$D$ HT$H4$HH4$HƃH=H8[]HH+HfUSHH>-t2uHH[]qH[]fuŃ~-Hn4^FH\uƃ@H^FHtK\^FHuHHj8t(H8H[]hHH5(H8C떐E\ƇPH\$Ld$HHl$Ll$Hh >-Iu|HLHEjS1VSH$H H$P L$X L$` Hh (&L1HtAl'h^FAHAE@AX A<$@(fDA|$-HvED$EƇIHf.HAdFLELI9H LDH(&LtH{h^FAʼnoAE@AX HATHt$1LHDŽ$ HDŽ$( HDŽ$0 AtYtY$ t@t @H(FLH @LtA<$@t EuLuD$H(FI|$ƃA1D$$T2L: \H E1L H @LHH}AWAAVAUIATAUSH8LJƇH$HD$HD$HD$D$ ~gH˽H4$LHA9~DH{_HpHSH{HT$H4$AEuH4$LHA9EuLHH8[]A\A]A^A_HHuHSHH?Ht HHCHC[ÐHx|$hHH4$D$`T$@D$d HxÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<HIH3HteHSHHHsH;H-H;L#HkH\$Hl$Ld$ H(f.H;H4 HItXL#Hk0F1@h(@h&HCHs)@hHD$&HD$B@h&뜐H\$Hl$HHHHSHHlH\$Hl$HÐHƇfHH9ufHƇfHH9ufHtHt1@HHH9wfffff.UHSHHHtK1D0HH9wH[]f.H\$JHH Hl$Ld$Ll$H(L9IHBHHHEALHHl$H\$Ld$Ll$ H(Lfff.H\$Hl$HHHt>ƇHHPHHHHl$H\$AAH+@Ƈu>1HuH\$Hl$HfDH\$Hl$HfHƇpG/fffff.H\$Hl$HHHuH\$Hl$HfDIHE1ɺHRDH\$Hl$HÐf.SHHH$sHHcH$HH$H$fDHH9uH$HHH9uH[Ðf.HHHH$HfHH9uHÐ@=&AVI1AUEATIԺ0 UHSHHp"H31HH6H$ H$ "H$ H$!1ɺ2pHtHI9h:F1FHH1AA0F@@FIDHtt!tfDHp"[]A\A]A^fDH$!L H$0 1ɺ2HF:L$0 L$!H$!H$ "HH1#0҃m@_VFH1LH<҃(H\$Hl$HLd$Ll$HLt$L|$HX @IIME̺@HD$ HHHD$H|$ LELtvtrH$( H$0 L$8 L$@ L$H L$P HX fDH1@HD$T$D$T$mǃ@1끐LHu(1҄kfDLHT$Q(T$Eǃ@14@ǃ@H|$ H;D$t@Ht$ LHH1҄LEMLHHHt$ LHGDH\$Hl$pGLd$H@HAu=EPFFHDWHHHH$Hl$1Ld$HU DEF&H봐Hu8Eu3ҸFFHDHt$Ht$HH1 fDHff.@SHut[Ð`FHH1[ HHHFH1 ffffff.HFbH1H HFNHVHff.HhF"H1 HFHHff.H\$Hl$HLd$HFHIHHH1 1H޿G A<$uH$Hl$Ld$H@LH$HHl$Ld$G1H @FFhFFSHDHHCHH1[U Df.HHHFH1 ffffff.HHHQFH1 fffff.H\$Hl$HLd$HhvH$Hl$Ld$HfDGh$ŀG GtH$HHl$Ld$G1Hs GIH1_ H$Hl$DGLd$1HA H$Hl$(EFLd$1H# w@H$FHl$Ld$1H @GH1 H$Hl$DGLd$1H _@GHl$HLd$1H$H CDL'o@xFFHDgLH1z PF FHDEH$HHl$Ld$1HI PGH15 H$Hl$DGLd$1H H$Hl$h:FLd$1HGH$HHl$Ld$1HH7H$@hHl$Ld$HpGH$HHl$Ld$1H^ hGdH1zH$Hl$DGLd$1H\HF/Hl$HLd$H1H$H0FH$HHl$Ld$1H H FHl$HLd$H1H$H_@GHl$HLd$1H$H_@FHl$HLd$1H$HF^H$HHl$Ld$1HbHoHF1Ld$H1HHHl$H$H/HFHl$HLd$H1H$HH0FHl$HLd$H1H$HFH;HH$Hl$Ld$1H>HHFHl$HLd$H1H$HFXH$HHl$Ld$1H\PF2H$HHl$Ld$1H6DgHoD_@FDHljHl$H$Ld$1HDgHoD_@0FDHljHl$H$Ld$1HFH1H$Hl$DGLd$1H_@FiHl$HLd$1H$HkFAH$HHl$Ld$xF1H@FH$HHl$Ld$1HXFH1FH$HHl$Ld$1H FH$HHl$Ld$1HHFHl$HLd$H1H$HH7H$GHl$Ld$1HmH@F@Hl$HLd$H1H$1HHFHl$HLd$H1H$1HHoFH;HH$HLd$Hl$1HqHopFH;HH$HLd$Hl$1HAHoFH;HH$HLd$Hl$1HHo0FSH;HH$HLd$Hl$1HHoF#H;HH$HLd$Hl$1HHFHl$HLd$H1H$1HHOLGFH11jFH$HHl$Ld$11HBo@HFLd$H1HHl$H$HLgHo FOH;HH$LHLd$Hl$1HHoFH;HH$HLd$Hl$1HHoFH;HH$HLd$Hl$1Hz FH;HH$Hl$Ld$1HHNFH$HHl$Ld$1HxFnH$HHl$Ld$1Hr8FHH;HH$Hl$Ld$1HFH;HH$Hl$Ld$1HFH;HH$Hl$Ld$1HHoFH;HH$HLd$Hl$1HWFH;HH$Hl$Ld$1H.0FtH;HH$Hl$Ld$1HHFHH;HH$Hl$Ld$1HPFH$HHl$Ld$1H#FH$HHl$Ld$1HFH$HHl$Ld$1HHoHFLd$H1HHHl$H$1H2o@FuH;HH$Ld$Hl$1HHFGHl$HLd$H1H$1H8FH;HH$Hl$Ld$1HHFH;HH$Hl$Ld$1H`FH;HH$Hl$Ld$1HXFH;HH$Hl$Ld$1H/HoFqH;HH$HLd$Hl$1HFEH$HHl$Ld$1HIoD_@FLd$H1Hl$H$HFH;HH$Hl$Ld$1HDgDo@FH;HH$DLd$Hl$1HKH FHl$HLd$H1H$HHFbHl$HLd$H1H$Hc(F9H;HH$Hl$Ld$1HLgHoFH;HH$LHLd$Hl$1HHoPFH;HH$HLd$Hl$1HcHoFH;HH$HLd$Hl$1H3FyH;HH$Hl$Ld$1H HoFLH;HH$HLd$Hl$1HPF H;HH$Hl$Ld$1HFH;HH$Hl$Ld$1HHoFH;HH$HLd$Hl$1HXFH;HH$Hl$Ld$1H/0FuH;HH$Hl$Ld$1HFLH;HH$Hl$Ld$1HF#H$HHl$Ld$11HHxFHl$HLd$H1H$1HHoFH;HH$HLd$Hl$1HWHoFH;HH$HLd$Hl$1H'`FmH;H1H$Hl$DGLd$1HbLgHoF0H;HH$LHLd$Hl$1HHoXFH;HH$HLd$Hl$1HLgHoFH;HH$LHLd$Hl$1HTHoFH;HH$HLd$Hl$1H$Ho@FfH;HH$HLd$Hl$1HHoF6H;HH$HLd$Hl$1HHpFHl$HLd$H1H$1HHFHl$HLd$H1H$1HhHoFH;HH$HLd$Hl$1H8Ho:FzH;HH$HLd$Hl$1HxFNH$HHl$Ld$11HF&H;HH$Hl$Ld$1HHoFH;HH$HLd$Hl$1HHHoFH;HH$HLd$Hl$1HTHoFH;HH$HLd$Hl$1H$HH$GFHl$Ld$11Hff.H=Yj&u HfDH+t$H=[~:HV$HfSGHH1BFHƒ [@SHGHH1pGH[ff.S1Hh:FFVHH11G=HE[ffff.U1SHh:FH)@@FGHDHH11GHH[]DHcH< GHvDHHwÐSHO(1HHv HYH9v1H[H7HHH.H[ÐHHttHG(HDHG(HHO(HAHvDHHwHDÐf.Hl$H,H\$Ld$HLl$IH(HI胹H3Hs(LL聝Hk(Ld$H\$Hl$Ll$ H(@ATIUHHSH;Mt'1@HS(HJHK(tHH I9@4w[]A\f.UHSHHHC(HHHPHS(H@,HC(HPHS(H HC(HHHHPHS(H HC(HPHS(H@,H[]ÐfDH\$Hl$HHHgHHHl$H\$H HJf.H\$Hl$HHH"HC(HPHS(H@,HC(HHPHS(H@,H\$Hl$HÐH\$Hl$HHH·HC(HPHS(H@,H\$Hl$HATIԉIUHLHH SHt! IH߉LHH uH߉[]A\offfff.UHSHHHHt H:HHuHH[]fff.SHGHHG(ҶHC0[SHHHHGHGHGG H[HHD$ HD$H蠲H\$Hl$HLt$Ld$HLl$L|$H8Lg(IIL/H{0tdMHL++IALHs(/HC(HI N,*H9r fHLHS(HH9wH{0MLL跿HtLLH$fE1E1MtM.LH\$Hl$Ld$Ll$ Lt$(L|$0H8@IILIT$IuHEeAEAEAE @ID$Hv-ADHAHwAGwqDD)I)M|MI)LDHHɉLt΀H@0HHɉuI8@0LMoI;AG^@ G@h1@hjf.H\$Hl$HLd$HLg(HIv=IHLNH3H}LH$Hl$Ld$HHfH$Hl$HLd$H馳H cHbÐSHbHH[fDAWAVAUATUSHHƇiaMT$ HhaHpHjHHH9HC逾M5LMLxHtDHưKAH4$@LH<$IL)M)LL!IL9AEsD D$ D!ͅdaaHE111D H4HD|DTLis'A1Ais'A?1is'D1Dis'A1D#HF#LBHHfyHHBTF daIH9DH[]A\A]A^A_DtHL1H D H4is'1tis'1pID# 2DLdaH9wH[]A\A]A^A_fHHKgLHHH)H)HL!H947@4s3@LL9IG@@u:HwHt1LG11DHi(DAH9rHH@H H9uƇULc1N SHHDL9EXDs=EP121%H|D9rA9HDDI9wA@tH1[]@H1L$L$ǃH1[]fffff.AWDZDBAVDIAEAUATUSHD$HD$HD$HD$EcEEHD$HD$EIAE1EA1A1E1f.H)A9 y@wzDJDRAD DJD EʉIL tEtAuEuHG IEHGEEIEIGG9DOAmDI9aV )ƒdSAE}AUAAEI6HaR1fHH?@HWHHHHHfBH ƀH9tJtuH H9ufSbHv9b 覔Hb 1[HLJbfff.SHHbHtKHǃb[fffff.42H9tNLLHA A|is'1A|is'1I 9HzHI9uDbEMAL9tH Hp AE1EuLI4DHDHHI9ufEM L9t@0HHDHDHI9uEIL9HLfpHI4q>fHfzHI9ufff.HH?@AWAVAUATUSHH( ҉t$T$D$Dl$D+l$bADt$AAF1=DGEDE1H$Dl$E)D$E9DEGHHaD8H `CA# D,A(DH+$EHHbH0H$ H虒D9blHa谑b$D$D$Ld$ E1D$ D+D$D$D$L<I)NjD$ # CHaEl$ I$AD$D$AD$ HaLAID$HbID$AEGAD$$DI(HAHT ϑD9,$wHaD9t$v Dt$4H( []A\A]A^A_f.D0daEɉat(bv"vvC+fSH bLbAEAIDHf@b;bbr/HbT$L$Ht$D$^D$Ht$L$T$AE1A@9>HA8t@u~DNAD DD DNAD D AAx80ADMDD@~DADN@~H9nfDH [fAWAVLbAUEATAUHSH8bLbHt$(I@f@b;bbrL+bLbAT$IPf@b;bbrLډA=AEHPAHL$(1Dl$E1McHT$ AED9~?C4,IcHE1A8LHADALA(EAHE)D9AHE9Dl$EtAtHPAnHHAHcH|$(H8[]A\A]A^A_@t$H|$ HL$DD$A46'DD$HL$8fDUSHbHbH@f@b;bbrHbHt$}Ht$~]HT@HH9t>~uFNȉȉFNHH9uH[]Ðfffff.~LF~tI9t{DxD9D|D9;tyDD|xtv v fPH9tHE1tfPD@;xtS;|t;At@@ADLcσLcׅFtFtuAϐLNHl$H\$Ld$Ll$HLt$L|$1틈tt?;$w7iatvDHDLE)# ACC8"td@HL9u1~PDLH\$Hl$Ld$Ll$Lt$L|$DHD9wf.DTE1E~AF,G4C*C82tIAoDPEZE9[AZD9t2AE9tAE9tTA9;AD0E9}fLfDLfDLfffff.AWAVAUATUHSHH`/XD$ \DHHcD DiaxLE1L$ED+LD)D!Eu D9DPAD;TLEA)E!A 2C8 :H8B4t3 fDu"|$Ft$AE҉t$DEfDI9.EL$D)※ptzwK9l~Cht9z ~\'sLKdIs@xƃp1t2 Gw1HHLk+\# <Kȃ9IDK@xuPLHHDƃ`H[]A\A]A^A_@;t$]DAԃI9‰t$|ft́뵀pt?SL[dЃIÉSH`ƃpt,XD$ \L$ HHƃ`@HHPH8ƃ`\LXH0H0DH8@@DH[]A\A]A^A_1NHHEqpt&SLSdЃI‰SHƃp`u0LPHHH[]A\A]A^A_눋X\HHƃ`밁I fDAWDHHAVLDAUATDUSPE,T$DLDDD\l؉\$DЉ\$4D$ DD$D)!ЉD$oA9fD$Eis'A1ADD$Eis'DD$A1AEis'A1@Eis'A1E!E1DDD:\$tqDDEEis'E1D\Eis'E1D\Eis'E1D\Eis'E1D#E9t!D\$D9@}D@[]A\A]A^A_ÐDD$EFA8DD$tIE,l$tDH D$DD)!;D$vA9rD\$܉D$D\$$@E)D$EA!1DDH\$B8;l$zLD$1E1GDEA~JD|$EF(EA!CEE)A!A)A!E9DGDGA9D|$DFE)A!F DL$EF\Eis'E1FLEis'E1FLFDEis'E1Eis'D\$E1E)D#D!D\$rA9i|$DLAD9DD$AA98DD$AA9|AAD;LwKL0LcC9TLPT$Hl$܈T$D)T$fD\$D# \$\$D~mfDT>\$fDED-F\l$BB8;l$ DD$DD$LDL$DL$=l$4@P1H\$Hl$Ld$Ll$Lt$ L|$DHD`DzIE1ɉT$AnHD$Et AEtED;$iaTD)# A  DbEH LD$ B8 1\$ fDA9~L$DD B8tA9t}sfAIA1H\$Hl$Ld$Ll$Lt$L|$DE9"AIADXAv9D$t8D9uLtA PfD1.LAA+ffffff.AWIAVAUATUSHHLHt$D$1T$;t;x;|;HT$L$;hH}¸nHL$E IAMA8DHEt$E!D<A\D$$@|$;DL|DLHT$PT$4T$t(A\tD)D!D9v;L$ wAcD)T$;DT$ D!E1ۉH|$(:>ED9\$4*HT$(E1A|ASD$ ~LDt$ADD!ELD)D!D)D!9AGDGЃD9|Dt$DT$ D$ DD! L$ L|TL$(LD)D!;D$@9D$ D D9L$D9\$4} 9D$D9\$DD$ @is'1is'1D$(is'1is'1|$<#D$$D)׉|$0L$ D!rfHL$TɉL$T$ L$ D$@AB<G 3>B8tT$ D$L$ lD;\$}ϸfff.AWAVAUATUHSHHF D$ f+D$ D|$ D4LH=GD{T A!EDDHA4D$ǃPA fDPAA4DP!D8$9u؋HDNA!DWB A!B8uDTAA~Dl$AF,E49A!A!B)B81ADl$xE9o)!;$_WAAA9ALDPEA4)fAD~iau^LA9sYSLsЃIƉSD`D$ C ;D$ WH[]A\A]A^A_E9'fLHHT$ PDD$ 뢁 =A)"@AWAVAUATUHSHHD0FdžHdžtHdž|ELnL$@Ɔ`Ɔpdžh@1Lss@1LdsS L0L8ǃ@ǃD1E1D$ f.Ds D)GE打TA!D+aDH!HH)HaD0:DB Df1D DBA9w!A9w!HDƒD<DDDD,AVD ǃP~(H0fDBH9@}E8ǃ@E8E8ꋃPG>QD8 HHnPt l$ ~iaD;LE1pt&SHsdЃHƉSHƃp`tX\HH]ƃ`E=LEƃpDdhPlS AD9@T |$ ~+DH0ǃP)# LBPl$ ǃ@0~ ;THHPPS EdAD9Rpt&SL{dЃIljSHƃp`oH[]A\A]A^A_f.SHKЃHSDhGD8 EFWB8TD)# PP~L9H0ǃPLB `fDA@D8 CE~APB>8-E~APB>8T DD)# P;$H0ǃPLBHHA/X\HHƃ`H[]A\A]A^A_H[]A\A]A^A_Jf.HH?@AWHPAIAVAUATUSHHdaHT$8PA9e) !bL$(b9F;L$(GL$(|$(L$, HbD$T$(+T$;T$,GT$,щT$$D\$$ 9GȸDȉ1EL|$ML$1E1D$Dt$$H\$0'HLAID9D)D9d$t;D$G\$9D$AdaIaMbA# L:Z DBIHBuIaCAIZrD9wIaDd$H\$0kqDL$E1L|$AHT$HahL`u=wAHD><>is'A<;is'A<8I<#HA 9Lw?fDLL9IGfff.AWHAVAUATUS,n FLE1틿,Ht$D$?|$D$DDT$AEAGTEECzHA9wDAAD9r HP D1DuHHD HDA9wfDAD9s0HHDD HA9w@AD9jLDpHI4q>ffzHA9wffff.HH?@AWAVAUATUSHH( ҉t$T$D$Dl$D+l$XADt$AAF1=DGEDE1H$Dl$E)D$E9DEGHH@D8H CA#,D,A(DH+$EHHpH0H$ Hy?D9XlH@>$D$D$Ld$ E1D$ D+D$D$D$L<I)NjD$ #,CH@El$ I$AD$D$AD$ HHLAID$HpID$AEGAD$$DI(HAHT >D9,$wH@=D9t$v Dt$4H( []A\A]A^A_f.D8LEPt(Xv"vvS+fAWE1AVL8AUATLhUSHHD8LA9E%DD,HǃHD!AAȉLB,D!<@81YEPDHELD)D!9Qu D94LD!LZHLZHLHZILZHLZLL ZLAD8A9HL[]A\A]A^A_Tf.AǃLD!@:,DLE!B:<NǃHDAHAFE)E!ttA)ɸDE!ADGD!D!8>uJEtE1fA9vB<DD!E!>B8tvD90~fD@LZY;4t"LE1҃#,LDL#YϐLYLLYLAaDHLfD=ESHA(:hA09AADQHHqP1D9H@8tuNDNAD DD DNAD D Ex6.ADMDDNDADNNH9x[fDHA(;hA05AADQHHqP-fDAWAVAUATUSHAH|$`HD$`Ht$hT$4DL$THA(9hH8EA0ADQHHqPDAHD$XaHD$hH\$`D$D$DDD$HD$HIcHD$8@t$t$TH|$XQD$D9D$4HD$pHD$xHDŽ$DŽ$Dd$Hl$HE1D$D$E1D$D$ 1AHcD$D$$D$ D$E11E1HD$(I1fD|$$T$EA)DAAD]<׋T$ EA(EAHD)B< @׃D$1) )ljL$p1)<2DAD$tAD1D)|$ |$xD)AAD1D)|$|$|B<AAD1D)|$$D)DAAD1D)|$$1)D$D+T$(nD$pH|$tAE19vE։HAuAw*EB$ G1|$ D$ f.Dd$Hl$8ID+D$9D$4D$xL$pED|$tD$D$ D$|D$$D$$D$D1|$$D$$1|$$)D$$mD1|$ )D$ UD1|$D$=D1|$)D$%DD$DHD$HD$D9D$HD$`HcT$4H|$hH4HD$`1ҋt$TH|$XDt$4HĘ[]A\A]A^A_TM@ATUHnrS1HdH%(H$1L$H$D$D$$I9IA~yDHD$LD"D JD(HJHD(HHL9uE#HD$*PH҉1)AH9uAI€E#D9IHi $T$9w1;L$v 9T$ЃH$dH3%(u HĐ[]A\4fDAWAVAUATAADD$L\$D$DD$KEtN1Ҁ|$JHt@fHtHcq;tsuD$JPDDL$4AMAEMF EMIDH9L$(v9HAH|=HIUHWEEIUIWW90H|$4DH9L$(M )уdt$4AAMAAUAuIH@|$uH|$PfD$HL$L\$<D$HL$L\$91nf=@HH?@ȉϹ D)AAAHAHHH HtD"AA HH9ufDAWAVAUIATUSHQHH|$HA(8hA0xAADHqPT$EHAf.xIHDGEt:EA1AsH|$AT$H=t8A)uHD)9D$~ AH[]A\A]A^A_ÐH|$DH޹H|$B0ADHށ두~LN~tI9tsDxD9D|D9;t}DD|xttNv PHf9tXE1tPD@H;xtZ;|t ;At@ADLcσLcׅFtFtuwAfffff.LNHl$H\$Ld$Ll$HLt$L|$1틈tt?;0w7QtvDHDLE)#,ACC8"td@HL9u1~PDLH\$Hl$Ld$Ll$Lt$L|$DHD9wf.DTE1E~AF,G4C*C82tIAoDPEZE9[AZD9t2AE9tAE9tTA9;AD0E9}fLfDLfDLfffff.AWAVAUATUHSHH`/XD$ \DHHcD,DQxLE1L$ED+LD)D!Eu D9DPAD;TLEA)E!A 2C8 :H8B4t3fDu"|$Ft$AE҉t$DEfDI9.EL$D)※ptzwK9l~Cht9z ~\'sLSdI‰s@xƃp1t2Gw1HHLk+\#,<Kȃ9IDK@xuPLHHDƃ`H[]A\A]A^A_@;t$]DAԃI9‰t$|ft́뵀pt?SLcdЃIĉSH`ƃpt,XD$ \L$ HHƃ`@HHPH8ƃ`\LXH0H0DH8@@DH[]A\A]A^A_1NHH5qpt&SL[dЃIÉSHƃp`u0LPHHH[]A\A]A^A_눋X\HHƃ`밁IfDAWDHHAVLDAUATD$USE,D$AB ABDABDABPD$D$D,<D$D,D0DD)D!A9D$EEis'L$is'L$Dis'Dis'D!E1fDDD D:D$E]EBEis'EEFFEis'EEEEis'FEEEEis'FGD#$D9t'L$9@}@[]A\A]A^A_f.DD$EFA8DD$tAE,l$tDHD,D0DD)D!D9w\$\$fDE)D$1E!DELD$H\$EB8;l$LD$1E1GDEA~MD|$EB (ED!ADD)D!A)E!A9DGDGD9|D|$DBE)D!AFDD$D@FDD$Eis'ED@Eis'FED@Eis'FGD\$Eis'E)D\$A#$E!\E9S|$DLAE9DD$AA9"DD$AA9|EAD;LwKL0LcG 9TDLPDD$DHD)F\$l$DD$DD$Dl$#,DD$~mfDT+\$fDED-F\l$BB8;l$D\$D\$6D$D$)l$ fDP1H\$Hl$Ld$Ll$Lt$ L|$DHD`DzIE1ɉT$AnHD$Et AEtED;0QTD)#,A  DbEH LD$ B8 1\$ fDA9~L$DD B8tA9t}sfAIA1H\$Hl$Ld$Ll$Lt$L|$DE9"AIADXAv9D$t8D9uLtAPfD1.LAA+ffffff.AWAVAUATUHSHHHLD$1T$;t;x;|;|$;hH¸~DHD,HL$D@E}E!DE_A |$ D\$(D$/DD$?AG<AGD AGDPD$ D$0DED$'0D)D!9ʼnl$D$/T$?D\$ l$0H\$@is'Al$D\$8@Nj|$is'A|$4is'AE1is'D$/#T$ AB 8tlD_BDis'O FEis'AˍOEis' AˍOEis' A #L$ 9t1HH[]A\A]A^A_L$\$'8t ACP~cQu E1D;LrQ8~ ;THH>PEdS AD9@eDE1pt&SHsdЃHƉSHƃp`tX\HHƃ`ELS AEƃpDdhPD9≃lTpt&SL{dЃIljSHƃp`[]A\A]A^A_DTDH0ǃP)#,LBP^ǃ@OSHKЃHSDhGD8 EGWB8TD)#,PP~L9H0ǃPLB fDA@D8 cEwAPB68MEwAPB687T*DD)#,P;0H0ǃPLBHHAr1LX\HHmƃ`[]A\A]A^A_[H]A\A]A^A_)CH{ ǃ$H(Afffff.HH?E@AWH8IAVAUATUSHHLHT$889e),!XL$(h9F;L$(GL$(|$(L$, HD$T$(+T$;T$,GT$,щT$$DT$$ 9GȸDȉ1EL|$ML$1E1D$Dt$$H\$0'HLKAID9D)D9d$t;D$G\$9D$ALIXM`A#,L:Z DBIHBuI@$DAID9wI@Dd$H\$0DD$E1L|$AHT$HXhL`u=wAHtfLHL[]A\A]A^A_BQfHLhfffff.Ll$LH\$Hl$Ld$HH(HGLHH8HhLHLR:HX 1H`HǃHHǃHǃHHǃHǃHǃHǃHǃHǃHCHCHǃHHǃ`HǃpNH@ǃ8ǃhǃXHl$H\$Ld$Ll$ H(H GHLHEH:LHHHfUSHH@uXƇQLJ4LJLƇPƇ0LJ4LJإLJܥƇLJPHcҋ,H8GǃDHǃXǃ<@@H肨ǃ8ǃ<H[]ÐfDU@1SHHH@Q L9HL1LL1D4 H< D is'A43is'47HfAzxis'<:HAxis'<:#$A9LwH[]@H1H1 HH[]1H|fff.AVHIAUATUSHmO,6 XH$0AEID(I,ALD(LHqHL1HDA@FH5H$ HHHHAD$Hi8HHCDXHCAEILH1LHCH1@ H1H1 H1HLsH{1Ii8HH{L1AJ<L)$HHX9ʼnh~AJ<DXH`Et,I1fD[I$XI9XwHOH1UH11i[]A\A]A^hzDHfff.HcG<@fDH\$Hl$HH9HHrH\$Hl$H@HHHtHH\$Hl$Hf@hN@H\$Hl$HvkvwHH2ھH ӾHH\$Hl$HfH1ҾHھɐHHھfDHHӾzfHHwھSf.AWAVAUATUSHHPEHt$HT$(L$$E1LXEHIAEf.1 LHTHT$DL$$LcL2PAD#,w8$XGDXE1ɃXALLHA׿AEEAAu M9ExA~AEHDHciIcIcEHIEEEXTD9PEIcAH HJLXEtSd)…~GE4HLT$$T$Ic$IcT$HEHcHD$HcH0uLT$HIXDXXLLHA%ATAEXELLH?XD\LLHoXD\LLH/jf.ADDTErIcHHD$HcTHH0zDT@fDDD$Ef.D$$HXT$(9T$$HĘ[]A\A]A^A_AEEtWHT$(*)Ņ~3Fd%H߉$IcK$IcHHcHcHD$H0HHT$HHD$(D EVE1AoA9HcHHPHÐEHcH4J HpHÐE;H DBD;@t&IcHHPHÐE9H uD9@u DDNE99bD)AAAAEd19HHHPHPEHBHD$0HBHD$8HBHD$@HB HD$HHB(HD$PHB0HD$XHB8HD$`HB@HD$hHBHHD$pHBPHD$xHBXH$)ȃHD9H,HhHPEHhHjHhHjHhHjHh Hj Hh(Hj(Hh0Hj0Hh8Hj8Hh@Hj@HhHHjHHhPHjPHhXHjXHT$0HPHT$8HPHT$@HPHT$HHP HT$PHP(HT$XHP0HT$`HP8HT$hHP@HT$pHPHHT$xHPPH$HPXDA9E_HLLhDt$(HD$$IƋإD$~?XE19XHu qf\H99D$L$g$|$ܥE19tpH߉$À$ܥE+L4#,v A@H߉$_|$$qHE9tHH$A 0EH$\E|$]EL0T$D$D 胻Dt$L$HHH$BD$B;rLAt$UE1fH(DHHP;rLLAAD9l$w@DA|$AGŃD!4L$DL7$L(|$|$t$LE1DH(DLA4D9l$wRfD$r@HADDEE=1fHEHcоL$$9EH1Aǃܥƃ1ҿ11XEHcɉإXD$@EHDEE1HEHcоL$ $9EJоL HcD$$AHHPH`E1H\Es2H߉$HT$HT$$ȋEHإܥE1yt$Lt$L D$1@H\$Hl$؉Ll$Ld$L8Lt$L|$HH,HL@D4(D)E9F苃L:9HLOAL0)LE14uzEtE11ɉH&4#,L4H\$Hl$ Ld$(Ll$0Lt$8L|$@HHD4E,ƃQ @H膱4q(HH<>@@@|1H@ 4DH`HcL>'Au7L$$D$ 1E1ELXH4$L9L=ƃPL$$D$ 4HPAHE4HT$ PEHHJl$ LXA9H4$LLDDL4$D$ D)LA4fD f HfDAHHp@HHAfHfH,Afffff.AWH8AAVLAULhATUSHHDHT$DL94DAu A9ttL:A8ADAAuH@w@$ŐGDDaLi:T@L94Kf1H0H[]A\A]A^A_LL;8ƃ0DL4L 1L 1L%A8u8t 1҃T<u 8LD4LD0LD9D4EDfAƃ0D\HggfHXH|$Lf.Hl$HLd$DH\$Ll$HLt$L|$AH8DHAI!HH@;rHU8ED8DDHMtULHAFXAV\8<z?~ ǃ8?u<~ ǃ<LE4tP@HDH`LI@;rHY7Dt0HH\$Hl$Ld$Ll$ Lt$(L|$0H8&7fDH\$Hl$Ld$Ll$ Lt$(L|$0H8DDHDDLh4L L1LDHQfDǃ8ǃ<HXÐXÐHǐHǐ$6GGLJ LJ ÐfDGGLJ  Ðf. =D@v A D !Ήt Gt9t)!9s7Wf.D GEGtWH1AQ t+# 9sAփHD9uAtMcBD BD B GÐHG$HGGG G @HHtffffff.GG G f.H\$Hl$H(9w$HtH HtHCk$H\$Hl$ H(f@hHD$8HD$f.H7HWfSHHHtW HwHC [fDG$[ERfAVAUIATIUSt\ 6)L9GI|$ALA|$ )A|$ t$MAl$$9uL`Al$$A|$ @[]A\A]A^ÐfDATAUSGHƒA)ԃwKoG *Hsƒ@,SkC Skw9C$uHC @C D[]A\ÐUSHHG W$H9s2HG@pPPG H[]fD9tgH{ƒ@,C ;C$H{ƒ@,C ;C$t_H{ƒ@,;C$C t2HKƒ@4C H[]t$C t$fDH߉t$C t$H߉t$C t$H߉t$C t$WH\$Hl$HLd$HO9w!) oOH$Hl$Ld$H@AA)D ww D)KkfDSHW HwHC [Ðt HHH9wH@HH9vfDG%?ÐfDAWAVAUAAATUSHHEADAB uB Et$ <EAAA AS@Ѓ@A ;SDHC HD$HK8ЃD<ZS@D11D1;SDtqHs8EBC@u!;Hs8ƒE@,C@t#A9CDuH|$C@H[]A\A]A^A_ÐHS@hH|$$S@$vE11AfDAVAUATUSHHG LFL11HL$H$HLL$ HHHLHCIxLHHJDAt$(I$HH4L(H>AuE0f{X+Cf.SHHHOXTt H[HHUۉuHtG1[fD\G1t$t$fUHSHH(uteHOX0tfE1uHuLuHu vHpLL$LuHt$LE‹uH01$H([]H0H8UtHMXƁ5n@@h)ېfDH8UHH @h7@hH@AWMAVL8UAUIATILUHպSHHAH$ H $CA$vtIEXH$0AH$8ALH`+H$8AH;$0AH$@HD$fDHH9$0AHH_HH$@HPH$@HPH$@HPH$@HP H$@HP(H$@HP0H$AHP8H$AHP@H$AHPHH$AHPPH$ AH@XH$(A$@AI$I}XHT$H$@H$A^H|$LaIEXcI$`uH9$@@Aƃ9A$@HH]H$@HH$@HPH$@HPH$@HPH$@HP H$@HP(H$AHP0H$AHP8H$AHP@H$AHPHH$ AHPP$(AfPX$@[H$@1 HHL$@I$H$P@IEXu6HH$<@w_$<@HHA[]A\A]A^A_fDLLةHtULHtߺIEXtA$vuҸtv@L1d; @A2LTQE$@H}(DŽ$@DŽ$AE1L{fDIL9e(vILH[x,uLH[L9x0uLH[L@LH[H@0뭋$AA;vAH$@H$ HKH$p@1EH$x@H$@HDH$@H$@H$@H$@H$@H$@H$@H$ADŽ$@H$@H$AH$@H$AH$@H$ AH$@H$(AH$@H$p@HHH$@#]IuX$AJȉ$A9H}($AHCE1E1HD$fAEL;e(LHZx,uLHZHT$H9P0uLHYxLv?LHYhL릀$(ALKRt-IEXALHY@,H$ZI$uI}XM$`uH$@1Atu@hXIEXCH$ H$p@Ht$HH$p@DŽ$@1`fDH\$Hl$HLd$Ll$H IAHn t;HbHtA H|$PAAG1跕LD$PEH1薕HH薲ƃ H$H$L$L$HÐfDH@u @H?u=H@H9HBº HqH9rGHu@HH@H9wHH H=HFHfff.1HvHHHHHH9HBH9HGf.AWIAAVIAUATIUSHHHwXH|$lH(F+zH$aL膰IT$XH$؁%DHDŽ$HDŽ$HDŽ$E+H$H$E1HD$H|$H3sHK(EHLLvtH|$1 HH$H$I|$XH$ $%?A$ $HDŽ$<HDŽ$`$h$A$iH$H$(H$H$0$a$8诖t$XI|$XDGEtAH$H$h$I|$XH$E11處H$HW$A$$ DEHK(11L$, t@hkHTH|$YwH[]A\A]A^A_I$HM$HLCH$aL$aIT$XH$p 1HHHH$H$pDŽ$HDŽ$UHHVAH|$HvHʘf.AUATUHSHx HsH$ DŽ$` DŽ$d DŽ$h I[HHHEXH45FƃǃTTbb’HuXH0@HH0HfHHEX.tH<tH(FAH(IHhHHGHFHH-HՐH$ DŽ$` DŽ$d DŽ$h gHx D[]A\A]fDH(FHHnGHBD-$$ЖHHIOL*tMtLOL5D;-$$AHLH蒖HHHHHDHlIHLޝIHF͝IHG輝HhHI諝AWAVIAUATUHSHH|$HT$D$pD$tD$x~"1HVH}(E1E1H](IIL9v/LHPx,tLHPx,tH](IL9wHHE1DHHtvHHPIċ@,wA|$+ IFXFA|$XtMtI<$$p$AL$X;@HĈ[]A\A]A^A_fDuI<$$+AL$X$t=I4$ɿI$:?1LLLj$I$Ht$+F@h1@I<$$AL$X$|DI<$f.I<$$AL$X$DI<$$AL$X$)f.SHtqt [f.1U2vH8UHs )bE@hu1U<uHs *D[@h1UPw̐fffff.H\$HHl$Ld$Ll$HL|$Lt$HXHIILD$D|$`DL$vutHEX0HHM$U HUL蚔EAƄ$uAƄ$uD$HEXTuup G1upwHH|HxuHt 2UIELP0HEXH@I9$vvI$vuLE111A$uuA$u-HLH\$(Hl$0Ld$8Ll$@Lt$HL|$PHXpIELP0DLHDHHHLLpH)1P HEXuH-HEXuH,HEXuL,LHLwƅvHDžHDžHDžA$A$vHEXH@I$v2EA$1UHEX0AƄ$uAƄ$u7H}I$8UL1E1E1FvHvH|$HT$HuLHMHƂM>HxuHMXLH2UHIEP 1LHD$ƀM~ƅ1ҀuHuHuLHE05H\$(Hl$0Ld$8Ll$@Lt$HL|$PHXf.GVH1l`G1`upI$I$uI$uI$I$u~A$ADŽ$ vAƄ$upHuH9xuHMxu10HHL$HI$u1HHL$vHHHHHH9HBH9HGHLHH\$(Hl$0Ld$8Ll$@Lt$HL|$PHXKHHtXHEXHx@v (P8軇HӌHf.AWHLAVIAUE1ATIUHSHH(HD$HpHD$HuHD$HHP(L9H1qHHH$HH$I9HHEXTuEA`G1DLH{3P,wHSXHH9HrπxXHT$IL9e(wH|$uHĸ []A\A]A^A_1ҾHH|$HAqH}(HD$ E1E1fIL9e(vvLH2P,wHKXHPH;rπxXuLIHHD$ L H@IH@ H@(H@0L9e(HP@8@9wHt$H|$ D@J)%E1tHD$HL$Ll$ HL4 HD$y@Iu@11LXtheLLHIuH1H|$0L8HH|$01LyAE9H|$0"II@L;d$s3L;d$rMtIu11L{II@L;d$rHt$H|$ D@Z(%E1E1s"qD$,HLd$ E1PDIt$@1ɺLdt:|$,uWI4$H1LpII@L;l$L;l$rMtIt$1ɺL tɋ|$,t|dK6K47H,I4$H0I4$H@HHD$0H0H|$0H4$ڬH4$H|$01 AD$9H|$0L|$II@襯L;l$MD$,|$,Ht$H|$ D@'%E1E1QrddHoL;l$MIILt$ L;l$sMILd$ $IAI@L;l$s1ҹLLtI6Hs/I4$HHD$b/HIHAPHCXPwID$I9HyH$` H $螊H $H$` 1GHHCXH $EH1>F1Ͳ1Ht$0HAEf.IT$Ht$0H.AD$87HD$H$` HxH $HD$H$` GH1EH $HCXt/d:FLGHE1GDH1H|$ t H|$ qH;drH|$0HBHrH|$0H-Hr@UHSHHHvHT$ l1xOH|$0vGH{Ht$(LL$ HtCL11fHHH9s+I H9quL9IuHHEH[]DHEHH$L$LL$Ht$H$H$H1[]f.AWAVAUATUHSHHhcHt$@HwXdH%(H$Xc1D ExHpDŽ$`DŽ$@ƃt==%H$bƄ$/c,HT$@H$/cH$bHHsXPH$@cHsXH$0cH$b1E1fH$bH+L;hsH$bH+LhH$bHL$(C+L`H$bHL$(CL$0Cz+H0H$0c:HH9$bN$ L$0CvBH$bH>+x,TH$bH$+x,:HH9$bwHt$@L$.cL$bH$0cH$@cHƄ$.cWH{X$B/wH$btp1HH9$bv^HCXctH$bH*x,tH$bHo*x,uH$bHY*HH9$b@,wHsXH$HcD$oD|$ot$C/$/c!XLHVHE$(CHHH%HH9H9HHVH$bHD$pHD$PE1HD$xH{`HP0H{`HtHPHkhHC`HtHeHgH|$xHChEt@@h׼AGGHHHD1HT$PH T$p|$oH$@cH$0cvH$Pc1`hH$PcD$L4FDHSXpGDFTDFHDH1HM@0rH:u6HE@u(H}( 1HuHP H}(虋u?DHEHH}(H@Hu(H軆H}011HP H}HH}HHE(HH)8HHHcH)0HǃHcDHE@x@HxL@9HU(HM@H@H}H@L@L@H0HLJHLJHt$$Ll$҃΄H}H%HHc@Hh@H cHx@H(cH@H0cH@H8cH@@c@u:ƃ nfDHEHH HHH}(Hx@LTHp@H@@ATUHSH @DHc] H}(HiXcH] 莨HMHAĀH}(ID$H;HP(H}(HEHL)THtHU@@tL)HHHLP HE@H}Hx@HLJHX'HU(HM@L@@H}HH@L@H0LD$L@Ht$$҃˂H []A\f11*H}( fDfffff.H\$Ld$HLl$Lt$IHl$H(HcoHw0HEEHiXcH/H5DH{(E11ҹHs(H HU6KHC(H cHDžHcDPcDQcuCCt!H$Hl$Ld$Ll$Lt$ H(@ILP8HHl$H$Ld$Ll$Lt$ H(f.UHSHH?HtGLGIiXcHH9tHXcH @şH}H9uHH[]FDH[]ÐH\$Hl$HHHH6H?\uHS8H9U8tH\$Hl$Hffffff.U1SHH?te<HH;uHH[]fH\$Hl$HLd$Ll$HLt$H(G,u.V,1H$Hl$Ld$Ll$Lt$ H(N,$t*t]tHF@H9G@D=Q$u1HU8H9S8t@E09C0txDeVuXu~Xtf:fD~X*H?H}II9q@H;p`H}Id`.IL4@.IL$@MHuiHtmHLZLLvZHUH9SHuH;Hl$H$Ld$Ll$Lt$ H(8ZtM@uu*fDSHH H=$HѝH;HYH [ffff.SHHH@H=$H$ 艝H=z$HH޹rH$ HrYH@[ÐHHGHGHGG HG(HG8Hw0HvHH@AVAUATUSHw(HHH?D`UwLs(EA|IcE)H,RH@tADH`DxSH H)P,uLm`LQ,tuH1H8}XuHAH`BD(,DDyD[]A\A]A^Ðfffff.SHw(HHG0HH$vH?D`vHs(Hs8[Ðf.AW1ADAVAUATIUH͹ SHHxLl$LHHt$LHC0HS8H3`H$?I1MtXHMw`I9wbf.HS8HRHHI9rsI)I)HIILLM<$LuHx[]A\A]A^A_IWLHHT$$HT$u/HIH9sfDLLt HvI`HT@ATIUSH(t+11fDI$H<(HtV=HH`I9\$(w[]LA\f.UHSHHH;HE(HHC8t5H$HܐfD@S@5$H$teHs(H;D[`nqSHH?Ht4{ u[x9HCH4@HhH;[V9fD[ÐH\$Hl$HLd$H(HwHGH9HwHWHt H9HHHl H9HB{ trH|mH7HIH3HtiHSHHRH:HCH;H4@HgH;8L#HkH\$Hl$Ld$ H(DHtmH;HH>&LHHL>L" HL>H;HuH ;H[]A\A]HH;H3AUATL USHLH`dH%(H$x`1.MGFHL$p`y2G(G@@HD UH1#rkH$``ΐu:H$0@t @H$``H$``܍L@H$P`CH$``6H$@@H2GoTH$@@H1}qH$``H H$P`HH$@@H$``p@t H$0@t($ @H$@@$P;H$@@#6!H$``螏VuDFSH1pH$x`dH3%(}HĈ`[]A\A]fDH$@@H$@ ,@H$@ MH$0@t @gL$O`H$@ H$P`IHD$H$蠈uA$O`H$@ @h,H$@ 1FLh@H$@ H$``H$P`1E@BH$P`E111Ҿ葯H$``H$P`H$``H$P`E11ɺtU$ @@u$H$@@%f (qH$``iH$h`HDŽ$@`+H$0@t|@uwH$``H$P`74F]QH1snfD$$@&fD$2H$@@L)H$P`1豺mH$@`H$P`1oQH$P`H|$1fH|$LfH$P`H|$HxpH|$H$ @hH$@`H$``nH$@`H$P`11lH|$HhH$P`贌H$``觌H-+HHfڐUSHH`H$@@dH%(H$`1/-u+H$`dH3%(CH`[]f.H$`H0H$@@H$`H$p`H$`HDŽ$p`HDŽ$x`HDŽ$`HDŽ$`Ƅ$`NH(FHW6H$@ HR5t $@ *@H|$Sd@D$$ H$p`1H$x`H$@`HDŽ$@`HDŽ$H`HDŽ$P`HDŽ$X`Ƅ$``Ho H$H`H$@`H$p`H$@`H 'H|$HHKgH$@`nH|$eH|$jfH$p`M3H$``GMH1jfL$`H$@ Ht$IHD$H$$u($`nH$@ @hW0G.MH$@ H1ufH@HH8tꋓH~0AHp0pD9wE1D1H @L$I DHxDH RDLHJL 0LD0pA9wËAD9wa1A9HxH4RHHр:uDHz0H4@AHHt0ED$'jHD$HD$H9]Hl$(Ht#HHnHH{01H{(1AddH:c:H|$t H|$h1|$'t HH[]A\A]A^A_@1҅H1Ll$(Ld$vH{01HHL$P HL$Iv0H{0H6IV8Iv01I;F`IIV8IvH9HHHxHLH9wLRH)JL4IV8H9HGHtA>HIFH$H$HH$H$a9uLl$(E1҃HxHRHHH RHHHThf8t HHHhH9uE1D$'fDLHAfDH|$0ADŽ$DŽ$DŽ$bG.Dd$'[H$H{(HH$:H+H$HH$>H&Yf.H\$Hl$HLd$H(H(Ht$,tH\$Hl$Ld$ H(H{(Hǃ<1Ht HC(txH1AHHIHC(@@HP ~@uHC(lHLH-QHHHl@AWAVAUIATUSH'Ht$`H$dH%(H$'1t+H$'dH3 %(H'[]A\A]A^A_IELP(]FLH$fH A H$1PIIH$%H$#H$+H$H$D$T H$H$ND$11I:E11ɺHHD$h|$IHT$XH$ۃ6At ؃\HL$XIEH$PHDŽ$PHDŽ$X1H$HDŽ$`1H$H$ HDŽ$hƄ$pHDŽ$ LHDŽ$(HDŽ$0HDŽ$8Ƅ$@H$P HcH\$XH$H$PH$ AH$H$H$H\$@H\$HH$H$H$LHL$ H$D$ZAIELP(IIE1Ht$HLP IEH$#LP$#$#T$H$L$ 1H 1ۍ<~H1IE1LLP D$ T$AA9IELP(HD$D$H)D$LD$@1HL$H|$hHD$xJAKҁL$4T$HcD$H9D$ HHT$ LH)HD$HT$(H$1HD$IEHt$P H$H$1L$H$@HH98tH$%ۉD$ HD$(SL$AE1T$tH-HD$8DAIA9AD$s[AċL$ A;uD9|$4\wHt$Dd$AA HD$HE)HH;t$McHNLx ED$|$E1IEHt$1Ht$xLP HD$HH$&t$TH$HDŽ$HDŽ$HDŽ$HDŽ$Ƅ$ H$H$1IE11LP E11E1H$HL$XH+$LD$XH|$hDH;$X1H$H$%LwH$% H$Hf H0HH9u9\$TAFH$TH|$hAddUHT$@H$LIEH4J1P |$TtQ1IEH$%LP1 H$%0 HH=u9\$TwIE11LP HL$XL$%H$#DŽ$D$ MD$HD$4H$D$HD$hT$ H$T$8\$4H;$XH$LLH|$`LHHD$(,L,D$IELP(HIE1Ht$@LP L.L.AIE1HLP D$E@AAD|$ A9D$@H|$hLH$H HHD$HLD H0HL9uLl%9D$ 6HL$In@A@H@HL$ELHt$h@DH~HT$LD H0HH9uL%9D$ ALHt$h@Hw/HT$Hc˃ %2H %uݺL%9D$ ]A@H@HD$@A$D$H$D$D$9D$TGD$HD$@D$ D$##9߉D1H9%Ht$IE1LHP HD$8HH$MH$H$1L;H$%A;F D9|$t0HD$(H$H$1LH-H$H$8%A;F@D$A)H$L)$3H$DLt$AIELP(H$PH;H$ IMLHc4Q H$ AHcH)${IELP(HH$PH;H$ IMLHc4Q H$ HcD$4H)$t$8$H$t$ |$8H$1HT$`HHHX P(H+D$(1H|$`HHT$(H|$`L'cL$8$St$8$H$1t$8$H$zIE1Ht$XLP Ht$`HL-|$HH$ӃBH$,H$_9IE1H$LP IEI1LP xLHtA$tAlIDžHD$IE1Ht$LP IE H$LPDpEH$E1A!xAHE9UHEzuHu"GLuUHƿT$M4L$ T$ L$f9uU+E,M*E-D$TU/E0M.u2U3 E1E4E5D$H HH$IcHD$IHD$HIEL1H$P H@HuGLUHƿT$ML$ T$ L$f9E U T$TUEMED$H$IcHD$I,IdIE11LP 111N5oIU 1/1AAD$T$TH$HH$C6HIEHH1LP H$?H$HHIE1LLP HH$H_?Rf.AUATUHHSHHX@H$0@dH%(H$H@1GH$ @HzGH$0@H L @H$ GƄ$I@LqHiH$ HH$ 15HT$GL.H&H|$H|1FHH|$1F+H|$1L$@H$ H$ @IHD$H$p>u|D$@EJH$ @-EH$0@ EH$H@dH3%(DTHX@[]A\A]1FH#@'fDH$ ^~ H$ @H$0@HIH$0@ǑW$$L AMtLL(AH$ ECH$ @&&H~ H$ @4AfH$ 1@h|9D$@fDH$ @H$0@sNfDH$ @KH$0@11?L$@HT$H$ @IHD$H$n<D$@EALDŽ$DŽ$ADŽ$DŽ$A;H$ @!Ao @ GHH1 #Ht$^:$ttjtQHt$LH$ @H$0@H(fDHt$@h7D$@H$P@>H$ @H$0@H觾H$ @H$0@DŽ$DŽ$zAHH$0@AHLHjH$ @}AHfDSHH HHtHHu؀VuDFH1!H [ÐSHH?Ht4{ u[HHCH4@H H;[&fD[ÐSHH?Ht HHCHC[ÐHx|$hHD$`t$@D$d HxÐHx|$hHD$`t$@T$DL$HD$dHxÐH\$Hl$HLd$H(HwHGH9HwHWHt H9HHHl H9HB{ trH|mH HIH3HtiHSHHRHHCH;H4@H H;L#HkH\$Hl$Ld$ H(DHtmH;HHIt_L#HkfD0F1@h2@h0HCHs%@hHD$0HD$7@h0땐SHHCHHD@HHT$HHT$HPHT$ HP[ÐxLL$ Ii1{CfDAA1fAAG΃ A }wG}8D$>uL9d$wHT$H|$ H=HND$ fDHH1[]A\A]A^A_HH[]A\A]A^A_AWAVAUIATIUSHX dH%(H$H 1HH=$=;j0HHD$(r=$1@=tXA;jAL苰IH$HMuJH$H dH3%(HX []A\A]A^A_ÐPfD@fDH=$tHD$0@AMLLLLl$H$|LH+T$0HHGHHL$TI)չ?jK4,91A;jfDH|$@?j贮L$L)I9IFHy@HT$@LD$HD$8ALLH$IHT$8L)H9HBH$H9HHFH)H?jtH?j膳LLHL蕰HF$Of111%H$+DH$@L0L$@aAH$HLD$HL$ H$H$q;jH菗HL$ HRHƿjLD$L3Hƿi衭rH|$@HLHL$ LD$L華LD$HL$ [[AWAVAAUATUHSHHdH%(H$81HHT$ (HE1E1L|$0II L9eHEJ(D93uH tlCbH|$ H=4H HL$H|$ LH˙H HT$L'H h:Fl@H}tnHK1HL$I9Hi H H Ht$HyHT$HL$茝HT$HL$uvH KH H( )HHD$HD$(CHD$HKH  H|$(H[fDHH9UHE+HD$DH|$ LL H!%tH LDHJHDHL)H AG@H$8dH3%(HH[]A\A]A^A_H HHL$HL$uH HT$(H HκHHL$PHL$uHο@h]XH 1HP kH|$HHz%@AUIATUSHHtTE11DHI I9mv7LI]H HtCuH HtHPDHL[]A\A]fDATI USH1H@@H$ H$( 蓧HHGq;tKHҜ=vH@@1[]A\@$xG$$ {=t ;HuH$ H LH@@[]A\f$$ fDDŽ$ DŽ$ HH{SHH?Ht 迨HHCHC[ÐH\$Hl$HLd$H(HwHGH9HwHWHt H9HHHl H9HB{ tjHi >HIH3HtaHSHHi HKH;Hi TH;L#HkH\$Hl$Ld$ H(ÐHi H;QHItYL#Hk˾0F1@h@h5HCHs5@hHD$HD$E@h뛐SHHCHt$ HHi HH[Ð~:HcʃHHHHLH)1P1PHH9uv6wDu-HH@u H҉uffffff.L 9$USLEf77DD9rt_H$f.H4At.DI43AI.vLB1u7u[]DEu7fDU1SH-$Uv$~ H[]D螤HHHA$tr腤HH3$tlHHf҉ցƀEHH9Qu1fHuH1[]É-׾$YH߉-ľ$H$6f.$SH=$H{$$uHt贤HېtH[饤D[fffff.HHHƃH9fD@u1Ht@Hf.HfH\$Hl$HHHHHHl$H\$HfDATIUHSHӋ 9v[1҅ɾt'@D3TA9sEH)I<4Ht5HaE[]A$A\Ds^1҅t*fDƒ 3LA U9s H)I<4H43H[]A$A\uJf.t;‹ 9LtA$ f.‹ 3LA u[]A\f[]A$A\AUATUSHHhDEHcL 3$H DHcHGDDuHH$Ht$Ht$H$DEIc L%޻$LXLۻ$AL݉L)E At^ɉtZHcI H Hc|t,DD)AIvLC<D19Hu I9Lt+IfHT$ 1HHHh[]A\A]DB|;H;ϋ:DHcL $ALֺ$HHLHAȃDT LGHHL$McI)HJDO6@AIvLC HHL9t(@ A uHHL9u؋L 9ffH(DHDL$E tcHcL$HHHH|H)@At'D)ʍHv H4A2HH9uAWAVAUIATUSHDEuHĸ[]A\A]A^A_DGH$DŽ$ H$$D$D$D$HgL%$L=$ȺL$ zȉҋ)AA+Hv H AH$HLL$,$9r)ʼnҋAA+Hv H AH$HpLLa,$t$9s@t$LLLLAH$4H,1&L$ D$LiUHSHHHH$H$H$ HH$ HHBH$ H$H$H$ HHHH$H$ H"HHHH$HHH$HqHĸ[]H\$Hl$HLd$HHu tBD#Et\HHHHubǃH$H$L$HfDEuHHHH@HXfDLHH$LH$ HHH$ H$H$H$H$@H$@HH$@HHZH$ HHGH$ HH4H$ H$@H$GH$HHH$LLHHH\$Hl$H8HHHqHH$HHHH$(H$0H8H\$Hl$H81Hu$H$0H$(H8f.HH$HH$HI$t\$fUSHHt$H$@HH]HHRuHĘ[]1tGATIUSHu@LH߽0HHHHLHH\u[]1A\Ft[]A\USHHDDŽ$DŽ$E HHH$ HH"H$ H$HD$ EtmHH$ HH$ HH$ tb$$tXH$ HHĸ1[]ǃH$ HHĸ[]fH$ H4$1tD$9tt$HHH%HHĸ[]D1EtGfffff.HHHƃHH9f@Lu1Ht@HHf.HfwfD1t'Ћ кp@u9u1ffffff.19vfff.A9wDƒ9s9vDEtk1AЃJ BDD9st9A ;HvH ɉ2uÐDEt\E1ɉDALA+vE0A9sEu DHt‹ utD‰uu@fffff.tgAABA)DuQv:AfD@N DEAB %AADwҋG%GÐwfATIUHHSHPJ$]~6HcHl@L0EHLHD$HP[]A\ffff.H\$Hl$HhDHHEuDDEuH\$XHl$`HhFH\$XHl$`Hh@+HHHH$D$0H\$XHl$`HhÐtcAA)w 5DDD@DL DA %AD9wЉ,DEuDUHS1HXH $t,fDD$H%DQ$uډ]HX[]H\$Hl$HLd$HhE1H1$t l$AHHHdEu'u!ǃH\$PHl$XLd$`HhH^fff.HDAwUviEtT1DAF DA DF DA9sۅtA1DEB H@D1HfDu 1H1fDAVAUATUHSHHHpHHH$EeH$ DžHH$ AJDh2@@t HHEE9HA$ 11D9vDD ƋE1D9vDDҋAA!քfEvHHE9kfHp[]A\A]A^H\$Hl$H8HHH`Gw:I@HHfD9w(HH9r 1f1fDfDf.UHS1HXH]HHHMufHH5t#t-H}HHuHH#HX[]fATIUHSH`GHH$ It$LH$ HHLHH$ H"H$@H$ H$@GH$LKH$H$@FtH$GH$@H$;H$HH[]A\ffffff.AWAAVAUIATIUHSHHX{LHEtkfDE1Lt%HAOLHAt&ADsHHLHDAD9}sHX[]A\A]A^A_ffffff.H\$Hl$HLd$Ll$H`GIHHIHHAHH6LH[GHNu(H$xH$L$L$HĘH$ HڹGHLLHHiH$ HiuH$ HuGHܐAWAVAUIATIUHSHH8@dH%(H$(@1HH9AE@uDI@HFHEHt$ HPD$tdHt=LE1HD$HT$Ht$ HHL$IHL$H`L9wׁ|$?vIELDmH|$ 1@THE11HP H$(@dH3%(uH8@[]A\A]A^A_fff.@Hu1Ht@DHf.H\$Hl$HxHHHH܊HHHHsHHl$pH\$hHxffff.UHo`1SHHD$@H<@HH<;THt$HrD$<D$vH[]ff.AVIAUATIUHSHƄ$1Ll$`DЈ$9}GH<@H$HH<8$<uH$L$@HcLLH/Ƅ$1DDHHHt]HU$H$HD$D$$9\]H[]A\A]A^HcHffffff.AVAAUATIUHSHHƄ$1Ll$`@Ј$D9}FH<@H$HH<8$<uH$L$E1DIcLHH<@H$AHH<8fE9Ƅ$1DHHHt H$H$HD$D$$A9GtD3H[]A\A]A^f.HUHSHWdH%(H$1H$WtCH$H41TшLTLHH9uH|$ UH|$ H8H|$ H1HH$H$dH3%(u H[]蒉fATLf<UHSH@HEHL9u[]A\ffffff.1LFTFHH uATIUHHSHP$Et*HXЃ v)PXvPXɃv vHPH[]A\fLHL\$DfDEtJEIfD LAAAE@GDHuIAuAJtf.UHSHHH$4H$HdH$HtoH|$PHH|$PHE@H$HH[]ÐAVIAUIATMUHSHHH$dH%(H$1H$LE1H$@H$Ht H-IHaH$HMtHL茇LTH$H$jf.H$H$KH$H$H$@H$tH$H|$LHHH!%t¹Q3FLDHSHDHH1H)A虇I|$H謆ItHH$-H$@H$H$dH3%(u-H[]A\A]A^H$LH辅fffff.IH1HI1H1fffff.t7DG1Eu, ‹4u9vf.1fff.AVIAUIATMUHSHHH$@H$LE1Ht HńIHH$@LHMtHL!LH$\H$DA$AT$Ht$LI|$BHcI+>HH@+1. $t)Dd$EtFfD‹,u79s1yH$@HĐ[]A\A]A^f.L$L1ۅtȋ\$PtD\LEu 9s$1ۅtD$Et'DEu9vUDH$H$H1.@H$@LHpjff.IHH1IHHH1AWEAVEAUATUSH@HH4$D$@DŽ$P t"H$P E1ȶH|$ n$P tHvH$P H|$ 1臺u01H|$ /Hĸ@[]A\A]A^A_D$4H$@HDŽ$@HDŽ$@HDŽ$@HDŽ$@Ƅ$@ 1DH$@AH|$ LH$@uH$@LH$@D$ 1ۃD$vH$@8EuD$ |$RAHDŽ$P@HDŽ$X@HDŽ$`@HDŽ$h@Ƅ$p@EAL$P@A,AIL$P@AfN t1 IWALHE@ =HI9vEA]L} t uIA uIA uHH$P *mH$P H|$ cfD tHtEHJu"HՃ uHEI)/uًHՃ/uBHDA"*LzID8"cH<$L貌L"H$@ IH$@  |$AH$@13H$@H#mL$P@HDŽ$P@HDŽ$X@HDŽ$`@HDŽ$h@Ƅ$p@H$@1<3H$@L2D$H$X@H$P@H?HH?H$@jcHL9AGIH$@1L$P@2L$P@H$@L2H$X@H$P@H$@eAD$ L ؃HHՃED$ D$ H$@HHp1L$@IL9Hct$ HcL$P@L$@H|=H1Ht5DA0E8IHIHHHDI9CwI)IC*D$ kx\YxD$ D@h31CxAxD$3L$P@HH$@ H|$ @H~LHHܐAUATIUSH~HøHt-HSI9s$HE1퐋{Hu9{_tAH[]A\A]f;H֎tAfDHI9rfff.AVAUATUSHHD ,dH%(H$1D;$,L$IcIf(,~;DBHL0,H,H$LOH9LL9@>HuH$HHF,,~?H0,H1H0,H8L)HHH,H@<9,,AHD9$,JH$dH3%(uH[]A\A]A^zff.AUATUSHHD ,dH%(H$1D;$,Ll$Ic(,~;DBHL0,H,HLOD@H9LL9@>HuH8,D@,HHG@,~>11@H8,H,Hc HHH H0, 79@,AHD9$,EH$dH3%(uH[]A\A]Oyffffff.f.AUATIUSHH~tbDoTEtGID$H1 ID$HAHK sLH{LK(IHKMD$@_RA9wH[]A\A]DohfAWEAVAUATIUSHHT$DHL$ 9F…D$HD$ 1DEt$ƒ=FM%LE1HD$(D$1HHD$0@@NzHHD$8KHD$81EHuIL$`AT$TAt$PH|$8OpH9l$0IDHTmHL)H|$HITxI|$p@EHD$xHD$HH9l$ v]H0L9sTHIKD$HD$DLHHD$(IDL9\L]@I|$pHH[]A\A]A^A_vHLHD$HD$^fDHD$ D$[H|$8HrHyDHH?u@UHS1HDH|HtHPHHuH(WxHH[]HHHxfffff.AUIGATAUHLSӺHH詳Ha1H1H H uPHuTHHHEtHH HHHE HMPtj11EtHH HHHEH HEtHH HHHE HH9]Pw1H&AĉLpLHHHEHsUC豉LHމLoHgHH[]A\A]HHQHvAWAVAUIATUHSHHH$ Ht$pdH%(H$81tH$ L4'DH$ D$AZH$vbH$ EЈ$*H$ALE1IHHL$`EpHl$hD$DQfD( uHH蓭LHXI$D$D|$DcDL1ILżu|$D^HD$pPD$HuD$DT$D9T$HLD$HD$H=)D$HD$D1Lcl$DH$Hcȉ$HHIIHHD$P6HHtErH}Ƶ|$DHD$x蘈|$HNlAL$LAL$H$AG1Dt$D<$m( tHIH|$pL$H$L+ILD$H$u$@hnHt$xH;1H$lo%H$]%AHAF9D$H$DŽ$L$HD$DL$H$AGDt$(D|$ L$D$1D|$D<$kHD$pVuDFbH1xH$ H$8dH3%(HH[]A\A]A^A_H$1@hN$@ DG1 HT$p҉T$Lt-1@H$t$HHiH,H<9<9\$LwًD$L|$DDŽ$HD$`D$\fDHE1E1E1@SaH;LHLHPHcL9tL1H)LHD$8jL$8A9DLAMHD;|$D|E1DEt$L=DOEE11#DH(pEpA9ADHH$)D;t$\DDDHiH,H,HL$PH‰,D|$L,L,H,L$D,L$H,iH9A9rH(nt$H~EL$L|$PIcD$@@_I>HL=D$@IMD$@9D$HHt$xH|$`8HT$pÀTu$9$tHT$xHt$`G諤$|$DMcLl$`HL$pT$a1탼$D$DT$HDD$fDHHD$h9$$HL$hHt;l$D|HHP(HIjHIt$1HP DHDH*D$DHHs ] HT$pMD$H$E1Hߋ1ZE1䋄$DH谭AA u!L/3D$HL$D)L$HD$DdD$HҍD$H`H$DŽ$DŽ$DŽ$nlddGȢEH$fHH;\$`sIH;:uLYL/2LHgH$ HGnHkHHgHѐfff.AUHIATUSHHH@uH$0 H踂 fDH$0 @h~HVH$0 蹴IH9H$0 1HgtH$0 1ɺ1MHBFkH$0 H1yDG1m1HH趢L`1HLծ11H9 Ń uATH$<@MHE1A迾9$<@tFH$0 H@h肻H$0 1Ҿf4F膎H¾DFDF1蒫HHH@[]A\A]HH޿@h芿HH@[]A\A]HHH)lAWAVAUATUHSH Ht$(HH$H$L$[HT$@dH%(H$ 1螀H$HH*GHWH$L$L9D$3GHcH$ rH$H$ sHDŽ$HDŽ$H$HDŽ$H$H$ 1HQtt^Ht$(H$H$HtH$tH$H|H$?H$ 2rD$ D$D$3Ht$(H$/H$H$$e$jH$L$8L$8H$HH$H$H~H+\$@GHHH)~H$DqH$H$oqL$`HDŽ$pHDŽ$xHDŽ$D$$M|D$ D$4D$HD$HH$1Lr|$|$3H|$u3H$DŽ$pDŽ$tDŽ$xn+D$L]9H$\H$LH$1XH$HpH$1I5H$蘦H$$~H$$d1E1$H$EA ă uHD$(MFH$H$E11ҋʹD;$Ls/H$RmH$- 1H$4F\wH¾DFDF1hH$0 1Ҿ|H$0 H@hԣH芏HH@[]A\A]HHqHTfAUIATIUSH8dH%(H$(1HDŽ$p"H$pLHGi@ͺHH3HH$p`H)HHiHp`GH)hH$`@[H$p`H$`@[HDŽ$ HDŽ$ HHDŽ$ H$`@1H]t:Hz81HuHH9H$pHhhL$p$p H$`@[H$0 H$0 1L%h:F1aH$ H$0 H1ۃH$0 ܌H$2H$LL?H$B*;yc;0L@hVH$0 )H$(dH3%(H8[]A\A]H$`@ZH$psH$pLL H$pC닿GHH$pHH$0 荌HQOHH$`@H{YHQH$H3뷐AWAVAUATUSHHXH$Ht$HֺL$KHHD$ VfH$9xH;D$ HHH+D$ GHHHHfH$ DŽ$`XH$H$ XLl$PHDŽ$` HDŽ$h HDŽ$p D$HD$8H$ 1LZ ?PHt$HHgLH輈u8HtHEHPL}Le(aL;d$ wLGL3mtL$1HH߅AtT$WD$AtDH;C.McLLI HLH;H/Ƈ Hdf.H#Hu HEƅT11HP L:vL9IAE1A<$ `tA$I0AAM9sOEfAPL{EM9$`H$`L|GHDŽ$@ HCH=( CHH@{LH|H$P HDŽ$X@HDŽ$`@H$P A@H HI9žLLL1jLCfHCL$@ =CP09H$0 PoCT;KT6KTKX/KT1ҸHHCHLE1^HtLAniL9HEE1{Tf@h趒H$P H1?HH$@ HYSP1HHDH$p@lH$p@rD9cT=EH$p@EeMAG1Dd$D4$1:( AHHLyH$0 L$H$p@IHH$P DŽ$X@D$H$*$H$p@@h譕$@ L}LeQkAM9wLZL$@ L/HȀ[]A\A]A^A_ÿDG1H$pSTsPH$p1=H{HH9{PH$ HC(DŽ$L HDŽ$8 fH$@ H+$8 E1E1H$( f+/DHSHH$ HH HHH+H}HP H$ LcLAuRLCHL  M9tH$ L1L)L8LCHL;$( H$ ALO$( H$0 DHE9ELAD9kPH{(Ht's{uIsH<"HHC(DH[]fH1[]DCQsH<="HHC(HfAWMAVMAUAATIUSHHEL9{8t#H{0Ht&J<!L{8HC0MtPHK0Hs1AHI9wHC(4H;1fA1HI9wH[]A\A]A^A_DkHC(MAl-HC4tHK0DL1L -AVAUATE1USHH@`$ t@HE1*t#?tEu( AHuE1fADtL$ H$@@H(`EL LH.H$0 -H@`[]A\A]A^f.1H$0 H-H%@AWAVAUATL$ UHSH X`L`ƅaL10H L .1Y$ IE11D$ D$ 0@|$ D$ \$ L$ ADA( AIt**t?uD$ XBuA$ XBt몋T$ |$ ƅaH|$GAMH|$RBB|A(J( H|$ :H|$>GHI#AHt$LI\/B|AtiDŽ$ H []A\A]A^A_fDH(`L|,¸u5 H'뭾LBD_AGL-9{GL"."@SB|@Jtfff.H\$Hl$HLd$HU1uH$Hl$Ld$Hf.H$ E1H^@uZD HHHȁL$ Ht.L$ 1ALtE[f}tSHaHtL+HaHt Han HLKTHA@hpH$ H$ L$ H ÐfDH\$Hl$HLd$Ll$HLt$L|$HH@D$ EHc HƃpHhH,efDH\$Hl$HLd$Hh1HHH1tUH H HI H8HH H8HH@!HL)H`H`H\$PHl$XLd$`HhHH_HH\$Hl$1Ld$Ll$H8HIHIt|"?*/etcyyyymmddhhmmssYMDHISWAEN/etc/rar/usr/lib/usr/local/lib/usr/local/etc%04u%02u%u%03u%05u?*<>|"?*HOME1F2F2F2F3F4Fi@j@e@l@p@d@4FileP;h4F Creating %-56s%u.%03u OKtemp..%.*ls(%u)%ls__rar_bakQOCMTstdin Locking archive Reading comment from %s Reading comment from stdin Deleting comment from %s Adding comment to %s@P@@@0@@X@@@@%@ȯ@7F@@0@Љ@p@0@7Archive0A=A=A=A:?A?A?A?A?Ax?Ar/dev/urandom%u-%02u-%02u %02u:%02u:%02u,%09u%u-%02u-%02u %02u:%02u????-??-?? ??:?? %s: , %c Cannot open %s-------- %2d %s %d, archive %s -------- %2d %s %d %02d:%02d:%02d %s Enter password (will not be echoed) Enter password (will not be echoed) for %s: Reenter password: ERROR: Passwords do not match [%c]%ls User break Program aborted %s A$A$AAAApAAAxA`AHAA0AA5hW9~<x?i7}],煼/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[                                   UOW\??\/??/ %s - use current password ?_Yes_No_All Testing %-56s Skipping %-56s ------ Printing %s Extracting %-56s %s is not RAR archive All OK Total errors: %ld ? %s%s Done.part1solid  Creating %sarchive %s ... %-58s Testing archive %s Extracting from %s ... %-56sFileCRC32BLAKE23.05.0Unix %ls%cB<-><---->%d%%NameSTMTypeTargetSizeRatiomtimectimeatimeFlagssolid%ls %ls:#%d: %ls RAR 4RAR 5%s%sSFXvolumelockEOFDOSOS/2Mac OSBeOSWinCEServiceDirectoryCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2Windows Attributes Size Packed Ratio Date Time Checksum Name ----------- --------- -------- ----- ---------- ----- -------- ---- Attributes Size Date Time Name ----------- --------- ---------- ----- ----%c%c%c%c%c%c%c%c%c %12s: %sNTFS alternate data stream %12ls: %lsUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referencePacked sizeAttributes %12ls: %8.8XHost OSCompression %12ls: RAR %ls(v%d) -m%d -md=%d%s %12ls: encryptedFile version %12ls: %uUnix owner %c%10ls %9ls %9ls %4ls %8.8X %02x%02x..%02x ???????? RAR 1.4Archive %s: %sDetailsvolume %dencrypted headers%.10ls %u %21ls %9ls %3d%% %-27ls %u %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu*<-?->&B"-B-B,B,B,BIFIF@KFtGFIFJF(JFpGpGpG..sBtB}tBOtB!tBsBsBsBksBCsBsBHCCCCC0CCCCCC0CCCCCCCCCCCCCCCCCCCCCCCCC @   (08@P`p @   0@`  0@`   (08@P`p@` [:<S>] Set priority (0-default,1-min..15-max) and sleep time in ms Usage: rar <command> -<switch 1> -<switch N> <archive> <files...> <@listfiles...> <path_to_extract\> <Commands> a Add files to archive c Add archive comment ch Change archive parameters cw Write archive comment to file d Delete files from archive e Extract files without archived paths f Freshen files in archive i[par]=<str> Find string in archives k Lock archive l[t[a],b] List archive contents [technical[all], bare] m[f] Move to archive [files only] p Print file to stdout r Repair archive rc Reconstruct missing volumes rn Rename archived files rr[N] Add data recovery record rv[N] Create recovery volumes s[name|-] Convert archive to or from SFX t Test archive files u Update files in archive v[t[a],b] Verbosely list archive contents [technical[all],bare] x Extract files with full path <Switches> - Stop switches scanning @[+] Disable [enable] file lists ad Append archive name to destination path ag[format] Generate archive name using the current date ai Ignore file attributes ap<path> Set path inside archive as Synchronize archive contents c- Disable comments show cfg- Disable read configuration cl Convert names to lower case cu Convert names to upper case df Delete files after archiving dh Open shared files ds Disable name sort for solid archive dw Wipe files after archiving e[+]<attr> Set file exclude and include attributes ed Do not add empty directories en Do not put 'end of archive' block ep Exclude paths from names ep1 Exclude base directory from names ep3 Expand paths to full including the drive letter f Freshen files hp[password] Encrypt both file data and headers ht[b|c] Select hash type [BLAKE2,CRC32] for file checksum id[c,d,p,q] Disable messages ierr Send all messages to stderr ilog[name] Log errors to file (registered versions only) inul Disable all messages isnd Enable sound iver Display the version number kb Keep broken extracted files log[f][=name] Write names to log file m<0..5> Set compression level (0-store...3-default...5-maximal) ma[4|5] Specify a version of archiving format mc<par> Set advanced compression parameters md<n>[k,m,g] Dictionary size in KB, MB or GB ms[ext;ext] Specify file types to store mt<threads> Set the number of threads n<file> Additionally filter included files n@ Read additional filter masks from stdin n@<list> Read additional filter masks from list file o[+|-] Set the overwrite mode oh Save hard links as the link instead of the file oi[0-4][:min] Save identical files as references ol[a] Process symbolic links as the link [absolute paths] or Rename files automatically ow Save or restore file owner and group p[password] Set password p- Do not query password qo[-|+] Add quick open information [none|force] r Recurse subdirectories r- Disable recursion r0 Recurse subdirectories for wildcard names only s[<N>,v[-],e] Create solid archive s- Disable solid archiving sc<chr>[obj] Specify the character set sfx[name] Create SFX archive si[name] Read data from standard input (stdin) sl<size> Process files with size less than specified sm<size> Process files with size more than specified t Test files after archiving ta<date> Process files modified after <date> in YYYYMMDDHHMMSS format tb<date> Process files modified before <date> in YYYYMMDDHHMMSS format tk Keep original archive time tl Set archive time to latest file tn<time> Process files newer than <time> to<time> Process files older than <time> ts[m|c|a] Save or restore file time (modification, creation, access) u Update files v<size>[k,b] Create volumes with size=<size>*1000 [*1024, *1] ver[n] File version control vn Use the old style volume naming scheme vp Pause before each volume w<path> Assign work directory x<file> Exclude specified file x@ Read file names to exclude from stdin x@<list> Exclude files listed in specified list file y Assume Yes on all queries z[file] Read archive comment from filea2C0C2C13C2Ca2C0C0C2C0C3C2Ca2C0C0C2C0Cf3CY3C2Ca2C2C0C2Ch=CC7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C>C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C7C>C>Cu>C7C7C7CL>C7C7C#>C=C7C7C7C7C7C7C7C7C=C?C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C?C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C9C?C?C9C9C9C9C9C9C9C9C?C?C9Cr?C\?C9C9C9C>ClBC;CACJAC;C;C;C;C;C;C;C;C7C;C;C;C;C;C^@C1@CCCCC|1? 1?X1(@1X@1x@1xB2B@2(Ch28C2C2HE2E3E(3FH3HFh3G3XG3G3H4HH 4xH84HX4I4HJ4J4K5K5L05(LH5HLh5XL5hL5N5(N5hN6N(6hOP6Op6O6P6Q68R07R`7S7T7T7T8U(8U`8Ux8V8(V8V8V8W9W 9WH9Y9Y9(Z:Z :Z@:([h:(\:]:_8;hc;e:He ;xe;fh<g<g<Hh=h@=hX=hp=i=xi=i=i=Xj=j(>j@>jX>Hkp>xk>k>Xl>Xm?xm8?ph?r?t`@u@xv@hxAy8A8z`Ah}A~Ah8BH`BBxBB0CX`CCءCPDDDز EPEصEEHXFxFF>H?@ @ؿ8@8DxFFx G8GXpG(GGGH8 H8`HHHIh@I`IIxIG((JJJJ8KhK0KHK`KHKLhPLLLLLhLxM(M@MXMpMHM(NN8HNxhNNNNNO@O O OXOH@P(PhPQPQhQQQ8Q R8 8RH!`R!xR!R#R#R$RX$R$S$ S$8S(%PSh%pS%S(&S&S'Sh'T'(T(@Th(`TX)Tx)TH-T-U/@U/XU/pU/U2Uh4U(5V5@V5XV5pV6V(6V86VX6V6V7W8(W9`WX9WH:WX:Wh:W:X; XX<@X8>X>X>X?X8BHYHB`YHCYCYE(ZF@Z(FXZhFpZFZGZ(GZHGZXG[xG[HHH[Jx[K[HL[hL[L[L\M8\hN`\R\xS\T]U8]X]Y]Z ^ZH^[][p^(\^X\^\^\^]_x] _]@_8^`_X^_h^_x^_^_^`_0`x_X`_`````(a`Haaxa8aaXaaxaaaaa(ba8bahbbxb bb_b`b@bcXb(cpbHcbcbdc8e0ceHcehcxlcmdrhdxwdzd{(e|XeeeHeheef(fpfȗffgȚ(gxgȜgXghh8`hXhhh(ix@iXixiHij j88jXjjxjjȮj(kHkkȱkkl@lhlطlllm8 mؽHm`m8mmxmx n8nhnnnnn(oPohpoXo8op(PpppqxqhqXq r( xr8rXrxs spsXsHshs8tPtht8ttt t u(#@u$`u'v)w7hwh7wx7w7w9x(:(x:@xxhB(yFxy(LzM0zNXzHOpzXSzTz8TzT({hU@{U{V{W{HX|]h|^|_|`}d}d}e~e~e0~f`~(fx~(g~g~h(ihi0kX(mprw@ȀȁHH`ؑ؁Ђ(0ЃاXȫ8X0x`XsuupvvHvhw@|h0XHPXxxȇX8xH Ј  h H ` xX ( 8 ؉H X  @HxXXX(Ћ,x-@x/0(14(5Њ6@86x7777(8ȍh88 9P9h8::;Ў(;=8(?h??@ЏH@@@XA@A`AxAAhUXxUpUVHVГVV W8(WPhWpxWW8XȔXY(HYHYhYHZZZ[08]`]]] ``axch8deȘgihm8oq`qxHrrrК8sht(8uPHuhuu8vvv8xHx(hzxz{}x~@XHx(P8pHH8pȠ8ȡP(@(8HЖXhxHh((xP8Ȥȷ`X8Ph8ئh`Xhاh((@XXhpب(H(XЩ8HتX(h@hȬ(Phxh`xخX@X  (hHhȰ(H #(#8#H#0X#б##$$0$H$`$xX%h%%в(&&@'x8(X((س()@,,12 H2@244x;?0?H?hH@@HApBxHBXBBзCCD0(JNиHNhNhO8P@xY__`h`@`a (b@bX8c8dhdػee(gXhhiмo(pPhqhqtwXyzоXxhпp(ؑhx((xp8h@ظ( xH0X88ȻXpXh @h8XH 8x(xhX@h@H`HHH(hP(88x(XH0xXh(H(H88 X%* H+x++h+8,--H8.`/11(2x3h3355 x6Hh=BB xGp(HHQQH8S8TUHWX[H^ ^_``Haabb0chd8dxdddeHXghi8kl8m`Hnno(oo phq8qxqqqqrr(Hs@sXHttXuu8v(vP(xxyyz8X{H|x}} ~@x~p؁HxHȂ(`ȅx8HXx(( (`8xȔ(8XȖh(0س hxXHh8X8`(( HhXxX0pXh(@h( h(@HXxh Pxx Xx8h(@Xxx x ( h( X  8PxzRx (:4*ACe$T,MI0Q H |LMD AC$@BACO M Q O AzPLRx.@ 4$ZHBCFCF + AOA $T|MN0Do B |hD SpJN0Cx<BBCA CA(CD0y (A ABBF  4 BCACA CD0  AABC Dp#\"t*ACe%AKXHAJ|$<MI0Q K gWD K$$HMIPFy K 4LHACACGPa AAA |H@8GN Fe G LhmBBA CA(CD0| (A ABEK D(C ABBLqBHBB A(CA0C} (A BBBF D(A BDElDACk A SAAC|DM DM(DX0 8 $0<(T0 l(4BBA BA(B  ABBF h*4D49N FdTl;N FfQHR CsXQHR CsDP A XDh A  JAFB$,(AJ_ F SDTXBGC A(BK  ABJI M  IBJF JACr J IACU4CBCECA CG@  DABJ 0NMI Fm4`'DV F F$TpMI IH I R|&ACa D[DM DP$, _N Cs L N$T 0zML@QO$| mMN0IHT BCBCB B(A0A8CG 8A0A(B BBBK  8 AC[, 8BCAA  DBD dL BCBB A(BA0C (A BBBK d (A BBBE f (A BBBC  #D^< (yBBB CA(A0Cc(A BBB< hqBBB CA(A0B\(A BBBL =d =| a P a$ MLCl H  `  X $ P MI N\ H , GLD vDT  @HBBCA CA(CG (A ABBA L  BCBCB CA(CA0EGEc 0A(A BBBE  pN Fy C 4 ACD R AE [ AD r AE L< 8BCBDB CB(CA0CA8CD@} 8A0A(B BBBH  x/ d BCBCB B(A0CA8CDp 8A0A(B BBBE D 8A0A(B BBBA $$BACO M T L ALdYDP$|DAGG Q G I ,M^g B PD8AGo 1AHO H P,+DM G N$LMLC A t1ACQ K P+DM G N,}ACD h AG | AA 2AFY H E -8ACI$<8lIN Cw G ,d:MMN@M A 4DR J S,>MMNPPk E #D ^D X,AFUL d$|MQ[ B P $H2ACGeA$`xHMI CE A $ rAHD G AK 4*ACY K AT DZ$l8:ACO M M K A$P,MI0Q H T HBBB CB(A0CA8Dx 8D0A(B BBBA ,|ABABLb AAA LDP5BCBB CB(CA0A8G@I 8D0A(B BBBH @8$0ALQH| AA VGI A 4HACG{ AI O AA Dp\h&txyGl A YGL A lG_ A $`ZAGGD AA L,BBCB B(CA0A8G8D0A(B BBB$|hvACL _ AA <BHBA CG(EGp(A ABB TGG A ` TGG A $$ ;ACGAnA,T &HACG AA ,!q=HMOCB G ,"ACABGl AAD $*:ACO M M K A *)DdT$X$gHBBB B(CA0BA8CG 8A0A(B BBBA <|'HBCAA GЂHA  CABC )YBCBCB CB(A0CA8CDP 8A0A(B BBBJ Q 8D0A(B BBBJ T 8A0A(B BBBJ Q8G0A(E BBBTLh*BCBB CA(A0G@ 0F(A BBBA G0C(A BBB,*>ACK W AI LA$*`HU C^ B [$(+`MI0R` H $`+ <X+DLT`+0Dklx+jN KL+MN Ft++{,X,JACD T AC hA x,$,<,ST,+l,p)Dd,,AMS G c E T D T,h-HAACD ~ DAE 8.ACI,$8.\HHLX@C A TTh12HBJBB B(A0GH8BGf 8A0A(B BBBE 3Dn,3M[GЀ+ F x.Di$VMN0Dr4L`4PHACACD AAA <4fHBCAA CIp  AABA ,5}HMMIpF D ,X7<HMQAC A $$h8HMN`C\ A lL8!HBEBCB CB(A0A8CDy 8A0A(B BBBA  8A0A(B BBBI $;HMI`JX H <PACN$><>T>AGC E N$t>ABF k AK \>AACD0g CAD Y AKC h CAD a ACK WCA>8?V,?HU[TedL?wBBB B(A0A8CD 8A0A(B BBBA p 8C0A(B BBBA D?ACACD p AAB q AAE aAAL?BBB B(A0A8DY 8A0A(B BBBA LL@ SBBB B(A0A8G\^ 8A0A(B BBBA 4@4BDDBF h ABG 4@BFFA A(F ABB, AhABACD@e AAA $DCO J VAAA/A?MD mD BBDB B(A0A8K2 0A(B BBBF TB 1+$lB81MNpIO E LB1BBB CB(CA0CA8BD| 8A0A(B BBBA $B2*MVpH G L C3BDB B(A0A8GY8A0A(B BBB\C5@LtC05BBCB B(A0A8CD@p8A0A(B BBB,Cp5BACA GABLCP6BDB B(A0A8DhQ8A0A(B BBB<DD9BECB CA(A0C(A BBBD:Y,D:ACACD  AAI $D;pARACWA,DME>vF>F>BACo M A$ E $GGM[@Cw F ,GIACACJ F AAF $$HIMLa E LH(K4,dHPKMML c J ,HL_ACD d AC fD$H MMY^ J HN4$IOM[a B ,IP+4DIP)BFCA CJ  AABE $|IQH[C D ,IPS_LRQd G ,ITMMQPLn K JPV5,JxVACFCG` AAD LJhW,lI`WHIML0Jw A $IXXHN Gj E J8XmACd,JX.MMNPS F $ K[NMLPt C 4K\\AIB D ,TK\M^@G_ G $K^MQ@J A <JhaHBCAA CIP  AABA DJa@HBFBCD CA(CJAM (C ABBI ,BBB B(A0CA8CDHr 8A0A(B BBBH " 8A0A(B BBBD s 8D0A(B BBBE L4B9BPGE B(GA0A8n 0A(B BBBK FoLHBBB B(A0CA8CD 8A0A(B BBBI LPL\BBB B(A0CA8CDH 8A0A(B BBBI tD`NBBB B(A0CA8NN 0A(B BBBF  0A(B BBBA A 0D(B BBBE S LԊSBJBB B(A0A8DYn 8A0A(B BBBE L$VBBB GB(CA0A8CNP 8D0A(B BBBG ,|X-HLRD0- A , ZABACD AA4ԋZDAGCCD  AAE wAA< [BJBB A(A0CS (A BBGD LH^$dP^lN JS E m C ^N Ef G L_[ BBB B(A0A8CG 8A0A(B BBBA ,iQLQNPL A L,luBMBGB GB(A0A8CDP 8A0A(B BBBH 4|oaLIMQ@Ii K b F q)̍q%qVqkPr,,hrDpr\xrVN0Fi C |rr>AFZ G I<ryBDCB CA(A0B_(A BBB,swBFAA FcAB4$`sAACD0v AAG j AAD $\HtjMI I\ E tACUt*t LԏtIBDB CF(A0BA8CDP 8A0A(B BBBB D$uBBB A(A0CG & 0A(A BBBH ,l(x@ACAD GmAA<8xBGA CA(GG (A ABBG $ܐ|WII Cg L N|"DCC F Q$,}KHIMG r A $LBACO M U K A$|=]HACK M AE T8}mHBEB CB(A0A8DPV 8A0A(B BBBA 4~HACAD0Ia EAE $,8LMI0U F T`>ACD tALt0~BBB B(A0A8CD 8A0A(B BBBJ LĒ BBB B(A0A8CGA 8A0A(B BBBA P%,,h@ACAD IkAA\*t $_LI Cj N NFDCC F u$ܒHLMG u A GLЋBEBB CA(DA0JLo 0A(A BBBG LdBBB B(A0CA8CG  8A0A(B BBBC ,0@ACAD GmAA@$BACO M Q O A$, =HACK M AE TTHBEB CB(A0A8DPV 8A0A(B BBBA 4HACAD0Ia HAE $ܕ<MI0Q K 9MD gd$@ BBB B(A0A8CD 8A0A(B BBBG  8D0A(B BBBK LȞ!BBB B(A0A8CG 8A0A(B BBBJ ܖ%,@ACAD IkAA$Y<(T%D`4lBDA CG   AABD p)$MI PT F $MN0Fx G , ȩMV0Gl J  L ,<H^ABG Q AD U HK ,lxACACD@r AAH ,K\T0BCBGB CB(CD0CF8GL 8A0A(B BBBG $ MQJ4pL6d*ACeTFHBCHCB B(CA0A8CGk 8A0A(B BBBA D HBGA CA(GAC (D ABBG $ 1DlL<8FBBCB B(A0CA8Gb 8A0A(B BBBG $8AIK K P P <EL HHRS`S; E E K 0 E d|BNBCB CB(CA0CA8CD` 8A0A(B BBBB @8A0A(B BBBTdt HBCBB B(A0CA8CGDZ 8A0A(B BBBB , HM]AJk A -DhT HBBB B(A0A8CG V 8A0A(B BBBA $T@aACG@TA$|8BACO M Q O A,` HAACD P EAE ,ܛ!HMPI0C A $BACO M U K A,(*ACe$Tx6!HAHD@j AA D|K!HBBCA CA(CGw (A ABBA TĜHd!HBBB B(A0CA8CGAp 8A0A(B BBBA $pLMI0U F <:AHp4\AHACGl AAF yCAT@!HBBB B(A0CA8CG   8A0A(B BBBC ,ZAACG@KAAAC<h6dTMBBB B(CA0A8D@L 8A0A(B BBBK R8A0A(B BBBxԟp#LAF@T$BBCA CA(DPDh (A ABBF | (D ABBK 4|bBACA D@I%  AABC , MMI0D E h4_ACAD Hw EAJ DAA(AMD o,<X7ABACD fDA,lh MV0Gf H { M $H3ACL@aA$ġ`WACOBA8 <BBB A(A0G(A BBB\H5AGlL|hBJB B(CA0CF8CD 8A0A(B BBBH $̢(BACO M U K A,EBCAA GlAE$$ LMI0U F ,LACACI  AAA $| BACO M Q O A$@ <MI0Q K TԢhy"HBBCB B(A0A8GE. 8A0A(B BBBA $2DJZ4L "HAACG AAA ,|x /mHI B 4x?"HAACG{ AAA D"HBGBA A(CQv (A ABBA D4#HBBGA A(CJ  (A ABBG t 7MD e4 V#HAFCGB AAK ̥$LI Fi D _$ MMI0Q E 44ACACDW CAI xAALl BBB B(CA0CA8CD`n 8A0A(B BBBA XQE| F ܦ%HXdBBB B(A0A8CK& 8A0A(B BBBA N 8A0A(B BBBA $\_BACO M U K A,`"#HAACD z DAE $"#HMI mu A ,8#3#HMMQ\k F ,H%#HMN0DS A $D%#HU0JX I Tl & $HBCBB B(A0CA8DTX 8A0A(B BBBA Tħ(0$HBBB B(A0A8CDw 8A0A(B BBBF $*.M$HMLIY E TD+,_$HBBB B(A0CA8CG 8A0A(B BBBJ T.~$HBBB B(A0A8CGb 8A0A(B BBBA ]*ACe< 81BBCB A(A0C(A BBBLX])Dddp]1Dl|2qQFY$3VAKIAT̩@3$HBLB B(A0A8CG 8A0A(B BBBA T$5$HBBB CB(CA0A8G"[ 8A0A(B BBBA $t\LMI0U F ]:AHp,X=ACD@} AJ e AJ L>BBB B(A0BA8CG 8A0A(B BBBE $<CMI0I] D TlD$HBBB CB(A0A8GP`l 8A0A(B BBBA DīT*L%HBBA CD(CG  (A ABBI $Y^ACG@QA,x\l<D\BCBA A(D0N (A ABBE $`]CIQ HD ,8_BCKCA CABܭ_!AJUL`FBBB B(A0CA8CDP'8A0A(B BBBLa ,dajBCAA IVABT@a%HBCGB B(CA0A8DpiJ 8A0A(B BBBJ b $bvGU D ] S aT4(c%HBBB B(CA0A8CG"o 8A0A(B BBBA Ti%HBBB B(A0CA8BG& 8A0A(B BBBA $ܯnWG[ F d D LnBBB B(A0A8CG  8A0A(B BBBA $TsIEr H b$|snLN0H\ B LsrBBB B(A0BA8BLS 8A0A(B BBBI 4|%HABACG@s CAK L4x|g&HBBCB A(BA0GY  0A(A BBBA ,|}HRT V F $h~EAD`Y_ AA dԱBCBB B(A0A8DP{ 8C0A(B BBBA D8F0A(B BBBL<BBB CB(CA0A8G\ 8A0A(B BBBB Th+&HBBCB B(A0CA8G!aF 8A0A(B BBBH Ј*ACe< zBCBA A(D0GX(D ABB$D<MI0U B l4AHjDBCFA CIE  CABE L  FABC Գ$HEJ AD 4ACD FR AAF  CAA LXBGNa J Al6:MD dTԴЋ-BCACA ET AFF Q AFH C ABJ AAJ<,[BBA A(CD/ (A ABBA lȍ9xLXBGB CB(A0A8GHG 8A0A(B BBBF ,(ADCNAA$ؑMLIk C DYQCDdwQD` K , MAEACGyAA@4̶8`BCAA E~ ADA GAGD`pABACG CAH f FAC XFALd|6 ķ1ܷؕ$ x$4<xcBCACD DpM AAB$tNpFh D [ E ~(k,PACABDpBAA$MIpC[ D $ Dg E I G P A D4PBBB A(CA0CJ/0A(A BBB|RQC}Țv,0ACABDpyAA4BCACA CL AABLXBFBB CB(CA0CA8CD8A0A(B BBB$lȜMQHi A T$BBB CB(CA0CA8CG 8A0A(B BBBA h6SNCA,$ОUADCCD0CAADT!BCBB CA(CA0BG 0A(A BBBA D6BCBB CA(CA0CG0A(A BBB,ؠACAG` AAA ,,1BDGCA CYAB\-4t~BCACD DpE  DABC V,ļ@ACACGmAALBCBCB CA(CA0CG 0A(A BBBA DP \HtPDLBCBCB CA(CA0CG  0C(A BBBK ܽH@TH4&HBCBCB B(A0A8BG 8C0A(B BBBA <dBBCA A(D0C (A ABBJ D.BBB A(A0CG 0A(A BBBA ح<Э!BBA A(CG (A ABBA D<\~BBCA A(CD0Z (A ABBH T&HBCBB B(CA0A8Df_ 8A0A(B BBBM  ,b&HACABD r HAE DDذ&HBCGCA CD(BIpK (A ABBA p-DhT&HBBB CB(A0CA8G` 8A0A(B BBBA T&HBFBA A(CG (A ABBA W (A ABBA TT( 'HBBB B(A0CA8G'yW 8A0A(B BBBA $BACO M [ E AD8'HBBCA A(D0I (D ABBE 4'HAJG  AF _ AA L(-Dh,lP'HP KQ D { A $lMI0U F X,{'HLMQ[c H D (HBCJCA BA(GH (A ABBA DTx5(HBCBCA A(Gg (A ABBA T@ (HBBB B(A0A8CGO 8C0A(B BBBA ,h(HMYN B ;AHqTD8)HBBB CB(CF0A8CG+ 8A0A(B BBBA $X)HQJI D s$ GAHADBBB A(A0CG0A(A BBBDACVLdqBBB B(A0A8GF? 8A0A(B BBBA LtBGB B(CA0BA8CG  8A0A(B BBBA $RACA K A,8ACL>dg,|(BDC FABdBBB B(A0A8CD` 8D0A(B BBBE D8A0A(B BBB< AGACD D AAJ D CAA TTBCBCB CB(CA0BA8CD@ 8A0A(B BBBD L()HBBB CA(A0CG 0C(A BBBK LBBB B(GA0CA8G@N 8A0A(B BBBG $L.MI _ K 4|)HBCAA Fz AJE ,H )HLRQ@I A $<MI0Q K  7MD e$$ML@L,T)HM^ЀP G T|>BBCB A(CA0K (A BBBF X (A BBBI $p @AAD DsAA$ MI IF K $ ,< MVPHf G O I lx kML FG pACk< yBECB CA(A0C](A BBBX , ` !)HMN0C E $4` M]@Yq D Td!)HBBA CA(DHM (A ABBH  (A ABBA $P*HACD g AE $-*HIHD0] A 4 p>*HMN`Mt D  G ~ B $<8LI MC K $lc*HMIpE A $fZ@J_ E 0>DM G a|Gt 8DX$@!D\<XDC} D <d8z*HAFD H DAH A ADA ,<BAA EoAB<BBCA GA(CG0(A ABB< HBGBGA GA(CD@j(A ABBLDK$dMI YR G $HMI CW H <BBB CQ(A0(A BEB$@qDCo J A G (D_$4Q_@FR\(u^/J]}}}Mg]i2J#;hL)6:G!8'{b"CP1*7,waS $bCt n"(. X G '*   v  ,#!jOFb+ce ? c  6  G s U   <   [F,CA'''" T   'H5Er+'Fs+%%)% %%S}Bj!Yeq+N]lv)w  1,JlSEp,Yg D?S>]#$" 5)c"c $  $t$N$$aa$$$$$$:J  1P ),  ~?%TBRA  /k=SZ%    ' 1     ',4CRapx@Rc~gb+6K' 9'^You-iR)PS  :         KF]" 457G "MU"#Moi 4  (     ?             [L  "Sb%=E"tNT_uh7_5[i  0GYqR6`k v  4   2s VP'WA|Rw;G\ %>O:n "50K _s! &J-@eud@DA`/F X'@ x0Fo@@@  /h @@ o@oo@.h'@'@'@'@'@'@'@'@(@(@&(@6(@F(@V(@f(@v(@(@(@(@(@(@(@(@(@)@)@&)@6)@F)@V)@f)@v)@)@)@)@)@)@)@)@)@*@*@&*@6*@F*@V*@f*@v*@*@*@*@*@*@*@*@*@+@+@&+@6+@F+@V+@f+@v+@+@+@+@+@+@+@+@+@,@,@&,@6,@F,@V,@f,@v,@,@,@,@,@,@,@,@,@-@-@&-@6-@F-@V-@f-@v-@-@-@-@-@-@-@-@-@.@.@&.@6.@F.@V.@f.@v.@.@.@.@.@.@.@.@.@/@/@&/@6/@F/@V/@f/@v/@/@/@/@/@/@/@/@/@#Iw0*XZWǓF\B (>VGeq{][C,kK1}Sr $|Y֍/y=®an6s9^i7? QLc3x)HˇGCC: (Ubuntu/Linaro 4.5.2-8ubuntu4) 4.5.2GCC: (Ubuntu/Linaro 4.5.2-8ubuntu3) 4.5.2.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment 8@8T@T !t@t$4o@\> @ F@No@([o@j@t@  ~X'@X'yp'@p'0@0xx0Fx00F0 !G!$EGEtHy-h-(-h-.h..h./h//h/X@4h@4 @;h8; 08;T;rar/unrar0000755000175000017500000113023013143334065010225 0ustar zzELF>*@@X@8 @@@@@@88@8@@@ ННdНd0 O ddTT@T@DDPtdCC44QtdRtdННdНd00/lib64/ld-linux-x86-64.so.2GNUGNU:gQ?7K=yA 1y|ȁ Ҝc)fUa&x 9BxIk.l|S  O8h`Z#>s@N3gBQ9'3  KE| {{\U\1RuFL/=#J8Y%sTkom|!dX?!dX7`dXd!`d@!d(8dh@&@)@!@dlibstdc++.so.6__gmon_start___Jv_RegisterClassespthread_createpthread_join_Znam_ZdaPv__cxa_throw_ZNSt9bad_allocD1Ev_ZTVN10__cxxabiv117__class_type_infoE__cxa_begin_catch_ZTVN10__cxxabiv116__enum_type_infoE__gxx_personality_v0_ZTVSt9bad_alloc_Znwm_ZTISt9bad_alloc__cxa_allocate_exception__cxa_end_catch_ZTVN10__cxxabiv120__si_class_type_infoE_ZdlPvlibm.so.6libgcc_s.so.1_Unwind_Resumelibpthread.so.0writepthread_cond_initpthread_mutex_destroypthread_mutex_initpthread_cond_waitpthread_cond_destroyfsync__errno_locationpthread_mutex_lockpthread_cond_signallseek64pthread_cond_broadcastpthread_mutex_unlocklibc.so.6putwchar__vswprintf_chkwmemsetfflushstrcpysetlocalembrtowctowlower__vfwprintf_chkwcsncpy__swprintf_chkstatvfs64wcscatwcrtombwcspbrk__open64_2ftruncate64mbsrtowcsclosedirstrncpy__wcsncpy_chk__stack_chk_failmkdirreallocclocktowupperstdintolowergetpidstrdupchmodflockfgetws__ctype_get_mb_cur_maxisattylchownsymlinkgetpwnamstrlenwcschr__cxa_atexitutimensatmemcmptoupper__fxstat64getgrnamstdout__wcscpy_chkmemcpyfclosewcscmpmallocgetpassumaskremove__strncpy_chk__lxstat64opendirwcsncat__wcscat_chk__xstat64getenvstderrwcscpystrncatfilenogetcwdfreadrename__memcpy_chklocaltimestrchrmktimereaddir64__sprintf_chkwcstolfopen64wcsrtombsaccessstrerror__libc_start_mainwcslenwcsncmpwmemmovesysconffreewcsrchrGCC_3.0CXXABI_1.3GLIBCXX_3.4GLIBC_2.2.5GLIBC_2.3.2GLIBC_2.7GLIBC_2.6GLIBC_2.3.4GLIBC_2.4   y P&y 0ӯkt)0ui ri ii ii ti ii ui ddyXd|`d}d~dz8d@d`d{dddd d(d0d8d@d Hd Pd Xd `d hdpdxddddddddddȠdРdؠddd d!d"d#d$d%d& d'(d(0d)8d*@d+Hd,Pd-Xd.`d/hd0pd1xdd2d3d4d5d6d7d8d9d:ȡd;Сd<ءd=d>d?d@dAdBdCdDdE dF(dG0dH8dI@dJHdKPdLXdM`dNhdOpdPxdQdRdSdTdUdVdWdXdYdZȢd[Тd\آd]d^d_d`dadbdcddde df(dg0dh8di@dHdjPdkXdl`dmhdnpdoxdpdqdrdsdtdudvdwdxHZBH5|$%|$@%|$h%|$h%|$h%|$h%|$h%|$h%z|$h%r|$hp%j|$h`%b|$h P%Z|$h @%R|$h 0%J|$h %B|$h %:|$h%2|$h%*|$h%"|$h%|$h%|$h% |$h%|$h%{$h%{$hp%{$h`%{$hP%{$h@%{$h0%{$h %{$h%{$h%{$h%{$h %{$h!%{$h"%{$h#%{$h$%{$h%%z{$h&%r{$h'p%j{$h(`%b{$h)P%Z{$h*@%R{$h+0%J{$h, %B{$h-%:{$h.%2{$h/%*{$h0%"{$h1%{$h2%{$h3% {$h4%{$h5%z$h6%z$h7p%z$h8`%z$h9P%z$h:@%z$h;0%z$h< %z$h=%z$h>%z$h?%z$h@%z$hA%z$hB%z$hC%z$hD%z$hE%zz$hF%rz$hGp%jz$hH`%bz$hIP%Zz$hJ@%Rz$hK0%Jz$hL %Bz$hM%:z$hN%2z$hO%*z$hP%"z$hQ%z$hR%z$hS% z$hT%z$hU%y$hV%y$hWp%y$hX`%y$hYP%y$hZ@%y$h[0%y$h\ %y$h]%y$h^%y$h_%y$h`%y$ha%y$hb%y$hc%y$hd%y$he%zy$hf%ry$hgp%jy$hh`%by$hiP%Zy$hj@%Ry$hk0%Jy$hl %By$hm%:y$hn%2y$ho%*y$hp%"y$hq%y$hr%y$hs% y$ht%y$hu%x$hv%x$hwp1I^HHPTIeCH0eCH0/@HHt$HtHÐUHSH=8~$uKdH2~$HdHHH9s$fDHH ~$dH}$H9r}$H[fff.H=pr$UHtHtdÐfGGGGGHG HG(HG0HG8fDLd$L H\$Hl$HHHL CHHLHǃ Hǃ( Hǃ0 Hǃ8 ƃ@ =H( LH( HtH H HHl$H$Ld$HÐSHH @Hx C1~4HǃH HǃX HǃP ƃ ƃ ƃ Cǃ ƃ ƃ ƃ ƃ ǃ ƃ ƃ Hǃ!ƃ!ƃ !ƃ ƃ ƃ !ǃ!ƃAƃA[ÐSHH?Ht HHCHC[ÐH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^HHIH3HtUHSHHsH;JH;BL#HkH\$Hl$Ld$ H(H;HHIt]L#Hk@(fC1)e_)eHCHsA)eHD$aHD$M)eF뗐H9wr HwDH+wATAUHhCSg)eIHH莍HDH苏@uHHҎHD1Hb<,8(H8u 8H߈$ jH5HIiHPH]HGQHFEHF9HQH9[]A$F$A\HIIItR)e xHIHHHIHFHGHO)e)e^k0)eHHHIHFIwHIHG2HPHHIHHIHSHH?Ht4{ u[HsHH;[f.[ÐH\$Ld$HHl$Ll$H(Ho(H;oIr(1HtHH\$Hl$Ld$Ll$ H(ÐL,L/LHDMHC(tM,$@HHt$rHD$HH\$Hl$H(HHt$HB1tHt$HH* H\$Hl$ H(fDAUATIUHSHHHHwHW(HT8HHHC(ALHHZAt:EyHHtHJHT0HHS(H[]A\A]D1@HG(ÐfDATAUHSHHHHwHW(HT8HHHC(Ht$Ht*Ht Ht$HtEtAHuʸHHtHJHT0HHS(H[]A\fHؒ뽐HHwHW(HT8HHÐfff.HHtHPHD0HHG(fffff.SHG(H/C0Hǃ[Ðf.SHHHGHGHGG HG(C0Hǃ[H\$Hl$8pCLd$HHHHLgHDHHpHJ<H;H@C0Hl$H$Ld$HÐH\$Hl$HLd$HHHIHHH$HD$HD$HD$D$ 1HT$H4$LtE1Ht H}AńEtrH\$ HVHHHH$茓HSZ/DHH HHD$H Hiʚ;H)Ѻ?HL$HT$1HH޿`H$(dH3%(H$8H$@L$HL$PHXÐH\$ HVEuUH$HD$?L耒LHD$ÒHSZ/DHH HH Hiʚ;H)HB脾H<HH$耒ʚ;1HHT$뗐fffff.H GfDSHHHwH蔻Ht$XHHĐ[fffff.H\$Hl$HLd$HHP(HH1HP HHP(IHHH1P LH$Hl$Ld$HIHH1HP L訿SHHHtH|$HcLHIEt]EtHT$f.I)MH|$.HHL[]A\A]A^A_H|$HHǽSHH?Ht,{ u[8Hs'TH;[fD[ÐH\$Hl$HLd$H(HwHGH9HwvnHWHt H9HHHl H9HB{ t^HHIH3HtUHSH&HsH;SH;肸L#HkH\$Hl$Ld$ H(H;HEHIt]L#Hk@(fC1)e蟫)eũHCHsA)eHD$衩HD$M)e膩뗐USӺHHdH%(H$1CQ@HE耼1u貹8H$dH3%(u H[]费@AWE1AVAUAATIUSH H?LE11AHL)HHItuI9spLLHE1Hu=iCA襆HH1hiC莆iCH1OH}YEtH D[]A\A]A^A_L8uѺLSAff.Hh1ffff.SH(H$p HdH%(H$x(1HHPO$p CH$ HER1uH$ H$ H$x(dH3%(u HĀ([踷HHdH%(H$1N1H迸H$dH3%(uHZf.SHHP@Pt|H$@ OIH$@ HIHt$H$@ 1HDŽ$ HDŽ$( HDŽ$0 JH$@ D$ID$HP@[HHP@[H$@ HHH跸@Átt øf.ÁHdH%(H$1HtHDMHGH$dH3%(uH׵HH$dH%(H$1LH$H1DD$H$dH3%(uHĨd@SHHdH%(H$1vLH|H$dH3%(u H[fDSHHH$dH%(H$1LHHLH$H H$dH3%(u H[芴f.HHdH%(H$1KH!H$dH3%(uH,fff.AWAVAUATIUSLHHdH%(H$81HHt$H$DL$$P(HD$(HH\$H9D$$D$$uI$11LP H$HDŽ$HDŽ$HDŽ$HDŽ$Ƅ$9H$|H$oH$H$T$$D$$E1E1IT$D$ dD$ TH|$tH$H$HwH<$tH$H$HXHH)L9HEL9t HHNI$H$LPt`HcIIAuT$XHL$LLHMRLHt$Lƿ&fD$$H|$tH$HT$H<$tHH$H$MH$H$HH$HBH$$HBH$,HBH$H$H$I$1Ht$(LP H$8dH3%(HH[]A\A]A^A_H|$0DŽ$DŽ$DŽ$~QAH|$0DŽ$DŽ$DŽ$NQLHD$HI$L1Ht$(P H軲薰H$HH$H$HHf吐SHH?Ht,{ u[HsHH;[έfD[ÐHx|$hHD$`t$@D$dlPHxÐAWIAVIAUMATUHSHHMD$XL$Ld$PD$t AHtTE1HMALLHL6Mt2uľ)eeHuf|$EAHt/DHHtmH[]A\A]A^A_fH߾CHH[]A\A]A^A_]D1H<$tH$H[]A\A]A^A_fH߾HHH[]DA\A]A^A_gAVIAUATIUSH 膪LH[HHIHDIM)I@@BtgH|$ EAjC1Hl$\$L$$lH|$ BuHt$ LLH []A\A]A^H 1[]A\A]A^ÐSHHh:HHt$GtHD$H[HHH[fH\$HHh:Hl$Ld$HHAtH$Hl$Ld$HÐDHHHl$H$Ld$HH\$Hl$HLd$H(Hh:HL$HI3tD$H\$Hl$Ld$ H(LHHƇhS@1Ht?RtfHvWEtIHvS1auruڀ!uԀu΀uWtt1~u^u1Ð@HH1H@ fffff.,tHH؃HHpH HEÐ@USHH0:HpjCtH8:HtHCH+H?Ht3Hh:7H8苆H$ jHH[]1HHHtHh:H8>H$ RjHH"HHHHH말SHH[^fffff.H\$HLt$L$ Hl$Ld$Ll$L|$H8HlHpjCL}gL8LLh:HǃP:LdHHǃtHǃtHǃtHǃtƃtHǃtHǃtHǃtHǃHǃHǃHǃƃHǃ Hǃ(Hǃ0Hǃ8:0:t藫HIHiHTH8:ǃ HH@Tƃ$ƃ%ƃ&C1ƃ'HHƃ(ƃ)ƃ*Hǃ0HǃP:ƃ+ƃ,ƃ9ƃ8ǃX:HǃHǃHHǃ@:ǃH:HǃHǃHǃHǃǃLHǃPHǃXHǃ`ǃlƃJƃhƃ`:Hl$H\$Ld$Ll$ Lt$(L|$0H8HHHLHvHHt~LLނLfHŐHH@H\$Hl$HLd$HH1HHH$HD$HD$HD$D$ 1HLd$ It$H |uKHSH3H<$?H;#HHH HHl$8H\$0Ld$@HHDH3H<$ILAH;B멐1@HSH3H<$CHH;H裨fH\$Hl$HLt$Ld$E1Ll$L|$H8dH%(H$1&HuVH$dH3%(DgH$H$L$L$ L$(L$0H8@HP( ITeH0H1HHP H:8DA j<0hE10<5(H} D$I@D 1HH讄H$ED$HLl$@H$H:H$1ҾzH$E1L$8OƄ$PO H$Sf9Hs 8h H$HE19fDHHLh 1HHAվDjCHQ9E1H=H1LHP fTE1EtEH$@HDŽ$@LHDŽ$HHDŽ$PHDŽ$XƄ$`萩HLH$@HP JH$@LDgfA9!Hs 8HH$@fDH0H1HHP HHAEF,(}@Hs 8DHH=AfH$pH$xHhH$pHHHUH}1HqHUHuH$xL;H}蓞HHH$۪Hs}H}A AuHH$@1HuH$@L:H}-HHRH$@H[HAPHA%EEAAƃG47谡HH|HH1LP H诣HH$HH$@HfDH\$Hl$HHH8:btH\$8Hl$@HHHH$HD$HD$HD$D$ t=H,$H\$H&Ht HH)H4pC1;H<$H菊H7H\$8Hl$@HHHHH赢@AWAVAUATAUSHHXƇ,Ƈ8HHSHHP1tHX[]A\A]A^A_ÐHǃ0Hxh wǃS.\:t-`:ttHH1HP H-4HuȀ9t EH1HHP 8T`:&t ,UHHP(HILD\:%HH1HP H3H\:u1%t x)Hs 9HHX1[]A\A]A^A_fDH|$ HD$ HD$(HD$0HD$8D$@HHP(HD$HT$(HHHt$ HPHL$ LcE1E1HH+D$L@DAIID9HL)?RuLT$HL$L$KT$HL$L$t u/E~*~%H|$A8RuAxSuAxFuAxXufIcHt$H1HH0P wHHHPH0H|$ <1%t u)HH1LD\:LHP %t)Hs Hldf.Hs E2f1YfH|$ 1?HHSHPSuǃSHHHh P(1HpHՋ $Hs :1HHH1LP HH|$ HJHfSHG1u[D1H.¸uHs 7H1[ÐS@Hu9t[)evfD[fDHs 7:[)eJf.SHH1[Hx|$hHD$dH4$D$`l;HxÐHx|$hHD$dH4$HT$D$`7;HxÐH9wr HwDH+w釩H\$Hl$HHSHHC@lH\$Hl$HÐSHHpH8:0tHp[fHw H0BtH8:0u>HHD$`D$dD$h_:)eH8:ƀ5Hp[fff.SHHH8:tt H[HH[9HHt$+:H8:Ht$fDqu= $SHuu%TuCtW$%$T[ftquuj$%T[D$%T[$%T[ljf$]@R$%AT[Ðf  !tzV tSHF D/tR\tDHt2\u僿 u܋ !u_Huf.fD t/ Fof~SFIƆ =H\$Hl$HSH0 t, TLTkHl$HH\$H THl$HH\$HÐfDSHw Hƃ8)e[駄fDSHH;tHs 6[)epH;u[Ð@HHw H -)eH8ATHUSHH`HdH%(H$X1\H0H9H`HTHt$PHe^H\H\Hǃ\:Hը%$H'TT1H9HO\$0H`H$XdH3%(HH`[]A\f.H_HxT1%ǃ|THC\TH5\ǃtHHt[H牃t[H牃T[H[H牃T[H̀Ty[<HD@ Tb[HAW[TTHtHǃxuƒuuuuTHthAHH^Ht$PHH~\Ht$PD,PHתHTH|$PH,HHSH|$0u#Hǃ\:HfDHHtTHHH诓HHTH輕fff.H\$Hl$HLd$Ll$ILt$HHdH%(H$18' 2E9H8u yL8LAmH|$0L4HظH|$01hH@{tjH8:10E1H̸HHLLE‹|H0H|$Ht$L1$rL:PLH8ƃ@9HHLH89qyƄ$NH@Hǃh99HؗH$MH`9L1ҀHHPLHE¸H|$0D$(D$(Hs Z1H$dH3%(H$H$L$L$L$HÐHw )e~1뉐H|$01HHs )eL~1M LD$(ED$(H@H%Mt5L{H@I4$LpHs 51ƃA9j-H|$0H蠘H8AWAVAUIATIUSHH HN0dH%(H$ 1HH)H;F8r@H)HF8Hv3H$ M$ L$ HD$fHWHu3H$ dH3%(Hĸ []A\A]A^A_f.HS0Hk8H9tH)H9HH,(VAt$HHS8t&FvfHC0Hk8H)Hqy@HuAD$HH$HL$kVH$HL$At$FwfHH)HHw$jCf.HLH$蘕I$ H$HVIHUAƄ$BA$AAƄ$AA$AA$AA$AAƄ$AfHhUHA$!XUHA$AEUH=Ƅ$L$I$!L*iHYHTHTAH|$0AAƄ$ AxkC1誈ITHt$0蔤HHTЉщЃD$ t.0H߉$L$SI$H `L$$ЃD$(t.@H߉$L$SI$P `L$$ЃD$,OF|$ Ft$(L$,"H0S%?=ɚ; I$X Qd@HSI$| ADŽ$x  H'TfHXSHHSH߃A$ A$ HRA$ I$ HSI$ HSA$ AƄ$ ADŽ$ AƄ$ It$ LcfDHH$HL$RHH$HL$&IID$0@H߉D$TRHH$HL$t$IID$ LHHLD$HD$RHL$Ƅ LD$HQA$CbHQA$C>HQH=I$BHFHHHL$eRHL$AƄ BH߉D$QAH=I$ALFHLLD$RLD$CƄAL$HC0H)HHH߉$PI$X |]$I$ HHHD$ QLHQL$LLD$LD$Ht$ L LD$H$ L膷H|$LA$ A|$Ht$ jCAƄ$ rIt$ L'H߉$L$OI$H HL\L$$HOI$X H'\LH߉$L$OI$P H\L$$H.O%?=ɚ;I$P O`HO%?=ɚ;I$H #`H\$Hl$HLd$Ll$HLt$L|$H H|$01dH%(H$ 1M,)H0HH9HHH$ HHPtkHC1H|$0H$ dH3%(HH$ H$ L$ L$ L$ L$ H DL$ H8:L$ HD$L\TILl$XTH01L$GTTtHlTL{Ld$pfH|$0PHH|$0ƃS&MH|$0SNH|$0AMHEAtEdAH|$0HcTPDH9D$`{H|$0H$AH|$PiGH$ H|$PCH|$PƃSSVCH|$PjCH|$P@SSMC@SSQtRsu\:H|$PFSHL&ŋSLHu% AHxTHؗEHD1H萀HSHEHSHESEEƒ    E 6ƅ 1҉ !@1@@ u HcҨH|$PH!  BH|$PEAH|$PAAH|$PEDžx AH|$P| AH|$PD$,gAH|$PEZA0H|$PEjAH|$PAA EDž t'E<  <  Dž EDž !<t< Dž !HH#EHDž!H9 1EuEE ! ! A11 EEN$!EH|$PLt$ AHH` HIDH|$ L$LFt$ Hh LLAEBƄ4 E HU E HT$@ Ht$@L胉Ht$@HvHHDuAtH H|$P8At$,HH xME H|$P?HtH$HDŽ$D$LHT$0H$HtHL$8D$, H$HtD$ H$L$,D|$LAAH|$0Dd$ EtH|$P+?H|$0LH|$0H$mJAt$ADŽ$ AE1E)Af.H|$Pv>DA $AE9牄$AdAH|$0H$$JD$ l$,|$ sHD$8HD$8HHD$0ǃS\:u SSH|$PAHaz{@ǃSfw x"yDugHSH|$PHXHSH`Sh|=H|$Pl<=H|$Pfp+=fr"fSf.H|$P1d?9St9Syt.vt)ƃ8)ecEHH9H$HSH|$PH<HSHDSL6<H|$PP&<H|$PQ<H|$PRV<TǃS@ǃS@HSH|$PHHSHS;H|$Pf ;H|$Pu;H|$P;fyHSSHHSH¨҈H|$P ;LfHSH|$PHHSHSȗ:̗HH|$P:H|$PfЗt:җЗf-fy$HkCHҗH|$PHHHHȗHЗfP:H|$P@:HҗH|$PHtHH|HȗHЗf9H|$Pf9ffv fǃf=v fǃHH|$P:HH|$P:ƄƄ(HҗH|$PHHHHȗHЗf 9H|$P8H|$P8H|$P8HҗH|$PHHHHȗHЗf8H|$P8H|$P8H|$PO8H|$P8f=fvfǃH H|$P`9Ƅ @H`  H|$PH:9Eƃ8)eg^E~HT$@Hs fHSH|$PHHSHS$d7H|$P(7H|$P,7H|$Pf.37H4H|$P0g8(H. HH@:fHHP(IHHP(H Hp1HQ AE1H(AEAuH1LHP @<LDž !=ƅ HTsHSH|$PHTHSHTST5H|$PfT6TTу$%'@+€,u fT(T)*THE LHHD$@KDe DuA D+d$ AAD$DEE~AMcH LSuH H|$PLo6H|$@̍CoDuH|$@DjCoƃ&H|$P4H|$PD$ 4t$ A!HH H H|$P45H|$Pz4H,(H8Dž!Dž!NHs Hnƃ91ƅ 1H$8L H!%tDHJHDHM HL)HL$@HI9wTDu Ef<t<JDž EDž 6Dž 'LLD$@H$H)IAL71H HN F HVvBH H@:HP(H@:HIxH:H ףp= ףLHLLH?J<"HH)H@:AH:9H:kHH1LHP H|$PEHmHH\$Hl$H1퀿9HtHH\$Hl$HfHP(H tHt3uHHHtHH9H1fHHHHfAVIAULATE1USHH8HHu[H]A\A]A^@\:tEIAu F \:t HS뱐LLku[H]A\A]A^D1fff.H\$Hl$HLd$HTt H0Tu'HHl$H$Ld$̍CHHP(HH1H0THP HMHIt8u \:tH1HHP H̍CkuLH$Hl$Ld$HÐ@ATE1USHHHHuH[]A\f.t \:t2IAuHD$ HD$;\:tHH1[]A\ÐHx|$hHD$dH4$HT$D$`G HxÐAWAVIAUIATIUSHHdH%(HD$81hHA1E1C4ASL$T$ fL$LH)I9D$ AttvOHT$ HD$ LL$gHHD$ DDfL$HL$ H1LcNASHL$0Ht$LLHD$0Ll$E13eHtHAuAEAMtCD&HT$8dH3%(DuHH[]A\A]A^A_C4g@AWILAVIAUATUSHHH<$HL$0dH%(HD$81Ht$H|$LHD$0eHtHHH$:I1E1D$f.AM9DH$;O,HD$ dHL$ HHLObHyD|$uAEI9v+M,D$AAEAM9v1CDHT$8dH3%(HH[]A\A]A^A_@1MtCDfDHD$ cHL$ H1HaNƒAM{CVYefHHt:ND1Eu"4@4H4@tH4t HH9wfff.HHt8O7ɉt&1ftODODƅ4t HH9wfffff.H@u fDHxHwH=w)HHt?ȀFHfD-=w\DA~ A~7HxU ȃ?ɀ?NȀFHO HA$v$H ?ȀFȃ?ɀ?NȀFHf.t20HHt~HHuHÐ0w:H~~HfDHH@HH{HHAAAAAAAAABDEAA*DGEAA€DWEAAÀA?A?A A?D AHD D Ht Hv*Ht Hv1HHDEAAudA?HD 뀐DEAAuHH纀i1HHHIǃyHǃm?ǃ5u@Liǃ#社du@a@E1Ht t  f HtE1E1MBD BT D)DDD9tMDHcH42%L΁A9D3D@3uIM9xAATAtULLHI9wAHH9v1I4,HHI9wH$dH3%(uHĘ[]A\A]Muإ@QfffD Ð@AWIAVE1AUMATIUHSHHxdH%(H$h1@t$DHHi0HD$H<HT$HT$MA,HLu}HD$H$P1ɾHLi0J#HP H@H$P1H$XhJ#HP H@H$@H$HA,tfAI0AHt$pLLALML4t IEJD4pIH$E1xfAADHt$pH$LyDHt$`H$Dd$`D$aDD$bzxA?uH$Ht$@H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$ H$H$(H$H$0H$H$8H$oyDT$PAAH@Ht$ H$9yD$ Hˆ$P$Q$SD$$$RHi0ˆ$T$U$WD$($VH<;ˆ$X$Y$[D$,$Zˆ$\$]@$_$^w1H?*MHi0҈ ,(Hi0H$P1ɾH$PH H$XHHi0H H$@H|$pHi0HH$HH$t$L$@HH`YHSH$@AH$hdH3%(uZHx[]A\A]A^A_fIUH EHHrLffffff.AWAVAUATULSHHH|$ Ht$(H$PHֺ@L$PdH%(H$1H@LD$0Ll$pHFѹDLt$oHHt$(H|$ H$PHKL$E1ƄPƄQƄRƄSHD$HD$H$#H$D$XHT$0Ld$PLd$nD$dD$hH$H$AD|$`HT$@Hl$HD$oH$H$D$nHD$8H$H$H$1EH$Ht$(H|$ H$L$L$ Ld$Ll$L4$FH$H$H$H$H$H$H$H$H$H$fD H0HH9uD9RH$HT$0HH$HBH$HBH$HBHD$8H|$8 tHD$8HTD@D|`HT$0H$PD5H$ #H$ H$ H$dH3%(uH[]A\A]A^A_%I@AWIMAVAUATUHSHD$HT$@dH%(H$1LL$8L$AH$@t$OLE1AAHEMixF95 AAuLt$PILߺLT$LLT$LH!%tDL$L$PDHVMLLT$HDHL҉D$H$pL)H$LHt$@LT$HƒHixHD Hy@4HHixI H HHIJHHH$H HxHHH$HGH$HGH$HGH$pH H$xH H$H H$H H$P1H H$XH$ H$`H, H$hH4 rMt3H$PI$H$XID$H$`ID$H$hID$HtDH$pHHH HH0 H9uH$p H|$8tt$OLD$8HLR LH$dH3%({H[]A\A]A^A_DHt$@J5HT$ LD$0LT$L\$(zHT$ LD$0LT$L\$(J5 LLIJ5 L$1ɾ HBHRLH$HPH$HPH@H$1H$J5 HB HR H$pHPH$xHPH@H$J5 H$HB HR H$PHPH$XHPH@H$`H$hfHyHAGDATUHSHHPdH%(HD$H1t"HD$HdH3%(HP[]A\DLcLD$ E1ɹ HLHD$HD$H$HD$ HCHD$(HC HD$0HCHD$8HCz@GLD$ HT$@ HE1ɹHD$HD$D$@H$(H|$@HD$ C1DH1H9us CAUATIUHHSHCHHtH0H*HHuM$LHHHtHxHHHuI$xTAADŽ$L1HtAL u}1HtI$ADŽ$ADŽ$@uS1HtH[]A\A]ÐA$I|$b@ADŽ$HlADŽ$I$fMHH)Hi0IL9tkH0HMHtZI L9tNHxHMHt5H)HixIL9tHxHiHCMtI$L9tH0H>fff.ATIUHSHT HGHH tHxHH9uMt#I$H0HL9uH[]A\Ht(I$H9tHxHD$HHD$MHtI$L9tH0HbHBH\$Hl$HLd$Ll$H(HIwN$ňkCfHt3(HIuDH\$Hl$Ld$Ll$ H(HH\$Hl$Ld$Ll$ HH(QBE1HtJ4+HIM9wfH\$Hl$Ld$Ll$ H(CfH\$Hl$HLd$Ll$ILt$L|$HdH%(H$1L$L$AtuPH$dH3%(VH$H$L$L$L$L$HÐHt$0HA$LD$(LL$ |H$0H|$0%LD$(LL$ v.H$0tH|$0e;$kC$HL$0AHLLl$L|$$PfDHL$0AHLyH$0L]H$0LPEH$0L-HIt1HHHF$1IփIL141@tHH9w؍=$H[]A\A]ÐG1Hu<@5 t uuHufDHS@HHIf._IHA1A1eAEAB3-eDB35eHcD3)eB3EeMc3Ae3=eB39eIwHHHHtt2H3)eHu[2H3)eH[HAt(1fD<HAEDEA H9wDfff.)eVIe1H-e3)eHH9uHuÐHHGHGHGG HG(HG8HG0HG@fff.HHGHGHGG Hw(HG8HG0HG@HGHG8HG0HG@Ðfffff.HW81H;W0sHBHG8HÐfHW81HJH;O0sHD HHW8Ð@HW81HJH;O0s0HtDDLHHW8Dfffff.H\$Hl$HHH߉ʼnH H$HHl$HÐHO8LO01L9sQLHQHW8A Hȃy71)L9s)LBLG8A4HHH@y Lƒ?v1fffff.HW01H9s&HH<1x<yHH9r1Hf.)f.Hl$Ld$HLl$H\$IH(Hw8H_0IH)H9HFHu8I9vLI|1H)Q3H]8HH\$Hl$Ld$Ll$ H(ÐH7HL6H\$HHl$HHC8HHHTPH;S0r"HH\$Hl$1H2DHHHHHk8H\$Hl$HÐfHHW01Hv!H@u'H7H%Hf.HW8HfDHHW0HvH7HHH@DID9vMDA DHȃy;1,fDEAFADM!ILEy D9wA1Ðfff.H\$Hl$HLd$HHHItH;H}H}0HL4H]0H$Hl$Ld$HÐfff.H\$Hl$HLd$Ll$H8H@HLgHG0LH)H9r$HHG0HH\$Hl$ Ld$(Ll$0H8II)LH؃N,(L:H{(LH3LHPLH3H{@HLHD$HD$HHDHk0f1Ht:H{(H3HHs0HPHHC0\GG HGHG@AU1HATUSMD"Ho EAAta_DAAttAAI9FIE_HL9ȉo _stI9souL9vfBIG Dӈ_AAuMSL9vFTBIAAEH_f.o _JH I9[]HGA\AA]ÐI9sFIEEH_5fDI9sFIA€t\L9AF,IAI9EE~ADAAHI9w_AI9wf.E~AAHI9w_1HÐ/ff.t 3{Hff.Hl$HH\$Ld$Ll$HLt$L|$HHEHAD3*tZ?u1EADH\$Hl$ Ld$(Ll$0Lt$8L|$@HH@A9EHHD3*uEAt.tJE @HD3Et,DHH6tAuEuE1^MLm*t4.H߉L$S1L$H…u3H-@AU.H1HHR gCHHT$j/HHT$t]D2H+E1.A\tEt A.AHHH\$Hl$ Ld$(Ll$0Lt$8L|$@HH3HZ.HT$H}0HHT$uAHLAGfHl$Ll$AH\$Ld$Lt$L|$AH8@HI+IƍEALLHZuC/\Ҹt1u@H$@H$@L$@L$ @L$(@L$0@H8@L$ HLOHLOEHJLIJ1ɺHƿkCH1VtqAHL=D.fDL$ HLOHLNAHL11HAHLLHMuku:$ L8*AHHL1zHLuAHL1IALH5H\$Hl$Hf^Ld$H(HISZ/DHH|$HH HIH HT$C/PH lUPUP UPU PUUP@UHH E HIH Hiʚ;H)щMH\$Hl$Ld$ H(fDUHSHHHFHD$ $FD$F D$FD$ FD$-lD$t(MHjL {Hiʚ;HHHHH[]fffff.HH(\(HHHH@HHHHHf^HHSZ/DH HH Hf.Hiʚ;HjL {HH7Hf^HfHjL {HH7Ðfffff.H8HD$T$ ЋT$ ЋT$ ЋT$ Ћ$H8 ÐfDH8D$D$?D$ D$ D$Ƽ4$HD$%H8H\$Hl$HLd$HxH?HAu&mCHq&H\$`Hl$hLd$pHxDHt$0EtYD$HDL$0AlCH?HH߉D$(D$DD$ D$@D$D$E1&AD$v AH}t*]L)3[]A\A]A^f2PHH9u8tH[f.ڿHL$pC1HL$H t9u9ZuHvpCfUSHH@tvtJHUHmH߉>HSH߾ $H[]H߾D$D$H[ ]fHHH߾H[]H9tH)H9HFHufH ωDAD DAE FAD ȉѺ )!f.ȉϹ D)AASAA1D DÃAN AA" A9u[Ðf.AWAVAUATUSHHhwz$@pCDGDWAG A1EtIE11E9v#D1fDH3σ*>DA9>wAAE9wHh[]A\A]A^A_HDG 1wڃ@19wt9s H@8u F +́iH뺋GLDw LT$D$1|$bT$QALIfExKHDpCEt3 eT$33 eAT$8D$= e3 eT$23 eT$73 eAT$<D$1 e3 eT$63 eT$;3 eA GLiLa L $ADIcAHHT8HBR3T$0PA3UP3QP 3Q ADT$0D$5Hcҋ eB3 eDT$:B3 e3 eT$4D$9 e3 eT$>3 eT$33 eAT$8D$= e3 eT$23 eT$73 eAT$<D$1 e3 eT$63 eT$;3 eA GD9HHHD8HP@3D$0A3BEAE3BA$3B AD$0!eD$5!eAD$:!eAD$?!eAD$4!eAD$9!eAD$>!eAD$3!eAD$8!eAD$=!eA D$2!eA D$7!eA D$<!eA D$1!eA D$6!eAD$;!eAHcGHHT8HBR1PA1IPA1U@ A1$It4HHH?D$@FD$DFD$HF D$L%HD$ HT$(HHDH$GG AEGA$GHD$XdH3%(u2Hh[]A\A]A^A_L $LiLa HW LoLgH$AWAVAUATUSHdH%(H$1HH4$u)L$dL3%( HĘ[]A\A]A^A_HGHHHD$`HGHD$h7LD$dLL$hLT$lHT$HG(HWLd$tHl$xH\$|L|$TLt$XLl$\@t$OLD$@LL$8LT$0HD$HT$DWH4$L$L $Ic‹6HHT8t$ HBR1T$PE@PDD$$D1AEIPDL$(D1AH$DH R A1щT$,LEMDD$TT$PDȋ4 e34 eT$Z34 eT$W34 eT$Q eB3 e3 eD$[t$p3 eA$DD$XD$U eB3 eDD$RB3 eEEAMcB3 eEDD$YF eF3 eDL$VF3 eDL$SF3 eEJAD!@McAIM\:A3st$PA3S AA3CAE3CLEEDT$TT$PD4 e34 eT$Z34 eT$W34 eT$Q eB3 e3 eD$[t$p3 eA$DT$XD$U eB3 eDT$RB3 eEAMcB3 eEЉED\$YF eF3 eDT$VF3 eDT$SF3 eADLL$A31t$PA3QAA3AAE3A EET$PLD eT$p@ e eT$qT$ZD$vD$[ e eT$rT$WD$wD$X e eT$sT$T eT$tT$Q eT$uD$xD$UHT$ eD$yD$R eD$zDEH eD${A eIЈD$|D$Y eD$}D$V eD$~D$S eD$23t$pt$pRA3$A$A@3EEE@ D3|$ODuXDL$ LT$@DL$`DL$$E DL$(LT$8E DL$,LT$0E Hl$1QADA tBH$HD3t$`LT$@LL$8t$pA3LT$0A$A3EE3DyHD$`HGHD$hHG}fff.ATDgE1U1EL$SHEHD$HFHD$HFHD$HFHD$~tExoD1AQLcICDHcIcAtIA@tt@tt@tTTA9AyA9bEYD9eMc:DBD e2T$T$BD2 e0D$BD e0D$BDT$ e0D$AHt$AHA~GIcAHHDHc0HHLH9tH0HH9uAHE9~VE~o1AJLcIA9~>HcIcAtIA@tt@tt@tLL~AEA9~D9~fHD9[]A\fDHt$AHfIcAHHDHc0HHLH9tH0HH9uAHAt VD$Ht$AH eD$2L$ e0D$D$L$ e0D$D$ e0D$DIcAPHDHc0HHTH9t H0HH9uAHANA9+E0|E0fff.AUATAUSf.Mc1LNHHl8LD$HcLM1IHcEJDIHtF eB2 eDVvB2 e2 eAIuuHD$IAIJD/HD$JD/D9gT[]A\A]Ðfff.USHH(tKMHIHAIPHI9uHH@uHH([]G A1fDH<:ɃA9HL @|wvfDGA fG AHCHC`fff.S1HdH%(H$1$Ƅ$HL$Ƅ$6@HcЍ<@ƒHҁ11Ѓuƃ$e0$1Ȉ %H%Heuۿ eA e11E11A@QHcHc#e"e!e e Aʈ"e!eD e#eD11ʉ1ʀD)Hc AHcDAJhHc "e!e e#e "e !e e #eAHc e#e"e!e e #e "e !eAAHcMc !e e#e"e !e e #e "eB #e"e!e e #e "e !e e}1@At@D)HcHHI AA111D1ىc1ʄ҈!e e#e e#e"e"e!eƀ#eƀ"e1ƀ!eƀ eA1Hcƀ"eƀ!eƀ eƀ#e1"e!e e#eƀ eƀ#eƀ"eƀ!e e#e"e!eƀ!eƀ eƀ#eƀ"e!e e#e"e@H$dH3%(u H[ f.=$SHu[Ð@SHGuHG[f&HC1[HfuHHt @fDwwÐfffff.HcHO4DT+O  %ÐH\$Hl$HHHHHt {uHkCHl$H\$HÐAWAVAUATUSH|$AHHD$D~Dv DnDfx DPHAADHD1!A1E1EyZFA!E1AAFyZE1G:yZAD!AA1AEAB1yZDE1AD!EA1EA͍ DE1B+yZE!E1ˉDAADՉD1G!yZ!D1AAnE1AA!E1DE(yZEA~EAω|$E:yZ1D!A1ADED^ 1D!A1AByZ<9D ~$ω|$č;yZDD1D!AD1ύ<;ߋ^(EyZ\$ЉDL$EE1A!E1DL$Aً^,EyZ\$DDD$AE1A!E1DD$A؋^0ˉ\$EyZ1D!A1AEAF^4ˉ\$؍yZD1D!A1D ^8ˍyZ\$܉|$DD1D!AD1|$ߋ^<EyZ\$DL$EE1A!E1D1DL$D13T$D13D$3D$E1D3|$AD3|$AyZAE1A!AE1EyZFDA؉1D!A1B9yZAEAFD1D!A1DE1D3t$ԍ DA1D1D3l$D3d$D!AD3d$A1D1D1A3l$B7yZA1AE1G)nAD1<;DD1G n1AAAF D1E*n1AEAF1D1AAEAF\$3\$3\$D3\$D1A1E1㍌nAÉL$D1BnD1L$AL$DL$ȋL$L$ȉ|$DD1D1|$A|$|$ȋ|$|$DT$DT$D3T$A1A1AGnDL$DL$E1A1DL$DL$AADL$DL$DL$ĉL$DL$DL$D3L$E1A1ACnDD$D3D$A1FL$ĉ|$A DD$D3D$ԉL$ЋL$E1E1ABnL$3L$3L$č |$<9L$3L$̉|$ԋ|$D1D1щ|$ċ|$L$nL$3L$3L$Ѝ<9L$ϋL$3L$؉|$̋|$D1D1ɉ|$L$|$nL$ԉ|$ȋ|$3|$3|$ԉL$|$ȋL$ĉ|$؋|$|$؉|$؋|$11D1D1D1lj|$܍9n|$3|$3|$ϋL$|$ċ|$1D1|$1D1Љ|$ċ|$|$̋|$1|$L$n|$ȋ|$3|$3|$|$ȉ|$Ћ|$3T$L$3D$|$‰L$|$Ћ|$ԍn|$ȋ|$13|$ċL$|$L$ĉ|$ԋ|$|$ԉ|$ԋ|$̍n|$ȋ|$13|$E1|$E1D3|$L$E1A1E1A1։|$̋|$AAƉL$|$̉|$̋|$B?n|$ȋ|$13|$|$ȉ|$؋|$̋L$D3l$|$A1ʼnL$Aʼn|$؋|$B7n|$ȋ|$13|$̋L$|$L$̉|$ċ|$|$ĉ|$ȋ|$B/n|$Ћ|$13|$؋L$|$Љ|$ċ|$|$A1D3d$D1݉L$D1E1ˉ|$|$E1AB'n|$Ћ|$13|$|$Љ|$ċ|$L$|$ĉl$L$ȋL$̋l$3l$؉|$ԋ|$1|$3l$D1t$D$ċ|$č9n|$͋L$|$L$L$1D1É\$Ѝn\$3\$3\$ˋL$č<;\$ԉ|$؋|$A1E1E1A1AA1D\$BܼAA D#\$A‰|$̉!A |$D\$DT$D3L$L$A|$E1A1ɋL$BܼDT$A|$ȋ|$A A!!A DT$DA<:DT$DL$F ܼDۉ|$DAAD D!! |$ADL$ADD3D$3L$DD$D1t$D11|$DD$D$ȋ|$DL$E E!1B ܼDL$E ܼE!E DL$L$FD݋L$AAD D!D! A<:EADDT$D3T$E1A1DA!DT$GܼEA AE!A ʋL$GAAED\$A1D1A1ˋL$A1ACܼAD\$E AE!A!ًl$E D\$F DAɋL$A1A1ˋL$A1DA D\$BܼEA!D!AD Eˍ A\$DD\$1ڋ\$D1EE!ӉT$EܼDD !D AAЋT$AEAD1D\$E1E11Љ1D!ʋ\$E1߉D$ܼD A1D!Ћ\$ DNjD$D!AA1DAA AG:ܼD!D|$ ADT$D!DE1AAAE AG1ܼA!Dt$A CAADD3l$D3d$D3l$D3d$D3l$A A!E!3l$E A3l$AE1D\$AAB)ܼG ܼD1DADA AA!A!E Aʍ/ܼEAAEA AA!A!E 3\$D3\$3\$ED3\$DAEDEA A!AD1A!E AܼAE1ADABܼDE AE!A!E AADAAF<DT$D3T$D3T$A A1AE!A!BܼE DF DA L$DL$DD3L$!Dt$D3L$A1AGܼDD$ED|$A A!A ȋL$DD$A!A DD$D3D$D3D$L$E1ABܼ|$ċ|$ !D |$AAFRH$H^¸tH)e| )e]1`豺H\$Hl$HLd$H(HHHdH%(H$1QusHgt Hs YHBQ )eçH$dH3%(H$H$L$ H(@LLٵHt'E1()e @m!tH}Hp!H@HADm!tH}Hp!Hf.E1䀽iHHUDCH$@LlHT$(H|$(L`*LLIHt$(L\<ju!H}Hs ƅj2Ht$(L1E1Eƅh]= )e藊D$@LZ5H$ uD$f|$@APHErEƅm!AuHPHXAIt6E HEsCiH$`H1}HETuvC1}HEH tHDžHDžHT$hH|$hHEtHlHtH|$(H$ HHEP<{EDuYDeZ.8!HtHtH H9H" H$ H}$ ED$gu APD$g|$fuȉL$0= D$0 |$g D$@ D$0 1|$gt|$@m!H1uu%1ҀJuH|$hHET$8HtrpuVƅkEO|$0DAIt@APt:tuCm HUvC0vCTuCHDH1{1Eu)AEtAXu|$fuH$ D$ ED$ tH`;f$VhucEHs H$`D)eHp!H$`AHHHL$XED$@u!Dp!Dd$@EtuD$@t$@HEcu dtAXAEH$`HH%HKuH1uH$L$РHD$8HT$0HL$hfHuH0@LHL!uHULL$0 uHT$(uLDH$1luHL$HL$8H|$($HL$LwuAuH|$hHBu8H$`xl!H}H020L 0u H$`HHZHu0)eHuD$@AfH$ЀH0H}H0H}H0)HEǀ0H~|$@t:AIt4APt.AEt(HEhtHPH$`HHAH$ R&H}E$  D$gLAE1H|$XƄ$ޢgtA$ޢuELtH}HtHT$XL$ޢ1D$H$$ޢ1$H$`115vHEAEAAPt@H$ E1Ls HT$X9L[HT$XL)e蹇E1tC1vH|$XHt$p1HDŽ$ HDŽ$ HDŽ$ ['%H$ H;t$| H;ET$@BЈT$@)e'H_D$A'uD$@D$0THtH|$(D$@D$0eTHtƅk|$@,H$ HHmHE?H$`3HUL$@cEȈL$@AP4=AE?tCaHt$XH1tsC`FutAut 8t kHs H$`()e虀|$@t#HUH$ }H}1HtHtHtHDȃHDЃH$ HDdH$ H}H$ HCHM1HtHtH$ HDЃHDHEƅm!HT$XHs ED$@D$0ƅpAE1puHxuHHg HHHtƇMHM*T1HXv$о9HtC^ATAXD$@KE1HL$XHt$(HD$@|$@D$0|$g҃|$gT$0H$@HuAHHHHD$(Y|$g$@|$0LD$(HL$XHS H$ AHaUpuT) HI|$th1ۀ$?t^H$p`LLf. uC[HL1n$gCL<1ۄt)ez1H$p`aH$_dH3%(H_[]A\A]f.CLӫkH$`@LH螼HL+I|$L1 I$P1^@L@b,tDH$`H$0 1HDŽ$@@HDŽ$H@HDŽ$P@HDŽ$ HDŽ$ HDŽ$ $?HL迻HL*$?1|HI|$1HHPH 1ۄR1HLeI$H+$0@H$ H)ػI$ H]I|$1HHPH蓖:fD H$p`H+HfUSHHlH8 ƇpAHHDŽ$ HDŽ$ HDŽ$ 1HHH{HuH{HPHƕfDH{HtYHC5u>fDHt1HHtH$ HfH0"HC5HPu4It+=g# t"pAta )eMwH8 []ÀVu탸Its/#tPuCWH1jH$ HHB>H0!HCVuCVH1jqHvCVH1zjXHx|$hHD$dH4$HT$HL$D$`R)HxÐAWAVAUATUHSHH8@\:L8:L$ T$'D$D$HxTHL$HD$|$HS HT$t} tHL$yvi| t`HL$HD$1HH HHEHx HS HT$u HT$Ht$H HHP(LHHD$(N,(LHHt$H$0  *H$0 ʰA$c1A$EE1E1AAtg@H$0 CHDHt$HPH1Ht$(HP 1H8@[]A\A]A^A_H$0 ?/tAHDH$0 HPLHt HDžEt$EtkA$t|A$MHt$H|$0H|$0踯HDHt$0HPEAuHt$LBDH$0 jfDH$0 F.{@HؗHT$HD$D$ BHG@HHP(HK HD$(HL$Ht$0H$0 |$ T|$ Xb^vCRHt$H1fH|$t$H\:|$'H|$HT$ H` HE@HL$A$HHDžx =H\:sH3HH1H+tHP |$'RwCQHTH1eA$T!vC1eDƅ5@t `vC|$ EAWL~ AVAUATIUDSHH+D dH%(H$*1EɈL$kDT$l:Hh HH9CL$@"LH` H$!{ !DSh7L$@!DL$@!DEAARDDD$(AxCHD|$ LSDɃ t$DD%L$AA T$CAEɉ$1AAI} f H$" xCHHD$`Er|$k{CHT$XuOwCH16c|C1*cHT$X0D!L$@!AwCLE1AAI| 2 UL$" xCLLT$`~HH H$p @ͺ2 V@ LL@C1*_b|$kH$p tyC1@bLwC11bH$*dH3%( H+[]A\A]A^A_Hh H` L$"AA,xC  L1LT$`{f@xCMLHƿC1a{2I$TxC舁zC(CMdxCHMHHƿPC1BaHt$pLxxCVMHT$pHƿPC1a }HH HP 9HX CMLHƿPC1`x p|$l|$l8pC|EaH!iCII H=v Iƺ\xCI|$lDkwCDcCwCHT$XHE^LHT$XHM1EDȂCH$H ` u t3yCLXCH1_ b - A#4pC1_if.L$@"uCL{L,pCc_-fD zC\wCHDnKHŋ!t dxCNKHHƿPC1 _!|$lxxCKH!HƿPC1^fDHT$`H$!1C^H$p 1tyC^x <C1w^2fH$" wCHHD$`az@L$@!uCL>zJfDҁ@-lD‰$@!AA-tD%EAAtDЃD綃w滃rAD%EAAsDЃDɃ ᶃw҃⻃rA@D%EAAsDL$@!DL$ %|$0t$(L$T$ADD$AhCwAE҉$A1D\$8DT$LDL$LMULArvfD}CHT$XHwCH1\~C1\HT$Xg@1CXCw\ABAAu A$vC1.\AtC`yC1\AYC`yC1[BD } ЄC| 1[f1LƩCGHƿC1[@xCGLHƿPC1l[CGH$!HƿPC1K[xCqGHT$`HƿPC1-[#xCFGHHƿPC1[~H$p HX 2ZNxCGH$p HƿPC1Z@H$p HP 2NxCFH$p HƿPC1qZ@xCFH$p HƿPC1GZKf | zC1@CZx aC< xH,ŠCh@ !8pCP{CwCHE;D%EAASZDD%EAASDBEfD$`CA$uH$"XfDŽ$@!d/H| HL$p1Ҿ AAb 0{Cu `{CwCHDHT$pPC1W"fHA贏LyCH1W6HB蔏wCH1W#H` I$HF` H$"LHHcщL$XPL$X1IHƄ"uffff.AWAVAUATIUSHX!dH%(H$H!1D$/TAEt AD$/BH$!D$LAA$VD$(HD$@HD$8HD$0D$'Ht$PL`A$5H$!L)Ht$PH$!GAŻD$ H$! tEƄ$!ADŽ$P D$HD$E1H$HvD$fDH$!*H$!Hd$,\uE1E11HLw1ۅtL$'DL$ H$!DD$H$!H $uH$D$HD$L$U@IE@E7|$/,L$'H$H$!H$!E1A$t$Etc|$/t\zC@HƺzCPC1~T$P t!yC@H$P HƿPC1RT4pC1FTfDEE$!CH|$H$ !IH$p!L4|$'|C1SHt$LDL$L$P H$p!H$ !C1S4pC1SD$Lt$8D$LHD$HD$@fD$(I$puH$!#fD$u$,\uԀ$tA$H$!11tH$!11,H$!#hC?HT$0HƿC1RC>HƿDmC1R$HCtyCyCHEо8pCyC1R$H$$t8$\mC1HRȅC$g>uH1*R$u|$uR$t0C2>H¾\mCyC1Q4pC1QhC>H1QDzC=H¾\mCyC1Q뎿C=H¾\mCyC1QayC=H¾\mCyC1cQ yC=H¾\mCyC1@QyCa=H¾\mCyC1Q~C1 QL$H$P H$ !C1PByC$=H$P IAxC221,$jA$H%E uCgH$ I.gN40IH$ HhDLHZbHLBhA$ ADŽ$( A$ A$ DLA$ ƃ mCHHktCHk¸u 1LH4H$HdH3%( HH[]A\A]A^DH$ 19$1@H$ H޺諀H$ n$ teH$@H$ H$@gHHH Ti8A$, 1-H濠)e\H$ CfH$ 8pCHS1iHx|$hHD$dH4$HT$HL$D$`b HxÐHHH?u HH=ffff.Ll$AH\$AHl$Ld$DH(H9/HAtCD身D,(ELeHHt,JD(H+HDH\$Hl$Ld$Ll$ H(Ð)eE13WԐHH1&AFHH*F HHHF F F F HAHF F FFFFHHH?HH)¸TADE)DEADT AH LHHHHHHHBH=uƆ10@Hc|>9@ǃ@A.HuULcSfD&HcHJHDHtH0HtBtL)4qLcƉFL.HMcFTD9t0AIHcLANLL JTLD)AELLcBL.HHtH2HT[]HH;ƇtLT$H0IILT$LT$LfIIHu>HHHIILP HHHHA HD$fAKfHuIII9tHL$M9uM@M9tAHIf:uDJEA=HB LZDfAHLXHRHB If:uDJED=~M@M9u@LD$M9f.I@ IPEXHPIPAHB ~_AHHH M L fDHHHHH L9uHDH E\+IACHT.HcLA9t<DHcT)A)ˍQGHcB HLLI L HLHHTILDLD$M9 LcIPHDHHHL[]BTH1IL+ RHcI9ekH)HHHHH@@HLJJHLJHHLJXHLJPÐfATH1 USHHHHJHt NtЉ|HhKH;`KHHhKtHHHXH@ pf@fUKLHHcHl HDH1HHTID$H`1ҋ|HHƃ x1HIHHHIDHHHqHDH uE1ADIcEпC1E)H@A1f@D @McM3@fBD[uHuAAuHSC 1Hcƍ HHD@fH@HH9uH@u[]A\JH`KHkHH;hKH`KH)HH`K+HpKHtHHpK1Hfff.SHƇ tHHƃHƃ@ƃ@@HHt Ht fHtHƃƃƃHؾuHH9uH 1ƃCHH HHHױH[Hƃ@ fH@Hfff.AVAUATUHSH`HHGDH9t5:rHJH H@:@rHB BHJfBHCH9uـ@E1AADCHL\B AfDCrEpA)HAA42@rfs DsH AA)DAfCy@:yv5D)LaHH H0Hp pfpH;Ct@:xwD(@xL`L9uAAHDHBx1DH xtFf)ffDAAA)fDCA9PAHKMcHcF JJIA9tRHcHl LlMIULHTHΉ\IcHl HTI$LdMLcL`[]A\A]A^HD$CQƒV҈Vt‰HL$LH(DsfKQfTs$a$L $aEX$Y9ȃ=MFwA?X)ǃYуH)MtOHHpHKHH)H!  HHpHH!HuH([]A\A]A^A_ÐǃY ^EYt JXDAddHfA ddHA@ddHvAAƃAl$A!%fY9ȉOr)XLAddfDL$_$hAAƃA!Afff.AVAUATLgUSHHLJXL[_X11탻X$C1ƃt1@CAHADхt,C1ƃu׋XAHADхuԃ4@CL^p LǃX )D~^AddH=VADD;YDH)MtLHHpEHKHL)H!  HHpHH!HuH[]A\A]A^CAHADхt,C1ƃu׋XAHADхuԃ2L4C1]XLǃX)ЉX!]dHA dG%HcȃH'TKtHH'tCftKfTCUH)MHpHHKHƒH)H!HHpHH!ȃHuH[]A\A]A^XYfXDH)M;HHpEf.HKHL)H!HHpHH!HuH[]A\A]A^LD$g[D$=rDH)MHHpEfHKHL)H!HHpHH!HuC XH[]A\A]A^LǃXZA@ddHLAAmZAƾLArZAH)M퉫DHHpAEHKHAL)H!HHpHH!AHuH[]A\A]A^ǃX@AL)MHHHH)HHhHH9 H9LKIIIHvzLHAAENLfD8@9x@yx@yx@yx@yx@yx@yxH@yHL9uJHIABA@BA@BA@ttBA@tgBA@uZBA@tLHpLD2DHKH!H  HHpHH!L9HufDSHHHH9tYƇMsPHKHcH#pH?#!HHKH; !HƃMH[fDH)HKH; HH[fffff.Ht HИƇƇLJ̘LJȘ1LJĘ.HHH@u>1HuH Y1;J@f.ǂH@0f.AWA\AVAUATUSȘD̘IHD$MJ7DDИH(L DD$ED+DADEҋؘD$AҋԘAҋAADܘEF@AAAAA)D1D)qD)FAAD1D)DA1A)D),*AAD1D)1))ލAAD1D) 1)D)FAAD1D)DA1A)DD)DAAD1D)1) DA*QADEQ҉Q̘BJ7DAE1Af2D9sAAH uA v []A\A]A^A_EB$CHT$A\IH׋̓HT$A\IH׋|HT$\HHИJ xJ mHT$\HHИJ KJ @HT$A\IHИJJHT$A\IHИJJHT$A\IHИJJHT$A\IHИJJHT$\HH׋ИhИZHT$\HH׋И:И,fDH\$Hl$1Ld$HwH)xE@LcNLHsH;)Hc~a‰H$Hl$Ld$HÐE1tHHcLcLH47>CfHMHǨFD1AHu#ǂǂ@Hǂ HAf.AUHATE1USHHPSAŃу ASt;1HhP AċCƒA9CwHD[]A\A]U1SHHO))@~&tHHcHcH47ǃXǃXHǃXǃXǃHHHǃXXfAU1IATUSHH Ld$@LHt 1ATHD@H9rH H 1D$@CDC1DA4TATT@TDHHuڅHsDH*1f.AUt ΃fs I9wՍHHHǃ AAIHE1ɸAAA))fAǂAIHE9v_wDD;Trf.w;TsH+TD)TD9vS fAHĈ[]A\A]ǃ-fAWAVAUIATIUSHHdH%(H$1z~1fDDwiH3AƾHA r3AuH3 HDP3EAf.vI$;H$LE1AH {BA39HKHc֋{E$4<DDTD)AD D%A;;EAAD;DsD;DAAuAA<8EAA{A403C+;A;A;$;C‰AD8Hw]DADAL 1H$dH3%(H[]A\A]A^A_DOH1 H߃ D$ o1EtD\$ EjAAƅ{u1A9[Ht$2LL$I$H$B@LI$H$LI$,H$,L3fD)A8<AD8@<:{423hf.EHD)HW0 H߃ $!0$$AfDDADAH/ H߃D$ /GH/ H߃$/$rD$ fANDAL LrA fEƄ AۉƄ;a1P'DAAPAWAVAUATUSHHH~8H|$C$S0DCA9C,ǃJADxJA9AʼnD$HCENE1HD$(E90E9|D9D$ JD9JJJH9HJуDK H IJDH{tHL9rӅ{I NHHT$ZLHHT$LI)J,HT$LHA@HT$Eȍ1#pA E$1H9@v H8EH1H9tH)H#pH9‹EAHE$UHEHEE,E$EHT$ BEHh[]A\A]A^A_fHAt]A@HHDu HD$ WHHh1[]A\A]A^A_f1HH11RfDLL$$H8HT$EL$HfL‰D$,1t$,H|$0E1HD$0HD$8HD$@HD$HD$P=LL|$0/DALAD9l$,wHL$ T$,LHt$0HH|$0;S@LALA H1ɾHDtLHT$L$t$HT$t$L$BH|$0v;1H|$0Hb;Hf.Hl$HHLl$Lt$H\$ILd$L|$HHx@HADž1LD$W:D$H\$HHl$PLd$XLl$`Lt$hL|$pHxH@tH.D$u6DHHADž1fHD`tE1mHL9Hfff.AVAUATUSHH@wHS HcD D L AD A D)AʼnE{ A40AAs ACH|$DHD$HD$HD$ 1HD$(D$0Et$C9~lfDHKHc4DT+K  ЉHL$ĈS ЃCD9S C9H蒨u.A9v)1H|$D$I8D$H@[]A\A]A^CXHc΃D D T Ds)AD  D`fHc΃D D T Ds){ AD  AAH@1[]A\A]A^HT$DDH=!H|$Hk7HfAWAVAUATUSHH #uoAC111AA~GED<AAAMcAF`eEE9A euBA<>DDIt뤀MƃM HHpHHH!ы9CH~HHH)H!H=w.H9t)HʳHMH9M M DCH{HDK DIc DT  D)D%;ESAu D9v fD;DIAAuG +EAADK GH;DCC‰C =w(HHK HHpH~=-CCDKDS IcDtLLT ȹ D)D%;E]A.D9v4fDDA;DAAuAEGB+EAADS G 4;DKC‰Cxʋ`e et/ 7D @D=v =HHωH)HhH-H9H9 LKI<8IH HvoLHAAENL HJHJHJHJHJHJHHJHL9uJHIAGA@GA@wGA@fGA@UGA@DGA@HHpD====-CxCtVDCDK IcDDLAD ȹD))%D‰s FDCHǃ҉HH)HhHH9H9HKHHHH @BHHpiH9HHp_D)CF DADK FDC^H˥Ac;FHHKD,HHpHArD)HGHpL0 DHHKH!HHHpHH!L9HuRDCDK IcDDLAD  ȹD))D%AAAAEDS DKD)xCxFDADS F DKEEkD)He#H脃ǃHH[]A\A]A^A_t-…DtƒuDKDH-DS DL.Ic DT  D)D%;-@AAdD9-vDD;DrAAuGDADS F AK+-DKD) .;-C‰CP:DKDS IcDDDLAE A ȹD)A)ADAуDS F DKqHHH)HHhHH9s H9HpH|0HKH!HHHpHH!H9Huq_y ZHHpH GHHpDKDS IcDDDLAE A ȹD)A)BTAAADS F DKaD)P.FDADS F CP2DKCCtXDKDS IcDTLAD ʹD))Ds F DKHHhE‰HHL)H9tH9kHKAH<>HI HHHAAEN\DDDBDADBDADBDADBDADBDADBDADBHDAHL9uJHHAkGFGFuGFeGFUGFEGFHHpHpHxHKH!HHHpHH!H9HuatjHwHpLHHKH!HHHpHH!L9Hu HZxHHpH'UVH@AAƃMH[]A\A]A^A_@H虱HQt@t KHt:DD)PE1E1HtYAtMAF401AAt ̄~AVAt$ HBHHpDH|ǃLKM IH LLHI8@:x@zx@zx@zx@zx@zx@zxH@zHwkHI9I8 JHJHJHrJHbJHRRPHHpDCDK LIcDTL`AD D_ ʹD);sDA;TrAAvAG DADK FAK+DCD) ;CщSd+tЉ@H.LAA)dSd#F DADK FDCAǃD@,fffff.AWAVAUATUSHHHHLHHpLH1L)H!HC@HL$ HHKHD$0HL$86fAD$H+H#pH9D$ rAD$ HHH9IIMLA<$tA|$ uAL$E|$HL)H#pH9sI9t7HLHHD$L$HHD$L$HIH)H#pEL9E]H|$0E4D#pLHD$L$LD$HS@EHD$L$LD$HT$(t D9MHt$(H|$8LHLD$EȩLD$Ht$(DLHLD$;HHB*LD$tH;LH7LD$HHHLMƃMHL)H#pH9@E1H|H11HH<9@H@HH9sAHtHHH)HHH41HH9H>HIHNHHfDHHEHHh@@HpHFhHH!H9HKtH9tHH)H)H!H!H9sHKHH[]A\A]A^A_LhI)MHt$(H|$8LHLD$LL$ELL$Ht$(LH|$81LLD$&fLHEHHHHH)iC@HHKH|$(LLD$LL$ELL$H|$(LHKLLD$fDHHKH|$(LLD$EQLD$dHLAH9HHH@8t@ HHH9wAfDUHSHHHwWHH1H9tH)‹MH#pH9EM H#pHUEHuLBH[]HvHǃ느AVAUATUSHHMƇMEHHpLLcHH!ȋS;HHKHH)H!Hw.H9t)H^HMH9MuM sH{DC DHc DT  D)D%;yEJA> D;sFfD;D3AAuAEGB+EAADC A41H;sC‰C Cc…tƅuDKL-DS DL.Ic4DL ȹD)D%;-cE^A D9-v fDA;D AAuAEGB+-EAADS G  .;-DKCCP:@HLLH׬t.S90u:LLH蹞uH[]A\A]A^9t1Hau HHHp D9C |D)FDADC 42CsMt?HH;LHHFHs\HKHHpSHHKHHpH+H (H;LsH+ðLH˰KEQD)@ϤHLHkHLH&iHLHHL?RDKDS rIcDtLLT ȹ D)D%;E^A D;s DA;DAAuAEGB+EAADS G 4;DKC‰CxP=AAADAPADKDS IcD`LD\LAD ȹD)D%;E^A D9vC DA;D* AAuAEGB+EAADS G  ;DKCCd+v vMHHH)HhHH9s H9AHWHpL2@HHKH!H  HHpHH!L9HuefHLpHK6HHp6tMHHH)HHhHH9=HpH|2DHKH!H  HHpHH!H9HuDADKADS ADIc4DL  ȹD)G%D)tDADS F DKD)xCxFDADS F DKwHKwHLHHHhD)P.CP2FDADS F DKMHHH)HhHH9H9 LKI<9IHHvnLHAAENDf HJHJHJHJHJHJHHJHL9uJHINA?GAA.GAAGAA GAAGAAGAAHWHpL2@HHKH!H  HHpHH!L9HuADKADS ADIcDDLAD ȹD)D)%EtDADC F DKECD)HD[DS Ic DLA LA LDA DAD)GT$A D)AADEAADS EDK|LKI<9IHHvqLHAAENDD HJHJHJHJHJHJHHJHL9uJHIAGAAGAAGAAGAA{GAAjGAAHHpƃMTD[DS McB BD BL BLB| DD) D) EDADC FD[EsD)=AAD)dCd#FDADS F DK^H9LKIIHHvzLHAAEOL9@8y@xy@xy@xy@xy@xy@xyH@xHL9uJHIABA@BA@BA@BA@sBA@bBA@HHpDEsD)HpnAAED)AA]AArf.AWAVAUATUHSHH(~8 E$U0DEA9 E,HUHpAHT$DxJA9Aʼn$HENE1H!E9H/E94"D9$ J D9J HKHH)H!Hw%H9t HHMH9M DEHEIcDM DH}<4TL DD)Dف;T@kESA D;T@sD;T{AAuAEG B+T@DADM F;UHHAHvtAHHEAEND JHJHJHJHJHJHJHHHL9uJHHAAGAFGAFpGAF_GAFNGAF=GFHHp,AϹD)AϹD)AAfDATUSHHJHJH@LdL9HpHKHH#HH)HH!H=w!H9tHHMH9MEuhf}LHLzHH#pHKHH@<uD)H9sH I9NH[]A\Ã7fuEHH߈$ED$ED$ EH H D$I9HhLHI9/UHKH BII9LLf.Et …t H@HHhDMHHH)H9D(H9LKDIIHAHv}ALHEAEJ|@0@1p@qp@qp@qp@qp@qp@qpH@qHH9uJAG HIEAA BAA@BAA@BAA@BAA@BAA@BA@EAHpJ| HKH!H  HHpHH!H9HuH I9J'HHH)HHhHH9EHpH|2fDHKH!H  HHpHH!H9HuDEDEDHUHH)HhHH9sH9rjE;HWAHpNHHKH!H  HHpHH!L9HuH I9:LKDI<9IHAHv{ALHEAEJtf. HJHJHJHJHJHJHHJHH9uJAGHIE4AA$GAAAGAAAGAAAGAAAGAAAGAAH9LKIIHH}LHAAEOD9@8y@xy@xy@xy@xy@xy@xyH@xHL9uJHI ABAABAABAABAABAABAADH1[]A\Ð@AWAVAUATUSHH8N@HYC0H{(HiJHJHH  fDHJH9ƂJƂJHuHJE1E1HG$HHG,G4HHHVSHV8 DfH : uHjL93I$HV IHCHfDMLJIHhKH;`KI$tUHHhKHHM9fL~Hn DvNHrHLl$ MefHpKHt\HHpKHED:0tH D:0upM҃)э6)9rN49у)D1LHT$L$LD$p:LD$HL$HT$f4 1ҍ DHf.HAW1AVAUATIUSHHH`hD0H@@HD$0wwHHHH Htgf9%HAD80u0HD8p HP ur@:pr"LHzLD@fDBD0H@pHx@rDA$pHI$LD1HI;$LI$LH|$0H;L$0A$pA$pII$HI$XDxD(DAE)E)H9I$JEEIHD$8Xf9E19AƒFTfKHsHHFD0DPLxf+H[ I9$H1+@T-C D99ȍ D9!ȍ JfKэBD4RA<69H<9E)199ETDfK1AJI$`K<H9I;$hKI$`KvHH)H|$8T$(I$`KDD$DL$LT$ D\$t7D\$LT$ HDL$DD$T$(HHCL:AƄ$ HH[]A\A]A^A_I$`LKHHCI$XI$HtHH[]A\A]A^A_@rfAWI$XI$H1HL$0H9I)$LfDLSBHEJHcAJA9 HcHl ILHHIDLHHL$(DD$DL$LT$ D\$D\$LT$ HL$(DD$DL$McIl KDIOTHHKA$JHcHl IDHHILH^HSHS fPHCHw:ɈH1AfA$lfKBDLg@xxDHD$0I$HI$XHH[]A\A]A^A_@A JI$`K HI;$hKI$`K2H|$8H)DD$I$`KDL$4DL$DD$AHQ<@ƍApH@r1LHL$(HHD$0HL$(2fI$`I$XHHI$HHD$0)SH1HODJDJD+JD񉎜J1HwAJDAA1D9DNE9L`Mƃ fHHV DREE9uA DJ @HHǃ`hHHH)HH H9@u쉋JH[C DJH`9A xDNfGA|ǃJH[f.H(:ǃJDJBH`A)DJBfGJ:NHLLBD LDVfDRNDLFH`~|HވD$9D$SHHDhщD)f0HE1D HcHHtHO  )BJ9OAE19ѹAA9HN HJ J HHDNA1fA)ЅfDJHWD I1H @H DF8tDRIDуtIDJDJ1DJD+JADA1DJAÉJDAA1E9A9H$BD9!Hf.HHDBDD9~쉃JJ)ȉJNw!FFuf&FNH`BfGz|| xH[DJHL$DJ+h HHQDufDhH[DHAǃJIH7_HƇ  1HHÐHHH)HHhHH9H9LKIIHHvzLHAAENLfD8@9x@yx@yx@yx@yx@yx@yxH@yHL9uJHIABA@BA@BA@ttBA@tgBA@uZBA@tLHpLD2DHKH!H  HHpHH!L9HuÐHl$HHH\$H(HH0YtH\$Hl$ H(@HD$<8ǃD$H\$Hl$ H(ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<衐HIH3HteHSHH͒HsH;H-,H;%L#HkH\$Hl$Ld$ H(f.H;H4HItXL#Hk(fC1)e7)e]HCHs))eHD$AHD$B)e&뜐SHH?Ht4{ u[hHsHS+H;[Jf.[ÐSHH?Ht4{ u[HsH+H;[f.[ÐSHH?Ht4{ u[ȏHsH*H;[骏f.[ÐH\$Hl$HLd$H(HwHGH9Hwv{HWHt H9HHHl H9HB{ tnH<qHIH3HteHSHH蝐HsH;H)H;L#HkH\$Hl$Ld$ H(f.H;H4谒HItXL#Hk(fC1)e)e-HCHs))eHD$HD$B)e뜐H\$Hl$HHHSHlH\$Hl$HÐH\$Hl$HLd$H(HwHGH9HwvzHWHt H9HHHl H9HB{ tfHHHIH3Ht]HSHHHsH;H~(H;vL#HkH\$Hl$Ld$ H(H;HH9HItaL#Hk(fC1)e菀)e~HCHs1)eHD$~HD$A)ev~듐H9wr HwDH+wSHHH4$HT$HCH$HHHHHT$HPH[S@FHu tq/Et)Xt$P€tu!Vu(Bt-[ÐfVƃt؃Lu܃Buƃ[DHFC'yfS CH[HH1uo[)e}@SHHPuUu =,S#t HP[ÐH|$1AACPPR#$2Wu'C[Ht$HǺ1nHP[Ht$lC1n1fAUAATE1USH;I$CCH蓎t51DH`CHytHHPuCH^u:IIu4pC11nHD)e[]A\A]{f.H8ZH1mfff.AWEAVA1AUAATUHSHHH(`趨HH$DŽ$ @蟗HD$HD$DH$ H苖tgH$ J8I0EtctA$EuzH$ 1;8*IH4$DL[tH(`[]A\A]A^A_fDtH$ CEtH$ q$ @L$ @uLHH$ DL[cA|$6/H4$H|$D$.D$/諡Ht$H\$Ld$HLl$DDHFHl$Lt$HH(HEDAD¸u1Eu%H$Hl$Ld$Ll$Lt$ H(GtHGADHDfD1Ðfff.HHt H;v"HHtH;fDfDHHH9t H9~HH1H9tH9H\$Hl$HLt$L|$LLd$Ll$HXMIHT$D$ EɉL$ Et|$ uELk E1LVH=v>DH\$(Hl$0Ld$8Ll$@Lt$HL|$PHXA 1ALLЈD$uHH LuCAuAt AGq|$uPIHHh H9t E1H9AIHH9tE1H9DIFAL蓓T$ LHXuALaHHuE1H|$tLH=HD$|$ DHH蚞@HPH鴔@HcHPH-ÐUSHH>0uL;1u1f VDH;tV(DuH@;uH[]H11ԇH[]ÐHl$Ld$IH\$Ll$HLt$H80>'?v;HLH$0H$0L$ 0L$(0L$00H80É$ŠC}Hu I$ `@CAƄ$DIHuL L辥Yf}'E P -HHDI$pDEEs AƄ$dD}&SHL}H]<}|&ES W C @ A$X|@}@&0  -fDJADŽ$l9fDULmE}I$G%I$FNHEڃ}@@ LH軑fD}%AƄ$fH]CH#DuHECI$8EHEw}8%CE0A$DEHL5D}$PHLDMHuEI$011+4pC1eDE}$L U -AƄ$b@}X$OHL$o}Lm,$P[}+A$LLz A$/}#L-<+"fHL1}+A$1L6EAƄ$cEu}=#H@S)FRAƄ$D@}#ClHL@EAƄ$4HuA$0I$011)4pC1c$ŀCMQЃt q΃Gڃ-Dڄu-u HHH_ A$A$A$VHuI$UX@HuI$?X*ADŽ$ADŽ$HuI$VHuI$VAƄ$AƄ$BAƄ$f$ C]HE(CH$ HE$ dL$ I$I;fH|$LޖHt$HH(D[LkE;LHHtA}.IECLDLb~HuH|$MA(CzxH} A$HL>}H]-u};:HE1) Pw HcҋC;+ƒ-t ҹtH7;HH@IH DhDpsE1xH0 AH;MuT@$ŰCAƄ$HuI$0{AƄ$aAƄ$r}-HuE AƄ$KAƄ$=AƄ$`/I$0HzH4HfDE2O1ADŽ$h@A$XHA$\f}h+-ADŽ$@mDI_H]HA$T:HE}Ht#Hxw=A$mA$pRWAƄ$CHAƄ$<DHLMHL5AƄ$rf}8R_H} A$FMVL*}H]螎HI$I$ `莒;{HkQJ;H^ADŽ$lfDADŽ$l3ADŽ$h}I$0HXwH4HSA\$HuL AD$AD$0HGAƄ$ADŽ$@}AƄ$AAƄ$ADŽ$@ADŽ$@ADŽ$@ȍCHX7ADŽ$8HAfH}u}H]ADŽ$hCADŽ$h2AƄ$$AƄ$ADŽ$ADŽ$HLADŽ$@ADŽ$@-ADŽ$XI$AƄ$%}HFpAlHLPA$XB1}-A $X%}H]虋HI$A$XHLI$fDADŽ$I I9uH莗E$$H}A1HD$$HqHLA$E؍CHwVDmHECI$EHE蹎E ύPЃFڍSFڃ-DC%MAA$OUAH} u?kf.RtPCt?HL+؋|e](LuE$$1E$ 1E$,1E$,E$(E$$E$ AWALAACHu+ADŽ$8A$A$}uDup}Cu AƄ$U؋|o:DtD~ЃPtQuADŽ$8AƄ$VAƄ$T밾CHuAƄ$CHAƄ$Wfffff.AUATIUHSHLfDII)IIJ<mrHHt4HLH'HHt;-t*Hs11HHuH[]A\A]fDHsLfUSHH>-t2uHH[]qH[]fuŃ~-HnXCHuƃ@lCHtKCHuHHj8t(H8H[]8UHH5(H8U떐M\ƇPH\$Hl$HLd$Ll$Hh >-Hu\LHLoSH$H H$P L$X L$` Hh D&EHE1oHtDdD蓒@CAqsH|AEAAXA ă}@L:f.}-HvuYDMEuPƇ@ILof.H&H\HhD蘑UCAʼnrAXAAEA HAT Ht$1HHDŽ$ HDŽ$( HDŽ$0 nAtWtW$ tEt @HFH~H @Hhtǃ}@tEuH肐uD$HFH}ƃA1D$$AH @HHH蛐^fDHOfH9tHuHG@1f.ATUSHH@t(DEtHCpHfD&EH&HaHIQCHCkpHHPHH}EwuHHHxsH@HHyQH)u 4pC14QH@[]A\փH^)fHC먐H$ЁHH$ЁsH$Ё6x$H${H$H&|lH$E1H規HDŽ$`HDŽ$hHPHHDŽ$pfH$PH{H$PHtH贎H$xfA|$6CHƶ3L$HL& gCL贅L茶LHH1ɾHHLu gCHVH BH$ЁH蘿HoHH$ wHoHH蝍ސf.AUATUHSHH|$zHt$E1E11ɺЎCD$$=Lp@H|$nwHHu UH;u pCHO DEtH$PL薃$P $TA ALAIASAMAVARL$PH$ AC 1gH$VhH$HHI J4H\Hs$HDARDŽ$TkVt R]DŽ$XMH|$2uHĘ[]A\A]H|$HuHmfffff.SHVHFǃǃ&ƃǃƃwHFwHGwHIwHPHwHx[fH\$HL|$LFHl$Ld$Ll$Lt$HHVLwwLFLhwLGLYwLPHLJwHIH;wHH\$Hl$ Ld$(Ll$0Lt$8L|$@HHHHUHmlHHD$sHD$HLsLsLsLsHHHHfSHt[DHtCRu"@t[ CR@CRfUSHCH8-iHHtaH-gHpHH$HD$HD$HD$D$ )xHT$H4$HH4$HlHrH8[]HHrHkf.AWAAVAUIATAUSH8LJƇH$HD$HD$HD$D$ ~gH˽H4$LdHA9~DH{/fHpHH{HT$H4$!EuH4$L0HA9EuLgHqH8[]A\A]A^A_HHqHjSHH?Ht eHHCHC[ÐHx|$hHH4$D$`T$@D$dHxÐHƇfHH9ufHƇfHH9ufHtHt1@HHH9wfffff.UHSHH_dHtK1D0HH9wH[]f.H\$JHH Hl$Ld$Ll$H(L9IHBHHHEeALHHl$H\$Ld$Ll$ H(Lfff.H\$Hl$HHHt>ƇHWbHPHHHHl$H\$AAH+@Ƈu>1HuH\$Hl$HfDH\$Hl$HfHƇ8pC/fffff.H\$Hl$HHHuH\$Hl$HfDIHE1ɺHRDH\$Hl$HÐf.SHHH$sHHcH$HSfH$H$fDHH9uH$HHH9uH[Ðf.HHH`H$HfHH9uHÐ@=)#AVI1AUEATIԺ0 UHSHHp"H_1HHfH$ H$ "||H$ H$!1ɺ28HtHI94pC1EC"1HH1EAApC@@CID0H7Jtt!tfDHp"[]A\A]A^fDH$!L{H$0 1ɺ2H7Cj0L$0 L$!H$!H$ "HH1D#0҃m@_VC0H1CLHoF<҃(H\$Hl$HLd$Ll$HLt$L|$HX @IIME̺@HD$ HHHD$xH|$ LELtvtrH$( H$0 L$8 L$@ L$H L$P HX fDH1@HD$T$D$T$mǃ@1끐LHe1҄kfDLHT$AT$Eǃ@14@ǃ@H|$ n|H;D$t@Ht$ LH7wH诨1҄LEMLHHHt$ LH}D@`vCvCSHDHH-HH1[eADf.HHHA0CH1/Affffff.HHH0CH1@fffff.H\$Hl$HLd$HhvH$Hl$Ld$HfDGh$@CfDC,HH$Hl$1Ld$H@HC,HHH$Hl$1Ld$HO@_@Cr,HH$Hl$Ld$1H$@_@CӿC@,HmHoHC',Ld$H1HHHl$H$H?HC+HHUHC+HH=C+H;HDH$Hl$1Ld$HAH7hCH@C+1HHDH$Hl$1Ld$H@HCZ+1HHHoCB+H;HHHopC)+H;HHHoC+H;HHHo0C*H;HHiHC*1HHOHOLG0CH11@`C*1Ho@HHC*Ld$H1HHl$H$HA>LgHoC_*H;LHHH$Hl$1Ld$H?HoXC,*H;HHHo(C*H;HHC)H;HHjpC)H `C)H;HHoC)H;HH'hC)H;HC)H;HHCp)H;H(C[)H`CI)CHxC2)H_HoHC)1HHH0C(H;H4LgHoC~HoXC(H;HHFHoC(H;HH*C(H;HHoC(H;HHXCo(H;HCZ(H;HHo CA(H;HHC)(H;H^8C(H;HIC'H;H4C'1H HC'1HHFHoC'H;HH*HoC'H;HHhC'H;H1<vCLgHoCHo`CM'H;HHLgHoCHoC'H;HHHoHC'H;HHuHoC&H;HHYHxC&1HH?HC&1HH%HoC&H;HH HoC{&H;HH@Cc&1HCO&H;HHoC6&H;HHHHoC&H;HHHoXC%H;HHmHwC1^XC%H19vCHXC%HH;=ff.H=I#u HfDH+!H=[~YeH!HfSHC2%HH19XC%Hc>[ff.S1H4pC8C$HH117:C$H>[ffff.U1SH4pCHi8@HCCHD$HH119Cj$H=H[]DHcHw:I@HHfD9w(HH9r 1f1fDfDf.UHS1HXH]HHHMufHH5t#t-H}HHuHH#HX[]fATIUHSH CHH$ It$LH$ HHLHH$ H"H$@H$ H$@@CH$LKH$H$@FtH$@CH$@H$;H$HH[]A\ffffff.AWAAVAUIATIUHSHHX{LHEtkfDE1Lt%HAOLHAt&ADsHHLHDAD9}sHX[]A\A]A^A_ffffff.H\$Hl$HLd$Ll$H CIHHIHHAHH6LH[@CHNu(H$xH$L$L$HĘH$ Hڹ@CHLLHHiH$ HiuH$ Hu@CHܐAWAVAUIATIUHSHH8@dH%(H$(@1HH9AE@uDI@HFHEHt$ HPD$tdHt=LE1HD$HT$Ht$ HHL$IdHL$H`L9wׁ|$?vIELDmH|$ 1@6HE11HP H$(@dH3%(uH8@[]A\A]A^A_:fff.@Hu1Ht@DHf.H\$Hl$HxHHHcH 8HHHcHsHdHl$pH\$hHxffff.UHo`1SHHD$@H<@HH<;bHt$HbD$<D$vH[]ff.AVIAUATIUHSHƄ$1Ll$`DЈ$9}GH<@H$HH<8a$<uH$Lb$@HcLLH/Ƅ$1DDHHHtcHa$H$HD$D$$9\]H[]A\A]A^HcHffffff.AVAAUATIUHSHHƄ$1Ll$`@Ј$D9}FH<@H$HH<8`$<uH$L`$E1DIcLHH<@H$AHH<8`E9Ƅ$1DHHHtMbHE`$H$HD$D$$A9GtD3H[]A\A]A^f.HUHSHWdH%(H$1H$WtCH$H41TшLTLHH9uH|$ ]_UH|$ Hx_H|$ H;a1HH$H$dH3%(u H[]R6fATLf<UHSH@HEHL9u[]A\ffffff.1LFTFHH uATIUHHSHP$Et*HXЃ v)PXvPXɃv vHPH[]A\fLHL\$DfDEtJEIfD LAAAECDHuIAuAJtf.UHSHHH$4H$HdH$HtoH|$PHH|$PHE@H$HH[]ÐAVIAUIATMUHSHHH$dH%(H$1H$LE1H$@H$Ht H3IHaH$HMtHL,4L1H$H$jf.H$H$KH$H$H$@H$tH$H|$LHHH!%t¹hCLDHSHDHH1H)A94I|$HL3ItHH$-H$@H$H$dH3%(u-H[]A\A]A^H$LH~2fffff.IH1HI1H1fffff.t7DG1Eu, ‹4u9vf.1fff.AVIAUIATMUHSHHH$@H$LE1Ht H1IHH$@LHMtHL1L/H$\H$DA$AT$Ht$LI|$BHcI+>HH@+1. $t)Dd$EtFfD‹,u79s1yH$@HĐ[]A\A]A^f.L$L1ۅtȋ\$PtD\LEu 9s$1ۅtD$Et'DEu9vUDH$H$H1.@H$@LHpjff.IHH1IHHH1AWEAVEAUATUSH@HH4$D$@DŽ$P t"H$P E18cH|$ .h$P tHvH$P H|$ 1Gfu01H|$ jHĸ@[]A\A]A^A_D$4H$@HDŽ$@HDŽ$@HDŽ$@HDŽ$@Ƅ$@41DH$@q4AH|$ LH$@luH$@Ll5H$@D$ 1ۃD$vH$@8EuD$ |$RAHDŽ$P@HDŽ$X@HDŽ$`@HDŽ$h@Ƅ$p@EAL$P@A,AIL$P@AfN t1 IWALHE@ =HI9vEA]L} t uIA uIA uHH$P CmH$P H|$ #ffD tHtEHJu"HՃ uHEI)/uًHՃ/uBHDA"*L\(ID8"cH<$L"9L5H$@{ IH$@  |$AH$@1H$@HcL$P@HDŽ$P@HDŽ$X@HDŽ$`@HDŽ$h@Ƅ$p@H$@1蜐H$@LlD$H$X@H$P@H?HH?H$@ cHL9AGIH$@1L$P@L$P@H$@LُH$X@H$P@H$@HuH$HHx3,,~?H0,H1H0,H8L)HHH,H@<9,,AHD9$,JH$dH3%(uH[]A\A]A^B'ff.AUATUSHHD ,dH%(H$1D;$,Ll$Ic(,~;DBHL0,H,HLOD@H9LL9@>HuH8,D@,HH3@,~>11@H8,H,Hc HHH H0, 79@,AHD9$,EH$dH3%(uH[]A\A]&ffffff.f.AUATIUSHH~tbDoTEtGID$H1 ID$HAHK sLH{LK(IHKMD$@?A9wH[]A\A]DohfAWEAVAUATIUSHHT$DHL$ 9F…D$HD$ 1DEt$ƒ=FM%LE1HD$(D$1HHD$0@@&HHD$8a8HD$81EHuIL$`AT$TAt$PH|$8u<pH9l$0IDHTmHL)H|$HITxI|$pCHD$]_HD$HH9l$ v]H0L9sTHIKD$HD$DLHHD$(IDL9\L]@I|$pHH[]A\A]A^A_^HLHD$HD$^fDHD$ D$[H|$8H H%DHH?u@UHS1HDH|HtHPHHuH(_HH[]rHHrH%fffff.AUHIATUSHHH@H$0 H9 fDH$0 )eHv^H$0 jIHY[H$0 1HYtH$0 1ɺ1]sCH$0 H1vC11HeHXL`1HLd11HYa Ń uATH$<@MHE1Am9$<@tFH$0 H豆)e"H$0 1ҾJfiCH¾uC0vC1H]HH@[]A\A]HH޿)e*HH@[]A\A]HH\H#AWAVAUATUHSH Ht$(HH$H$L$[HT$@dH%(H$ 1n7H$>HH*CHhH$L$[L9D$3CHH$ TH$H$ HDŽ$HDŽ$H$HDŽ$H$ptH$ 1Ht^Ht$(H$ptH$pHYtH$ptH$HL6H$psH$ 袱D$ D$D$3Ht$(H$tH$H$J$%$*H$L$8ZL$8H$HNH$H$H5H+\$@CHHH)q5H$贰H$H$߰L$`HDŽ$pHDŽ$xHDŽ$D$$M|D$ D$4D$HD$HH$1L|$|$3H|$u3H$DŽ$pDŽ$tDŽ$xn;D$L]虂H$|VH$Ld1҅89UH$H$1cH$P,$pH$q9~1H@uH$HeHHU HHH$HLHH$ ˢHH$pHdHAUATIUSHH8HtI|$(HtI|$t811f.HH HI$H<HtHPI;D$rM$LHHtH"H\ H0L9uI|$p)LHL[]A\A]HLH@SHHHHHHGHGHGG HG8HG(GPGTGXHGHfDHXxHǀH0H9u@tHCpH[DFHCpU HC8HC@H[HHD$HD$Hfff.H\$Hl$1H@HHLJHLJHLJHLJƇ HtHǃ(H\$Hl$HHH<1HHEH(H\$Hl$HHH]HH\$Hl$1Ld$Ll$IL|$Lt$HdH%(HD$x1HHl$`IALHPtUHT$xdH3%(eH$H$L$L$L$L$HĸCH(uDu AVwUH|$LET$ %H|$LhI9tH|$\?@Hu Ht$L;D$ uH|$<<uH|$NH|$AD$P<H|$AD$TAD$PAD$X AD$X9s=v1cH|$,EAu4I,$Hi D 7 H|$H[H At$XLIl$Hi HAL$XI,$HDHH H9rE1:H|$EH|$Mi J5 I,$B5 I,$AE;l$PrE@AUIHֺATIU1SHH@H$0 "@H$0 )eHGH$0 iSGHCH$0 1HBtH$0 1ɺ1sCkH$0 H1)vC11҅HLATH$<@IHE1AA=VۃHH HHI$$<@9 u>iCH¾uC0vC1H$0 1Ҿd3H$0 Ho)etHEHH@[]A\A]HHEH fAUIATIUSH8dH%(H$(1HDŽ$p"*H$pLH @ͺHH9HH$p`H)HHHp`CH)H$`@ H$p`H$`@8HDŽ$ HDŽ$ HHDŽ$ H$`@1H莜t:HR181HuHH9H$pH8L$p$p H$`@脚H$0 AH$0 1LE?4pC1H$ H$0 HF1ۃH$0 BH$2H$LL?H$B*;I;0L濠)eH$0 ICH$(dH3%(H8[]A\A]H$`@wH$psH$pLL H$p닿CHH$pHzH$0 BHHH$`@HHH$H3뷐AWAVAUATUSHHXH$Ht$HֺL$KHHD$ &H$ /H;D$ HHH+D$ CHHHHH$ DŽ$` H$H$ KLl$PHDŽ$` HDŽ$h HDŽ$p D$HD$8H$ 1L莙 QpHt$HHZLH>u8HtHEHPL}LeL;d$ wLCL$tD$1HH߅AtD|$EWD$AtDH;C,McLLI HLH;H/Ƈ H}Hd#H0%u 8HEƅhS11HP L -L9IAE1A<$tA$I0AAM9sQEfAPL{EM9D$`EH$`L3G9D$M)$ 9kPwHt$8H|$00HD$Tu9l$LtHT$8Ht$0C蠜l$LMcLl$0QHHSHLPAH1E11{Xt&HH HHH<Ht79kXwH{`HtZH|$@t H|$@HHT$Tty|$K\HD$VJHvC.H11H$-]`1%HHH$ 莍HfH濐C1vH$H LH붐Hl$Ld$HLl$H\$HLt$HXIH$AdH%(H$(1PH$1HNuv1EtWH$NH$(dH3%(LH$0H$8L$@L$HL$PHXÐH)e1H$YtZ$H$.5H$01fH$0AHLOH$0p$H$11GLL$ H$LLqCL(ӃH1HAHLHTH0HHH$HMH0HH$0HԐSHH?Ht4{ u[HCHH HHiH;[`[ÐHx|$hHD$`t$@D$dHxÐH\$Hl$HLd$H(HwHGH9HwHWHt H9HHHl H9HB{ HHH HHHIH3Ht}HKHHH HHHCH;HH HHhH;`L#HkH\$Hl$Ld$ H(DHHH;H HHHIt_L#HkfD(fC1)eo)eHCHs)eHD$qHD$#)eV땐H9wr HwDH+wwLJHH1ɸ(LcFBAA=AMHuHHH9uÐfff.$USH1D$HA9E1@DEtxD)ȅ~oIHE1L@tOMcHcFDMcFE1AIDD$HEA)E9~DEDA)uE1HHD9l[]ÐAVAUATUSHH$H$NHHH HH9HuL Ll$DŽ$HAfD~&HLIL@HH9HuEH$HLHD$$b$~8FH 1 HH9uAHA9pH[]A\A]A^SH$Ƈ,zH[AWAVAUATUSH$HL$x*HL$AHAN fDHL9HuLc kILcEAǃLlELF3TEMcA1fDEt;HcɋBHcɋ 1΃tt%HcЍHHcɋt u11΃tuEtoEtjMcBBHID$M9X~+HT$1DK)HcɋL $H9HĠ[]A\A]A^A_1EA|fffff.AWAVAUATIUSHH($HL$$AAE1DD$D$ AEYA4$EL11Mc*t3HcHcHcɋ H19trBH{(Hts{uIsH<VHHC(DH[]fH1[]DCQsH< HHC(HfAWMAVMAUAATIUSHHEL9{8t#H{0HtJ<L{8HC0MtPHK0Hs1AHI9wHC(4H;1fA1HI9wH[]A\A]A^A_DkHC(MAl-HC4tHK0DL1Lk-AVAUATE1USHH@`$ t@HE1*t#?tEu( AHuE1fAUtL$ H$@@H(`ELHBDŽ@@gH$0 vH$@@H$0 %wN$ HDŽ$ HDŽ$ HDŽ$ fH$0 1Hnxtb$ tLHHHCHItCLuH HH fDX`t>LHnH$0 ,vH@`[]A\A]A^f.1H$0 HuH@AWAVAUATL$ UHSH X`L`ƅaLH L1Y$ IE11D$ D$ 0@|$ D$ \$ L$ ADA( AIt**t?uD$ uA$ t몋T$ |$ ƅaH|$CAMH|$B|(J( H|$H|$?CHIAHt$LIB|RtiDŽ$ H []A\A]A^A_fDH(`L<¸u5 H'뭾LBDCL{CL."@SB|~Jtfff.H\$Hl$HLd$HU1uH$Hl$Ld$Hf.H$ E1HuZD HIċtb.txI)H$@ǃ IHLaz, tD0 EA뇐CHA$.uAD$t.vA|$iHCHgEfATIUS x(HcIHtHrHLyI$`*[]I$(`A\I$`H I$(`HHfffff.L|$L(`H\$Hl$Ld$HLl$Lt$LH8HAEAH`H߹1HH D D D ƃ ƃaǃ ǃ$ ǃ ǃ ǃaHǃȁHǃaHǃaH\$Hl$Ld$Ll$ Lt$(L|$0H8HLHt@H\$Hl$HLd$H >HHȁL$ Ht.L$ 1AL,StE[f}tSHaHtLHaHt Han HLn THB)eGH$ H$ L$ H ÐfDH\$Hl$HLd$Ll$HLt$L|$HH@D$ EHc H|"?*/etcyyyymmddhhmmssYMDHISWAEN/etc/rar/usr/lib/usr/local/lib/usr/local/etc%04u%02u%u%03u%05u?*<>|"?*HOMExgChC(hCPhChCiCc@d@ _@ f@k@^@4FilediC Creating %-56s OK %s%.*ls(%u)%lsCMTjC0|@ }@P{@z@z@Pz@7ArchivedjCiCژ@ @@@x@@@`@g@@o@o@Ф@~@@@Q@@@"@;%u@`@@@@@*@@@@@h@r/dev/urandom__rar_%u-%02u-%02u %02u:%02u:%02u,%09u%u-%02u-%02u %02u:%02u????-??-?? ??:?? %s: , %cEnter password (will not be echoed) Enter password (will not be echoed) for %s: Reenter password: ERROR: Passwords do not match [%c]%ls User break Program aborted %s AAA A A"A/A@$A%A$A$A($A$A$A5hW9~<x?i7}],煼/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[                                   UOW\??\/??/ %s - use current password ?_Yes_No_All Testing %-56s Skipping %-56s ------ Printing %s Extracting %-56s %s is not RAR archive All OK Total errors: %ld ? %s%s Done Testing archive %s Extracting from %s ... %-56sFileCRC32BLAKE23.05.0Unix %ls%cB<-><---->%d%%NameSTMTypeTargetSizeRatiomtimectimeatimeFlagssolid%ls %ls:#%d: %ls RAR 4RAR 5%s%sSFXvolumelockEOFDOSOS/2Mac OSBeOSWinCEServiceDirectoryCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2Windows Attributes Size Packed Ratio Date Time Checksum Name ----------- --------- -------- ----- ---------- ----- -------- ---- Attributes Size Date Time Name ----------- --------- ---------- ----- ----%c%c%c%c%c%c%c%c%c %12s: %sNTFS alternate data stream %12ls: %lsUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referencePacked sizeAttributes %12ls: %8.8XHost OSCompression %12ls: RAR %ls(v%d) -m%d -md=%d%s %12ls: encryptedFile version %12ls: %uUnix owner %c%10ls %9ls %9ls %4ls %8.8X %02x%02x..%02x ???????? RAR 1.4Archive %s: %sDetailsvolume %drecovery recordencrypted headers%.10ls %u %21ls %9ls %3d%% %-27ls %u %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu*<-?->HA°AAAAzA$zC4zC{CwCHzCdzCxzC8pC8pC8pC....AA}AOA!AAAAkACAAHBBBBB0BBBBBB0BBBBBBBBBBBBBBBBBBBBBBBBB @   (08@P`p @   0@`  0@`   (08@P`p@` [:<S>] Set priority (0-default,1-min..15-max) and sleep time in ms Usage: unrar <command> -<switch 1> -<switch N> <archive> <files...> <@listfiles...> <path_to_extract\> <Commands> e Extract files without archived paths l[t[a],b] List archive contents [technical[all], bare] p Print file to stdout t Test archive files v[t[a],b] Verbosely list archive contents [technical[all],bare] x Extract files with full path <Switches> - Stop switches scanning @[+] Disable [enable] file lists ad Append archive name to destination path ag[format] Generate archive name using the current date ai Ignore file attributes ap<path> Set path inside archive c- Disable comments show cfg- Disable read configuration cl Convert names to lower case cu Convert names to upper case dh Open shared files ep Exclude paths from names ep3 Expand paths to full including the drive letter f Freshen files id[c,d,p,q] Disable messages ierr Send all messages to stderr inul Disable all messages kb Keep broken extracted files n<file> Additionally filter included files n@ Read additional filter masks from stdin n@<list> Read additional filter masks from list file o[+|-] Set the overwrite mode ol[a] Process symbolic links as the link [absolute paths] or Rename files automatically ow Save or restore file owner and group p[password] Set password p- Do not query password r Recurse subdirectories sc<chr>[obj] Specify the character set sl<size> Process files with size less than specified sm<size> Process files with size more than specified ta<date> Process files modified after <date> in YYYYMMDDHHMMSS format tb<date> Process files modified before <date> in YYYYMMDDHHMMSS format tn<time> Process files newer than <time> to<time> Process files older than <time> ts[m|c|a] Save or restore file time (modification, creation, access) u Update files v List all volumes ver[n] File version control vp Pause before each volume x<file> Exclude specified file x@ Read file names to exclude from stdin x@<list> Exclude files listed in specified list file y Assume Yes on all queriesB`BB%B`BBȤBB%BBpB%BPB%BBBB(BBBhB@B BBBBBpBbBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBTBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQBQB>B(BQBQBQBQBQBQBQBQBBBQBBڦBQBQBQBqBB0BԣBԣBԣBԣBԣBԣBԣBԣB0BԣBԣBԣBԣBԣBBzBBBBBBBBBBBB0BBBBByBBB0BДCpC`C8CȗCCPCCCC؜CCОCCCؠCpCC CأCCCChCPCHCCC0CCCPCCCCCCPCȗCCCpCXCPCPCCCCCCCCHCCCC C`C(CC CC CC`CCCCRAR_Yes_No_All_nEver_Rename_Quit_Yes_No_All_nEver_Quit Overwrite %s ? Would you like to replace the existing file %s %6s bytes, modified on %s with a new one %6s bytes, modified on %s Enter new name: %3d%% %-20s - checksum error Checksum error in the encrypted file %s. Corrupt file or wrong password. %-20s : packed data checksum error in volume %s The specified password is incorrect.Not enough memory Cannot open %s Cannot create %sCannot close the file %sSeek error in the file %sRead error in the file %sWrite error in the file %s Cannot delete %s Cannot rename %s to %s WARNING: Cannot change attributes of %s Cannot copy %s to %s. You need to unpack the entire archive to create file reference entries. Cannot create directory %s Cannot create symbolic link %s Cannot create hard link %s You may need to run RAR as administratorCorrupt archive - use 'Repair' command Corrupt header is found Main archive header is corrupt %s - the file header is corrupt ERROR: Corrupt data header found, ignored WARNING: Unknown data header format, ignored ERROR: Corrupt %s data block Recovery record is corrupt. Unknown method in %s Unknown encryption method in %s Renaming %s to %s You may need a newer version of RAR. ERROR: %s and %s belong to different sets Nothing to reconstruct Reconstructing... Reconstruction impossible Unexpected end of archive ERROR: Bad archive %s The archive comment is corrupt ERROR: Invalid file name %s Unsupported archive format. Please update RAR to a newer version. No files to extract Cannot find volume %s WARNING: You need to start extraction from a previous volume to unpack %s Unknown extra field in %s. Corrupt %s extra field in %s. %s switch is not supported for RAR %d.x archive format. %ls%ls%ls ERROR: Path too long Cannot read contents of %s ERROR: %s group and owner data are corrupt WARNING: Cannot get owner %s ID WARNING: Cannot get group %s ID WARNING: Cannot set %s owner and group WARNING: Cannot read symbolic link %s WARNING: Symbolic link %s already exists WARNING: Attempting to correct the invalid file name Creating %s Calculating checksums of all volumes. %d recovery volumes found %d volumes missing WARNING: FAT32 file system does not support 4 GB or larger files Testing the recovery record%s Insert disk with %s_Continue_Quit_Retry_Abort ERROR: Not enough disk space for %s. %sJanFebMarAprMayJunJulAugSepOctNovDecBBBB{B\BGB3BBBBBBBsBaBEB3BBBBBBBBmBQB@(>X8>pX>h?8@@(AhA A8APAhB8BxBB8CD D@(E`EXGGGIHhIhI(JHJxJJJJ0JHJ`XKKHLT0 (TP T V V!HW@!W!X!HX!X!(Y!Z"Z "(Z8"Z`"8["x]"H^#^8#H_p#_#`#(`#(bX$8bp$b$Hd$d$d%e %He@%fh%Xf%f%g%Hg%xg&g0&hX&Hi&i&j&j&k'(k 'Hk@'XkX'hkp'm'(m'hm'm(hn((nH(n(o`(p(8q)q8)r)s)s)s)t*t8*tP*uh*(u*8u*u*v*hv+v(+Hw+{H+X{p+{+|x,},}-X~(-~P-~h-H-h---.ȃ...؊ //؏/8/X-H.`.ؐx./(0X0(p00ȓ080h1@1ؔX1ؗ1X12H2x22(23x(1`3834h 484P4h4H4X44H855(5h5x6606H6`6x6(6H6(778H7xh777778@888X8H@9(9h9:P::x:H;;@;X;Hp;;;;(;X;< <X8<P<(x<<<<<=8=P===(=H=X>8>xX>>>(>X>x>??0?XH?Xp?h??@ @8@P@@@8@@A hA A A( A A A B (BH HBh hB B B BhBC8C`CXC8Cx8DDXDXDXDDE EX8E`EExEEEE0FPFhpFFFXFGx@GXGxGGGHGXGxH0HHHhHHFH(GxHHHHX Ix!xI!I"Ix"I(0J)xJ.J3K87PK8K9Kh=K=L= L=8L>PL8>hLx>LTLHTL(UMV`MHWMYMHYMY@NZpN^N_O8`O8aHOapOaObOcPdPPehPePePfP(gPgQ(k0QHkHQkxQxlQhmQHnRo@RppRXrRrRhtRtSv8SvPSxxS8zS8|Sx|SH} T}HT~hTHTTT(UPUhUUVxPVhTVV(WWWȽWWX XXXXXXXYYHPYxhYYHYh@[x[x[[[[H\0\p\X\]]]x]8^HP^x^(^^X^_H_p_8_`(`H`x`a0aaaaab`bxxbbbXbbcHc cc`dddH d&@e)pe3hf5f9f:hg?gxA hCh(U(iYiHZijjyjjHHkpXZ@ZZZ8([X`[_Xeef8@f gȚHghHihxi`kHkxk(klplHlXllءlm(mȣ@mأXmXmmHmX@nhhnnn(ohHohooxoxoxo@pXpppHpppq(qXPqxq8qHq(qH(rxHr`rxrrhrxs s@sX`sssXss tX@txXtpttt8u@uXuXpuxuXu(v8vXvXvhvv8 wX8wxPwhwwwwHwwwxHx(pxxxxxyhPypyHyyy@zhzzzXz({p{({8{|X0|H||h||}0}(H}x`}}}}h8~x~(~8~hx0pxx h0x !h$X0x22h2h4؁485P5x6780>x>?ȄH??h@(HCDЅE(GxHJȆxKL(MMȇTUXWXWPWxX8XhY([x[8\`^^_(a(haHahb8b8cc8d(dheexfggPXhxhh(izRx :4*ACe$T,MI0Q H |LMD 8AC$BACO M Q O AzPLRx)@ 4$@JlDBCFCF  AOA $T|MN0Do B |D SJN0Cx<8BBCA CA(CD0y (A ABBF  4 BCACA CD0  AABC D#\ "tx!*ACe%AKX(HAJ|$H!<MI0Q K 0gWD K$$DMIPFy K 4L DACACGPa AAA |!!!GN Fe G L"mBBA CA(CD0| (A ABEK D(C ABBL "qBHBB A(CA0C} (A BBBF D(A BDElP"DACk A S"AAC|"DM"DM"DX" " $"<"T" l#4x$BBA BA(B  ABBF %*%4@%Dx%p%4h%9N FdT%l%;N Ff%QHR Cs%QHR Cs0&DP A &Dh A  'JAFB$,'AJ_ F SDTh(XBGC A(BK  ABJI M  IBJF )JACr J I)ACU4)CBCECA CG@  DABJ *NMI Fm4*'DV F F$T+MI IH I R|p+x+&ACa+ D[+++DM +DP$, +_N Cs L N$T +zML@QO$| ,mMN0IHT h,BCBCB B(A0A8CG 8A0A(B BBBK  3 AC[, 3BCAA  DBD dL @4BCBB A(BA0C (A BBBK d (A BBBE f (A BBBC  5#D^< 5yBBB CA(A0Cc(A BBB< 6qBBB CA(A0B\(A BBBL @6=d h6=| 6a 6a$ @7MLCl H  7 7$ 7MI N\ H , 8GLD vDT 8@ DBBCA CA(CG (A ABBA L :BCBCB CA(CA0EGEc 0A(A BBBE  (;pN Fy C 4 x;ACD R AE [ AD r AE L< ;BCBDB CB(CA0CA8CD@} 8A0A(B BBBH  MMNPPk E CC#D ^CD XDAFU D $C$<CMQ[ B dxE $|pE2ACGeA$Ex0DMI CE A $ErAHD G AK 8F*ACY K AHFDZ$,`G:ACO M M K A$TxG,MI0Q H TF DDBBB CB(A0CA8Dx 8D0A(B BBBA ,(H|ABABLb AAA LxH5BCBB CB(CA0A8G@I 8D0A(B BBBH ThIl`I$XIALQH| AA IVGI A 4J\DACG{ AI O AA JJ&4JLJdJYGL A JlG_ A $(KZAGGD AA $`KvACL _ AA KTGG A $O:ACO M M K A<O)DdT\KrDBBB B(CA0BA8CG 8A0A(B BBBA OYBCBCB CB(A0CA8CDP 8A0A(B BBBJ Q 8D0A(B BBBJ T 8A0A(B BBBJ Q8G0A(E BBBTDhPBCBB CA(A0G@ 0F(A BBBA G0C(A BBB,P>ACK W AI LA$P`HU C^ B [$(Q`MI0R` H `Q 4XQ{LQdQ+|b)Dd,QDAACD l DAE RACI,RDHLX@C A 8b.Di,PbDXb8MD f$l(UDMIPp F , V+DMMQ_Q E ,[DNPPN D  A l[DBBB B(CA0A8CD@ 8A0A(B BBBB u 8C0A(B BBBG \_GACN F n$| `VAGS U A G OX`ACK,aACDT AC rA,aYACD [ AD D DH $a4<aHCr C b F T D T D ttHb$ciN Ft H XHc)AG\Xc;AC] O JH.Di `c(KX<,xcЋDBDA CG  AABK ,l8fxDMMLc% B Li'BBB CB(CA0A8CGA 8A0A(B BBBK ,hq DM^AZ F ,z.DM^B[ E DhN B] C TdBCBGB CA(A0CY (D BBBE @ (D BBBF $0MI Id M zD؎{BCABA CD0Q  AABK D CABT,@BBCB CB(CA0A8DXC 8A0A(B BBBD LxBCECB B(A0A8Du 8A0A(B BBBE D@Bx&4L LdcBCBB A(BA0Co (A EEFH A(A BBDLؕsBHBB A(CA0C} (A BBBF A(A EEFLBBB B(A0A8CDPs8D0A(B BBB,TX3ACAD F^DA,h3ACAD F^DAxph^ , D \ Tt BFBB CB(CA0CA8CG 8A0A(B BBBG  a, xACACK AA!@AC{4! L!5d!8|!Мt<!8BHA A(DPCa (A ABBA 4!xCBGMCR D(C ABL< "BBA CA(CN (A ABBA L"p Td"hABCBCB CB(CA0CA8CG 8A0A(B BBBA L"`BBB B(A0CA8CG 8A0A(B BBBA L #BHB B(A0CA8Gy  8A0A(B BBBF 4\#7BACA CDpx  AABF D"4YDBBCA CD(ED0 (A ABBB <"rDBHAGA D0a  AABA ,$0 MN0Mh H b F H,L$MMQd_ B L|$BBA CF(CI@t (A ABBD m(A ABB$@J$$x DH D ` %`4$%\<%еDT%@l%0!%H%P+%hB%7MDe%b&F$&PMMD0P B $D&mHI Gf J dl&JDq K & ,Dg&8c&SMI Is$&иMN@Nv A '4' BGA A(F   AFJB T'xl'p'h4'pHRNPM~ E P E ,'H[LbI I (x]0M,$(rACACD`cAAT(hl(p(h&((((ID@y(`F@Y$)MIJb F 4<) BACA CDp  AABA t)5ACD kA<)BCBB A(BA0Cv (A BBBC ))*xD,$)DMSN0C1 A L*0,l)DAACD Q HAE $*hMI GD O $*M[@GL*xMBIB B(CA0A8CD`f 8D0A(B BBBA 4+xL+pd+x,|+poACD0x AG eA++++ZQ CE,AGT4,]DXL,@ $d,8AG]A$,AG]A,,xAAG!dAA,hqMD F I $-ACGR AB 4,-@BCABA CGP  AABI Ld-BBB B(A0A8CLo 8A0A(B BBBF L-H3BBB CB(A0CA8G I 8A0A(B BBBI .8AJw$$.BACO M Q O A$T-OΌDAHF \ AE $|-ތDLHD0g A .BDs A .".".P$/;ACDqA,/0RDf F ]L/pyN IX A l/2MD \/ACN/DK/ ABH/)Dd/ACS0LG R G k<0*AG]$\0[U GZ J $08TP GS F c0p*AG]$0ACG!A0.Di 10!DX$1HACSD1H$AC[d1XACN1X$AC[1h 1`ACN1`$AC[1p 2h$AC[42x L2pACNl222AGC E N$2ABF k AK \28AACD0g CAD Y AKC h CAD a ACK WCAD38\3 Vt3hU[Ted3wBBB B(A0A8CD 8A0A(B BBBA p 8C0A(B BBBA D3ACACD p AAB q AAE aAALD4BBB B(A0A8DY 8A0A(B BBBA L4SBBB B(A0A8G\^ 8A0A(B BBBA 444BDDBF h ABG 45BFFA A(F ABB,T5ABACD@e AAA $5XEASp AA 5HCK5>DCO J V566/46?MD mDT6BDB B(A0A8K2 0A(B BBBF 6@+$6XMNpIO E L6BBB CB(CA0CA8BD| 8A0A(B BBBA $,7*MVpH G LT7 BDB B(A0A8GY8A0A(B BBB7( @L7P BBCB B(A0A8CD@p8A0A(B BBB, 8 BACA GABL<8p BDB B(A0A8DhQ8A0A(B BBB<8BECB CA(A0C(A BBB8Y,8ACACD  AAI $9pARACWA,<90MBCAA D~ABl9PT9HBBB FB(CA0CA8CGV 8A0A(B BBBA <9BCBGA CA(BG(A ABB:pM4:vL:d:BACo M A$:HACD I AF $:@MI Ha A z F $:0AJ\h AH :,;[ACACDPG AAA ,D;(BCAA Cz AEF Dt;AACGЀ] AAE  FAD GCA$;pML@mg C $;(M[@Cw F , <ACACJ F AAF $<<@MLa E d<4,|<MML c J ,<!_ACD d AC fD$<!MY^ J =x#4$=#H[C D ,D=X%_LRQd G ,t=&MMQPLn K =X(5,<(DIML0Jw A $< )XDN Gj E >X)mACd,4>).MMNPS F $d>,NMLPt C >-\AIB D >M3Dn,>-M^@G_ G $>/ML@J H <$>`2DBCAA CIP  AABA Dd>2@.DBFBCD CA(CJAM (C ABBI ,>3AVDM^^ F D>E}DBBCI A(G_( (A ABBK ,@ JAACN@7 AAA LL@ LBBB B(A0CA8CG 8A0A(B BBBA T@PBDBB B(CA0CA8CGV 8A0A(B BBBI T?^܍DBBB B(CA0A8Gj 8A0A(B BBBA LAfdAf|AfAHM4AfmBCFCA CG  AABF AHj3DnLA0gBBCB CA(A0CG 0A(A BBBF n`g,nBDC FABdn8BBB B(A0A8CD` 8D0A(B BBBE D8A0A(B BBB<\oAGACD D AAJ D CAA ToBCBCB CB(CA0BA8CD@ 8A0A(B BBBD Ln DBBB CA(A0CG 0C(A BBBK LDp8BBB B(GA0CA8G@N 8A0A(B BBBG $px.MI _ K 4o#DBCAA Fz AJE ,o 7DLRQ@I A $$qx<MI0Q K Lq7MD e$lqpML@L,p(IDM^ЀP G Tq>BBCB A(CA0K (A BBBF X (A BBBI $r@AAD DsAA$DrMI IF K lrp,qx!^DMN0C E $rxM]@Yq D $qP{DACD g AE $ r8DIHD0] A 44rDMN`Mt D  G ~ B $dsxLI MC K $r0DMIpE A $sfZ@J_ E sps>DM G at|Gt4txDXLt!D\dtDC} D <sxؒDAFD H DAH A ADA ,t<BAA EoAB<tBBCA GA(CG0(A ABB<4uBGBGA GA(CD@j(A ABBtuDK$uMI YR G $uMI CW H <uBBB CQ(A0(A BEB$vqDCo J A G Dv(D_$\vQ_@FRvhqY2=P}}}@dfCJ[{BSsg!4b7, _FsL' ,=u#J=zM&(<HT`lz$/>MgFb+ce 9 c  7  G s U   <   [F'" T   'H5Er+'Fs+%%)%%%S}Bj'19HR]kv!hEQc 1,Jl,Yg D?S>]#$" 5)c"c $  #t$N#:#aa##$$$#7G#, "~?%TBRA  /k=2Z%%@',4CRapxRcwgbPS  :         KF]"MU"#Moi 4  (     ?             [L  "Sb%=E"tNT_uh7_5[i  0GYqRVP'WA|Rw;G\ %>O "50K _s! &J-@eu^@@dCoy (#@ fCo@0@@  d@ @@ o0@oo*@dV#@f#@v#@#@#@#@#@#@#@#@#@$@$@&$@6$@F$@V$@f$@v$@$@$@$@$@$@$@$@$@%@%@&%@6%@F%@V%@f%@v%@%@%@%@%@%@%@%@%@&@&@&&@6&@F&@V&@f&@v&@&@&@&@&@&@&@&@&@'@'@&'@6'@F'@V'@f'@v'@'@'@'@'@'@'@'@'@(@(@&(@6(@F(@V(@f(@v(@(@(@(@(@(@(@(@(@)@)@&)@6)@F)@V)@f)@v)@)@)@)@)@)@)@)@)@*@*@&*@6*@F*@V*@f*@v*@*@*@*@*@*@#Iw0*XZWǓF\B (>VGeq{][C,kK1}Sr $|Y֍/y=®an6s9^i7? QLc3x)Hˇ @H F0@0No*@*[o0@0j@t@@  ~(#@(#y@#@@#*@*8;fCf fC fx C4DvlDl НdН(dddddd@ dE 0TTrar/rar.txt0000644000175000017500000030230413143334065010477 0ustar zz User's Manual ~~~~~~~~~~~~~ RAR 5.50 console version ~~~~~~~~~~~~~~~~~~~~~~~~ =-=-=-=-=-=-=-=-=-=-=-=-=-=- Welcome to the RAR Archiver! -=-=-=-=-=-=-=-=-=-=-=-=-=-= Introduction ~~~~~~~~~~~~ RAR is a console application allowing to manage archive files in command line mode. RAR provides compression, encryption, data recovery and many other functions described in this manual. RAR supports only RAR format archives, which have .rar file name extension by default. ZIP and other formats are not supported. Even if you specify .zip extension when creating an archive, it will still be in RAR format. Windows users may install WinRAR, which supports more archive types including RAR and ZIP formats. WinRAR provides both graphical user interface and command line mode. While console RAR and GUI WinRAR have the similar command line syntax, some differences exist. So it is recommended to use this rar.txt manual for console RAR (rar.exe in case of Windows version) and winrar.chm WinRAR help file for GUI WinRAR (winrar.exe). Configuration file ~~~~~~~~~~~~~~~~~~ RAR and UnRAR for Unix read configuration information from .rarrc file in a user's home directory (stored in HOME environment variable) or in /etc directory. RAR and UnRAR for Windows read configuration information from rar.ini file, placed in the same directory as the rar.exe file. This file may contain the following string: switches= For example: switches=-m5 -s It is also possible to specify separate switch sets for individual RAR commands using the following syntax: switches_= For example: switches_a=-m5 -s switches_x=-o+ Environment variable ~~~~~~~~~~~~~~~~~~~~ Default parameters may be added to the RAR command line by establishing an environment variable "RAR". For instance, in Unix following lines may be added to your profile: RAR='-s -md1024' export RAR RAR will use this string as default parameters in the command line and will create "solid" archives with 1024 KB sliding dictionary size. RAR handles options with priority as following: command line switches highest priority switches in the RAR variable lower priority switches saved in configuration file lowest priority Log file ~~~~~~~~ If the switch -ilog is specified in the command line or configuration file, RAR will write informational messages, concerning errors encountered while processing archives, into a log file. Read switch -ilog description for more details. The file order list for solid archiving - rarfiles.lst ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ rarfiles.lst contains a user-defined file list, which tells RAR the order in which to add files to a solid archive. It may contain file names, wildcards and special entry - $default. The default entry defines the place in order list for files not matched with other entries in this file. The comment character is ';'. In Windows this file should be placed in the same directory as RAR or in %APPDATA%\WinRAR directory, in Unix - to the user's home directory or in /etc. Tips to provide improved compression and speed of operation: - similar files should be grouped together in the archive; - frequently accessed files should be placed at the beginning. Normally masks placed nearer to the top of list have a higher priority, but there is an exception from this rule. If rarfiles.lst contains such two masks that all files matched by one mask are also matched by another, that mask which matches a smaller subset of file names will have higher priority regardless of its position in the list. For example, if you have *.cpp and f*.cpp masks, f*.cpp has a higher priority, so the position of 'filename.cpp' will be chosen according to 'f*.cpp', not '*.cpp'. RAR command line syntax ~~~~~~~~~~~~~~~~~~~~~~~ Syntax RAR [ - ] [ <@listfiles...> ] [ ] [ ] Description Command line options (commands and switches) provide control of creating and managing archives with RAR. The command is a string (or a single letter) which commands RAR to perform a corresponding action. Switches are designed to modify the way RAR performs the action. Other parameters are archive name and files to be archived into or extracted from the archive. Listfiles are plain text files that contain names of files to process. File names should start at the first column. It is possible to put comments to the listfile after // characters. For example, you may create backup.lst containing the following strings: c:\work\doc\*.txt //backup text documents c:\work\image\*.bmp //backup pictures c:\work\misc and then run: rar a backup @backup.lst If you wish to read file names from stdin (standard input), specify the empty listfile name (just @). By default, console RAR uses the single byte encoding in list files, but it can be redefined with -scl switch. You may specify both usual file names and list files in the same command line. If neither files nor listfiles are specified, then *.* is implied and RAR will process all files. Many RAR commands, such as extraction, test or list, allow to use wildcards in archive name. If no extension is specified in archive mask, RAR assumes .rar, so * means all archives with .rar extension. If you need to process all archives without extension, use *. mask. *.* mask selects all files. Wildcards in archive name are not allowed when archiving and deleting. In Unix you need to enclose RAR command line parameters containing wildcards in single or double quotes to prevent their expansion by Unix shell. For example, this command will extract *.asm files from all *.rar archives in current directory: rar e '*.rar' '*.asm' Command could be any of the following: a Add files to archive. Examples: 1) add all *.hlp files from the current directory to the archive help.rar: rar a help *.hlp 2) archive all files from the current directory and subdirectories to 362000 bytes size solid, self-extracting volumes and add the recovery record to each volume: rar a -r -v362 -s -sfx -rr save Because no file names are specified, all files (*) are assumed. 3) as a special exception, if directory name is specified as an argument and if directory name does not include file masks and trailing backslashes, the entire contents of the directory and all subdirectories will be added to the archive even if switch -r is not specified. The following command will add all files from the directory Bitmaps and its subdirectories to the RAR archive Pictures.rar: rar a Pictures.rar Bitmaps 4) if directory name includes file masks or trailing backslashes, normal rules apply and you need to specify switch -r to process its subdirectories. The following command will add all files from directory Bitmaps, but not from its subdirectories, because switch -r is not specified: rar a Pictures.rar Bitmaps\* c Add archive comment. Comments are displayed while the archive is being processed. Comment length is limited to 256 KB. Examples: rar c distrib.rar Also comments may be added from a file using -z[file] switch. The following command adds a comment from info.txt file: rar c -zinfo.txt dummy ch Change archive parameters. This command can be used with most of archive modification switches to modify archive parameters. It is especially convenient for switches like -cl, -cu, -tl, which do not have a dedicated command. It is not able to recompress, encrypt or decrypt archive data and it cannot merge or create volumes. If used without any switches, 'ch' command just copies the archive data without modification. Example: Set archive time to latest file: rar ch -tl files.rar cw Write archive comment to specified file. Format of output file depends on -sc switch. If output file name is not specified, comment data will be sent to stdout. Examples: 1) rar cw arc comment.txt 2) rar cw -scuc arc unicode.txt 3) rar cw arc d Delete files from archive. Please note if the processing of this command results in removing all the files from the archive, the empty archive would removed. e Extract files without archived paths. Extract files excluding their path component, so all files are created in the same destination directory. Use 'x' command if you wish to extract full pathnames. Example: rar e -or html.rar *.css css\ extract all *.css files from html.rar archive to 'css' folder excluding archived paths. Rename extracted files automatically in case several files have the same name. f Freshen files in archive. Updates archived files older than files to add. This command will not add new files to the archive. i[i|c|h|t]= Find string in archives. Supports following optional parameters: i - case insensitive search (default); c - case sensitive search; h - hexadecimal search; t - use ANSI, Unicode and OEM character tables (Windows only); If no parameters are specified, it is possible to use the simplified command syntax i instead of i= It is allowed to specify 't' modifier with other parameters, for example, ict=string performs case sensitive search using all mentioned above character tables. Examples: 1) rar "ic=first level" -r c:\*.rar *.txt Perform case sensitive search of "first level" string in *.txt files in *.rar archives on the disk c: 2) rar ih=f0e0aeaeab2d83e3a9 -r e:\texts\*.rar Search for hex string f0 e0 ae ae ab 2d 83 e3 a9 in rar archives in e:\texts directory. k Lock archive. Any command which intends to change the archive will be ignored. Example: rar k final.rar l[t[a],b] List archive contents [technical [all], bare]. 'l' command lists archived file attributes, size, date, time and name, one file per line. If file is encrypted, line starts from '*' character. 'lt' displays the detailed file information in multiline mode. This information includes file checksum value, host OS, compression options and other parameters. 'lta' provide the detailed information not only for files, but also for service headers like NTFS streams or file security data. 'lb' lists bare file names with path, one per line, without any additional information. You can use -v switch to list contents of all volumes in volume set: rar l -v vol.part1.rar Commands 'lt', 'lta' and 'lb' are equal to 'vt', 'vta' and 'vb' correspondingly. m[f] Move to archive [files only]. Moving files and directories results in the files and directories being erased upon successful completion of the packing operation. Directories will not be removed if 'f' modifier is used and/or '-ed' switch is applied. p Print file to stdout. You may use this command together with -inul switch to disable all RAR messages and print only file data. It may be important when you need to send a file to stdout for use in pipes. r Repair archive. Archive repairing is performed in two stages. First, the damaged archive is searched for a recovery record (see 'rr' command). If archive contains the previously added recovery record and if damaged data area is continuous and smaller than error correction code size in recovery record, chance of successful archive reconstruction is high. When this stage has been completed, a new archive is created, named as fixed.arcname.rar, where 'arcname' is the original (damaged) archive name. If broken archive does not contain a recovery record or if archive is not completely recovered due to major damage, second stage is performed. During this stage only the archive structure is reconstructed and it is impossible to recover files which fail checksum validation, it is still possible, however, to recover undamaged files, which were inaccessible due to the broken archive structure. Mostly this is useful for non-solid archives. This stage is never efficient for archives with encrypted file headers, which can be repaired only if recovery record is present. When the second stage is completed, the reconstructed archive is saved as rebuilt.arcname.rar, where 'arcname' is the original archive name. By default, repaired archives are created in the current directory, but you can append an optional destpath\ parameter to specify another destination directory. Example: rar r buggy.rar c:\fixed\ repair buggy.rar and place the result to 'c:\fixed' directory. rc Reconstruct missing and damaged volumes using recovery volumes (.rev files). You need to specify any existing volume as the archive name, for example, 'rar rc backup.part03.rar' Read 'rv' command description for information about recovery volumes. rn Rename archived files. The command syntax is: rar rn ... For example, the following command: rar rn data.rar readme.txt readme.bak info.txt info.bak will rename readme.txt to readme.bak and info.txt to info.bak in the archive data.rar. It is allowed to use wildcards in the source and destination names for simple name transformations like changing file extensions. For example: rar rn data.rar *.txt *.bak will rename all *.txt files to *.bak. RAR does not check if the destination file name is already present in the archive, so you need to be careful to avoid duplicated names. It is especially important when using wildcards. Such a command is potentially dangerous, because a wrong wildcard may corrupt all archived names. rr[N] Add data recovery record. Optionally, redundant information (recovery record) may be added to archive. While it increases the archive size, it helps to recover archived files in case of disk failure or data loss of other kind, provided that damage is not too severe. Such damage recovery can be done with command "r" (repair). RAR 4.x and RAR 5.0 archives use different recovery record structure and algorithms. RAR 4.x recovery record is based on XOR algorithm. You can specify 4.x record size as a number of recovery sectors or as a percent of archive size. To specify a number of sectors just add it directly after 'rr', like 'rr1000' for 1000 sectors. To use a percent append 'p' or '%' modifier after the percent number, such as 'rr5p' or 'rr5%' for 5%. Note that in Windows .bat and .cmd files it is necessary to use 'rr5%%' instead of 'rr5%', because the command processor treats the single '%' as the start of a batch file parameter, so it might be more convenient to use 'p' instead of '%' in this case. RAR 4.x recovery sectors are 512 bytes long. If damaged area is continuous, every sector helps to recover 512 bytes of damaged information. This value may be lower in cases of multiple damage. Maximum number of recovery sectors is 524288. Size of 4.x recovery record may be approximately determined as /256 + *512 bytes. RAR 5.0 recovery record uses Reed-Solomon error correction codes. Its ability to repair continuous damage is about the same as for RAR 4.x, allowing to restore slightly less data than recovery record size. But it is significantly more efficient than RAR 4.x record in case of multiple damaged areas. RAR 5.0 record does not use 512 byte sectors and you can specify its size only as a percent of archive size. Even if '%' or 'p' modifier is not present, RAR treats the value as a percent in case of RAR 5.0 format, so both 'rr5' and 'rr5p' mean 5%. Due to service data overhead the actual resulting recovery record size only approximately matches the user defined percent and difference is larger for smaller archives. RAR 5.0 recovery record size cannot exceed the protecting archive size, so you cannot use more than 100% as a parameter. Larger recovery records are processed slower both when creating and repairing. RAR 5.0 recovery record is more resistant to damage of recovery record itself and can utilize a partially corrupt recovery record data. Note, though, that 'R' repair command does not fix broken blocks in recovery record. Only file data are corrected. After successful archive repair, you may need to create a new recovery record for saved files. Both 4.x and 5.0 records are most efficient if data positions in damaged archive are not shifted. If you copy an archive from damaged media using some special software and if you have a choice to fill damaged areas with zeroes or to cut out them from copied file, filling with zeroes or any other value is preferable, because it allows to preserve original data positions. Still, even though it is not an optimal mode, both versions of records attempt to repair data even in case of deletions or insertions of reasonable size, when data positions were shifted. RAR 5.0 recovery record handles deletions and insertions more efficiently than RAR 4.x. If you use the plain 'rr' command without optional parameter, RAR will set the recovery record size to 3% of archive size by default. Example: rar rr5p arcname add the recovery record of 5% of archive size. rv[N] Create recovery volumes (.rev files), which can be later used to reconstruct missing and damaged files in a volume set. This command makes sense only for multivolume archives and you need to specify the name of the first volume in the set as the archive name. For example: rar rv3 data.part01.rar This feature may be useful for backups or, for example, when you posted a multivolume archive to a newsgroup and a part of subscribers did not receive some of the files. Reposting recovery volumes instead of usual volumes may reduce the total number of files to repost. Each recovery volume is able to reconstruct one missing or damaged RAR volume. For example, if you have 30 volumes and 3 recovery volumes, you are able to reconstruct any 3 missing volumes. If the number of .rev files is less than the number of missing volumes, reconstructing is impossible. The total number of usual and recovery volumes must not exceed 255 for RAR 4.x and 65535 for RAR 5.0 archive format. Original RAR volumes must not be modified after creating recovery volumes. Recovery algorithm uses data stored both in REV files and in RAR volumes to rebuild missing RAR volumes. So if you modify RAR volumes, for example, lock them, after creating REV files, recovery process will fail. Additionally to recovery data, RAR 5.0 recovery volumes also store service information such as checksums of protected RAR files. So they are slightly larger than RAR volumes which they protect. If you plan to copy individual RAR and REV files to some removable media, you need to take it into account and specify RAR volume size by a few kilobytes smaller than media size. The optional parameter specifies a number of recovery volumes to create and must be less than the total number of RAR volumes in the set. You may also append a percent or 'p' character to this parameter, in such case the number of creating .rev files will be equal to this percent taken from the total number of RAR volumes. For example: rar rv15% data.part01.rar RAR reconstructs missing and damaged volumes either when using 'rc' command or automatically, if it cannot locate the next volume and finds the required number of .rev files when unpacking. Original copies of damaged volumes are renamed to *.bad before reconstruction. For example, volname.part03.rar will be renamed to volname.part03.rar.bad. s[name] Convert archive to SFX. The archive is merged with a SFX module (using a module in file default.sfx or specified in the switch). In the Windows version default.sfx should be placed in the same directory as the rar.exe, in Unix - in the user's home directory, in /usr/lib or /usr/local/lib. s- Remove SFX module from the already existing SFX archive. RAR creates a new archive without SFX module, the original SFX archive is not deleted. t Test archive files. This command performs a dummy file extraction, writing nothing to the output stream, in order to validate the specified file(s). Examples: Test archives in current directory: rar t * or for Unix: rar t '*' User may test archives in all sub-directories, starting with the current path: rar t -r * or for Unix: rar t -r '*' u Update files in archive. Adds files not yet in the archive and updates archived files that are older than files to add. v[t[a],b] Verbosely list archive contents [technical [all], bare]. 'v' command lists archived file attributes, size, packed size, compression ratio, date, time, checksum and name, one file per line. If file is encrypted, line starts from '*' character. For BLAKE2sp checksum only two first and one last symbol are displayed. 'vt' displays the detailed file information in multiline mode. This information includes file checksum value, host OS, compression options and other parameters. 'vta' provide the detailed information not only for files, but also for service headers like NTFS streams or file security data. 'vb' lists bare file names with path, one per line, without any additional information. You can use -v switch to list contents of all volumes in volume set: rar v -v vol.part1.rar Commands 'vt', 'vta' and 'vb' are equal to 'lt', 'lta' and 'lb' correspondingly. x Extract files with full path. Examples: 1) extract 10cents.txt to current directory not displaying the archive comment rar x -c- dime 10cents.txt 2) extract *.txt from docs.rar to c:\docs directory rar x docs.rar *.txt c:\docs\ 3) extract the entire contents of docs.rar to current directory rar x docs.rar Switches (used in conjunction with a command): -? Display help on commands and switches. The same as when none or an illegal command line option is entered. -- Stop switches scanning This switch tells to RAR that there are no more switches in the command line. It could be useful, if either archive or file name starts from '-' character. Without '--' switch such a name would be treated as a switch. Example: add all files from the current directory to the solid archive '-StrangeName' RAR a -s -- -StrangeName -@[+] Disable [enable] file lists RAR treats command line parameters starting from '@' character as file lists. So by default, RAR attempts to read 'filename' filelist, when encountering '@filename' parameter. But if '@filename' file exists, RAR treats the parameter as '@filename' file instead of reading the file list. Switch -@[+] allows to avoid this ambiguity and strictly define how to handle parameters starting from '@' character. If you specify -@, all such parameters found after this switch will be considered as file names, not file lists. If you specify -@+, all such parameters found after this switch will be considered as file lists, not file names. This switch does not affect processing parameters located before it. Example: test the archived file '@home' rar t -@ notes.rar @home -ac Clear Archive attribute after compression or extraction (Windows version only). If -ac is specified when archiving, "Archive" file attribute is cleared for successfully compressed files. When extracting, -ac will clear "Archive" attribute for extracted files. This switch does not affect directory attributes. -ad Append archive name to destination path. This option may be useful when unpacking a group of archives. By default RAR places files from all archives in the same directory, but this switch creates a separate directory for files unpacked from each archive. Example: rar x -ad *.rar data\ RAR will create subdirectories below 'data' for every unpacking archive. -ag[format] Generate archive name using the current date and time. Appends the current date string to an archive name when creating or processing an archive. Useful for daily backups. Format of the appending string is defined by the optional "format" parameter or by "YYYYMMDDHHMMSS" if this parameter is absent. The format string may include the following characters: Y - year M - month MMM - month name as text string (Jan, Feb, etc.) W - a week number (a week starts with Monday) A - day of week number (Monday is 1, Sunday - 7) D - day of month E - day of year H - hours M - minutes (treated as minutes if encountered after hours) I - minutes (treated as minutes regardless of hours position) S - seconds N - archive number. RAR searches for already existing archive with generated name and if found, increments the archive number until generating a unique name. 'N' format character is not supported when creating volumes. When performing non-archiving operations like extracting, RAR selects the existing archive preceding the first unused name or sets N to 1 if no such archive exists. Each of format string characters listed above represents only one character added to archive name. For example, use WW for two digit week number or YYYY to define four digit year. If the first character in the format string is '+', positions of the date string and base archive name are exchanged, so a date will precede an archive name. The format string may contain optional text enclosed in '{' and '}' characters. This text is inserted into archive name. All other characters are added to an archive name without changes. If you need to process an already existing archive, be careful with -ag switch. Depending on the format string and time passed since previous -ag use, generated and existing archive names may mismatch. In this case RAR will create or open a new archive instead of processing the already existing one. You may use -log switch to write the generated archive name to a file and then read it from file for further processing. Examples: 1) use the default YYYYMMDDHHMMSS format rar a -ag backup 2) use DD-MMM-YY format rar t -agDD-MMM-YY backup 3) use YYYYMMDDHHMM format, place date before 'backup' rar a -ag+YYYYMMDDHHMM backup 4) use YYYY-WW-A format, include fields description rar a -agYYYY{year}-WW{week}-A{wday} backup 5) use YYYYMMDD and the archive number. It allows to generate unique names even when YYYYMMDD format mask used more than once in the same day rar a -agYYYYMMDD-NN backup -ai Ignore file attributes. If this switch is used when extracting, RAR does not set general file attributes stored in archive to extracted files. This switch preserves attributes assigned by operating system to a newly created file. If this switch is used when archiving, predefined values, typical for file and directory, are stored instead of actual attributes. In Windows it affects archive, system, hidden and read-only attributes. in Unix - user, group, and others file permissions. -ao Add files with "Archive" attribute set (Windows version only). If -ao is used when archiving, only files with "Archive" file attribute will be added to archive. This switch does not affect directories, so all matching directories are added regardless of their attributes. You can also specify -ed switch if you prefer to omit all directory records. Example: add all disk C: files with "Archive" attribute set to the 'f:backup' and clear files "Archive" attribute rar a -r -ac -ao f:backup c:\*.* -ap Set path inside archive. This path is merged to file names when adding files to an archive and removed from file names when extracting. For example, if you wish to add the file 'readme.txt' to the directory 'DOCS\ENG' of archive 'release', you may run: rar a -apDOCS\ENG release readme.txt or to extract 'ENG' to the current directory: rar x -apDOCS release DOCS\ENG\*.* -as Synchronize archive contents If this switch is used when archiving, those archived files which are not present in the list of the currently added files, will be deleted from the archive. It is convenient to use this switch in combination with -u (update) to synchronize contents of an archive and an archiving directory. For example, after the command: rar a -u -as backup sources\*.cpp the archive 'backup.rar' will contain only *.cpp files from directory 'sources', all other files will be deleted from the archive. It looks similar to creating a new archive, but with one important exception: if no files are modified since the last backup, the operation is performed much faster than the creation of a new archive. -cfg- Ignore configuration file and RAR environment variable. -cl Convert file names to lower case. -cu Convert file names to upper case. -c- Disable comments show. -df Delete files after archiving Move files to archive. This switch in combination with the command "A" performs the same action as the command "M". -dh Open shared files Allows to process files opened by other applications for writing. This switch helps if an application allowed read access to file, but if all types of file access are prohibited, the file open operation will still fail. This option could be dangerous, because it allows to archive a file, which at the same time is modified by another application, so use it carefully. -dr Delete files to Recycle Bin Delete files after archiving and place them to Recycle Bin. Available in Windows version only. -ds Do not sort files while adding to a solid archive. -dw Wipe files after archiving Delete files after archiving. Before deleting file data are overwritten by zero bytes to prevent recovery of deleted files, file is truncated and renamed to temporary name. Please be aware that such approach is designed for usual hard disks, but may fail to overwrite the original file data on solid state disks, as result of SSD wear leveling technology and more complicated data addressing. -ed Do not add empty directories This switch indicates that directory records are not to be stored in the created archive. When extracting such archives, RAR creates non-empty directories based on paths of files contained in them. Information about empty directories is lost. All attributes of non-empty directories except a name (access rights, streams, etc.) will be lost as well, so use this switch only if you do not need to preserve such information. If -ed is used with 'm' command or -df switch, RAR will not remove empty directories. -en Do not add "end of archive" block Not supported for RAR 5.0 archives. By default, RAR adds an "end of archive" block to the end of a new or updated archive. It allows to skip external data like digital signatures safely, but in some special cases it may be useful to disable this feature. For example, if an archive is transferred between two systems via an unreliable link and at the same time a sender adds new files to it, it may be important to be sure that the already received file part will not be modified on the other end between transfer sessions. This switch cannot be used with volumes, because the end of archive block contains information important for correct volume processing. -ep Exclude paths from names. This switch enables files to be added to an archive without including the path information. This could, of course, result in multiple files existing in the archive with the same name. If used when extracting, archived paths are ignored for extracted files, so all files are created in the same destination directory. -ep1 Exclude base dir from names. Do not store or extract the path entered in the command line. Ignored if path includes wildcards. Examples: 1) add all files and directories from 'tmp' directory to archive 'test', but exclude 'tmp\' from archived names path: rar a -ep1 -r test tmp\* This is an equivalent to commands: cd tmp rar a -r ..\test cd .. 2) extract files matching images\* mask to dest\ directory, but remove 'images\' from paths of created files: rar x -ep1 data images\* dest\ -ep2 Expand paths to full. Store full file paths (except the drive letter and leading path separator) when archiving. -ep3 Expand paths to full including the drive letter. Windows version only. This switch stores full file paths including the drive letter if used when archiving. Drive separators (colons) are replaced by underscore characters. If you use -ep3 when extracting, it will change underscores back to colons and create unpacked files in their original directories and disks. If the user also specified a destination path, it will be ignored. It also converts UNC paths from \\server\share to __server\share when archiving and restores them to the original state when extracting. This switch can help to backup several disks to the same archive. For example, you may run: rar a -ep3 -r backup.rar c:\ d:\ e:\ to create backup and: rar x -ep3 backup.rar to restore it. But be cautious and use -ep3 only if you are sure that extracting archive does not contain any malicious files. In other words, use it if you have created an archive yourself or completely trust its author. This switch allows to overwrite any file in any location on your computer including important system files and should normally be used only for the purpose of backup and restore. -e[+] Specifies file exclude or include attributes mask. is a number in the decimal, octal (with leading '0') or hex (with leading '0x') format. By default, without '+' sign before , this switch defines the exclude mask. So if result of bitwise AND between and file attributes is nonzero, file would not be processed. If '+' sign is present, it specifies the include mask. Only those files which have at least one attribute specified in the mask will be processed. In Windows version is also possible to use symbols D, S, H, A and R instead of a digital mask to denote directories and files with system, hidden, archive and read-only attributes. The order in which the attributes are given is not significant. Unix version supports D and V symbols to define directory and device attributes. It is allowed to specify both -e and -e+ in the same command line. Examples: 1) archive only directory names without their contents rar a -r -e+d dirs 2) do not compress system and hidden files: rar a -esh files 3) do not extract read-only files: rar x -er files -f Freshen files. May be used with archive extraction or creation. The command string "a -f" is equivalent to the command 'f', you could also use the switch '-f' with the commands 'm' or 'mf'. If the switch '-f' is used with the commands 'x' or 'e', then only old files would be replaced with new versions extracted from the archive. -hp[p] Encrypt both file data and headers. This switch is similar to -p[p], but switch -p encrypts only file data and leaves other information like file names visible. This switch encrypts all sensitive archive areas including file data, file names, sizes, attributes, comments and other blocks, so it provides a higher security level. Without a password it is impossible to view even the list of files in archive encrypted with -hp. Example: rar a -hpfGzq5yKw secret report.txt will add the file report.txt to the encrypted archive secret.rar using the password 'fGzq5yKw' -ht[b|c] Select hash type [BLAKE2,CRC32] for file checksum. File data integrity in RAR archive is protected by checksums calculated and stored for every archived file. By default, RAR uses CRC32 function to calculate the checksum. RAR 5.0 archive format also allows to select BLAKE2sp hash function instead of CRC32. Specify -htb switch for BLAKE2sp and -htc for CRC32 hash function. Since CRC32 is the default algorithm, you may need -htc only to override -htb in RAR configuration. CRC32 output is 32 bit length. While CRC32 properties are suitable to detect most of unintentional data errors, it is not reliable enough to verify file data identity. In other words, if two files have the same CRC32, it does not guarantee that file contents is the same. BLAKE2sp output is 256 bit. Being a cryptographically strong hash function, it practically guarantees that if two files have the same value of BLAKE2sp, their contents is the same. BLAKE2sp error detection property is also more reliable than in shorter CRC32. Since BLAKE2sp output is longer, resulting archive is slightly larger for -htb switch. If archive headers are unencrypted (no switch -hp), checksums for encrypted RAR 5.0 files are modified using a special password dependent algorithm, to make impossible guessing file contents based on checksums. Do not expect such encrypted file checksums to match usual CRC32 and BLAKE2sp values. This switch is supported only by RAR 5.0 format, so you need to use -ma switch with it. You can see checksums of archived files using 'vt' or 'lt' commands. Example: rar a -ma -htb lists.rar *.lst will add *.lst to lists.rar using BLAKE2sp for file checksums. -id[c,d,p,q] Disable messages. Switch -idc disables the copyright string. Switch -idd disables "Done" string at the end of operation. Switch -idp disables the percentage indicator. Switch -idq turns on the quiet mode, so only error messages and questions are displayed. It is allowed to use several modifiers at once, so switch -idcdp is correct. -ieml[.][addr] Send archive by email. Windows version only. Attach an archive created or updated by the add command to email message. You need to have a MAPI compliant email client to use this switch (most modern email programs support MAPI interface). You may enter a destination email address directly in the switch or leave it blank. In the latter case you will be asked for it by your email program. It is possible to specify several addresses separated by commas or semicolons. If you append a dot character to -ieml, an archive will be deleted after it was successfully attached to an email. If the switch is used when creating a multivolume archive, every volume is attached to a separate email message. -ierr Send all messages to stderr. -ilog[name] Log errors to file (registered version only). Write error messages to rar.log file. If optional 'name' parameter is not specified, the log file is created using the following defaults: Unix: .rarlog file in the user's home directory; Windows: rar.log file in %APPDATA%\WinRAR directory. If 'name' parameter includes a file name without path, RAR will create the log file in the default directory mentioned above using the specified name. Include both path and name to 'name' parameter if you wish to change the location of log file. By default, log file uses UTF-16 little endian encoding, but it can be changed with -scg switch, such as -scag for native single byte encoding. Example: rar a -ilogc:\log\backup.log backup d:\docs will create c:\log\backup.log log file in case of errors. -inul Disable all messages. -ioff Turn PC off after completing an operation. The hardware must support the power off feature. Windows version only. -isnd Enable sound. -iver Display the version number and quit. You can run just "RAR -iver". -k Lock archive. Any command which intends to change the archive will be ignored. -kb Keep broken extracted files. RAR, by default, deletes files with checksum errors after extraction. The switch -kb specifies that files with checksum errors should not be deleted. -log[fmt][=name] Write names to log file. This switch allows to write archive and file names to specified text file in archiving, extracting, deleting and listing commands. Its behavior is defined by 'fmt' string, which can include one or more of following characters: A - write archive names to log file. If RAR creates or processes volumes, all volume names are logged. F - write processed file names to log file. It includes files added to archive and extracted, deleted or listed files inside of archive. P - if log file with specified name is exist, append data to existing file instead of creating a new one. U - write data in Unicode format. If neither 'A' nor 'F' are specified, 'A' is assumed. 'name' parameter allows to specify the name of log file. It must be separated from 'fmt' string by '=' character. If 'name' is not present, RAR will use the default rarinfo.log file name. It is allowed to specify several -log switches in the same command line. This switch can be particularly useful, when you need to process an archive created with -ag or -v switches in a batch script. You can specify -loga=arcname.txt when creating an archive and then read an archive name generated by RAR from arcname.txt with an appropriate command. For example, in Windows batch file it can be: set /p name= Set compression method: -m0 store do not compress file when adding to archive -m1 fastest use fastest method (less compressive) -m2 fast use fast compression method -m3 normal use normal (default) compression method -m4 good use good compression method (more compressive, but slower) -m5 best use best compression method (slightly more compressive, but slowest) If this switch is not specified, RAR uses -m3 method (normal compression). -ma[4|5] Specify a version of archiving format. By default RAR creates archives in RAR 5.0 format. Use -ma4 to create RAR 4.x archives. Use -ma5 or just -ma in case you need to override -ma4 saved in configuration and force RAR to use RAR 5.0 format. This switch is used only when creating a new archive. It is ignored when updating an existing archive. -mc Set advanced compression parameters. This switch is intended mainly for benchmarking and experiments. In the real environment it is usually better to allow RAR to select optimal parameters automatically. Please note that improper use of this switch may lead to very serious performance and compression loss, so use it only if you clearly understand what you do. It has the following syntax: -mc[param1][:param2][module][+ or -] where is the one character field denoting a part of the compression algorithm, which has to be configured. It may have the following values: A - audio compression; C - true color (RGB) data compression; D - delta compression; E - x86 executable compression; I - Intel Itanium executable compression; T - text compression. RAR 5.0 archive format supports only 'D' and 'E' values. '+' sign at the end of switch applies the selected algorithm module to all processed data, '-' disables the module at all. If no sign is specified, RAR will choose modules automatically, based on data and the current compression method. Switch -mc- disables all optional modules and allows only the general compression algorithm. and are module dependent parameters described below. Audio compression, delta compression: is a number of byte channels (can be 1 - 31). RAR splits multibyte channels to bytes, for example, two 16-bit audio channels are considered by RAR as four channels one byte each. is ignored. x86 Intel executable compression, Intel Itanium executable compression, true color (RGB) data compression: and are ignored. Text compression: Text compression algorithm provides noticeably higher compression on plain text data. But it cannot utilize several CPU cores efficiently resulting in slower compression time comparing to general algorithm in multicore and multiprocessor environment. Also its decompression speed is much slower than in general algorithm regardless of CPU cores number. This is why the text compression is disabled by default. You can specify -mct switch to allow RAR to select this algorithm automatically for suitable data. Switch -mct+ will force use of the text compression for all data. Switch -mct can also include and , so its full syntax is -mc[param1][:param2]t[+ or -]. is the order of PPM algorithm (can be 2 - 63). Usually a higher value slightly increases the compression ratio of redundant data, but only if enough memory is available to PPM. In case of lack of memory the result may be negative. Higher order values decrease both compression and decompression speed. is memory in megabytes allocated for PPM (1-128). Higher values may increase the compression ratio, but note that PPM uses the equal memory size both to compress and decompress, so if you allocate too much memory when creating an archive, other people may have problems when decompressing it on a computer with less memory installed. Decompression will be still possible using virtual memory, but it may become very slow. Examples: 1) switch -mc1a+ forces use of 8-bit mono audio compression for all data. 2) switch -mc10:40t+ forces use of text compression algorithm for all data, sets the compression order to 10 and allocates 40 MB memory. 3) switch -mc12t sets the text compression order to 12, when the text compression is used, but leaves to RAR to decide when to use it. 4) switches -mct -mcd- allow RAR to apply the text compression to suitable data and disable the delta compression. -md[k,m,g] Select the dictionary size. Sliding dictionary is the memory area used by compression algorithm to find and compress repeated data patterns. If size of file being compressed (or total files size in case of solid archive) is larger than dictionary size, increasing the dictionary is likely to increase the compression ratio, reduce the archiving speed and increase memory requirements. For RAR 4.x archive format the dictionary size can be: 64 KB, 128 KB, 256 KB, 512 KB, 1 MB, 2 MB, 4 MB. For RAR 5.0 archive format the dictionary size can be: 128 KB, 256 KB, 512 KB, 1 MB, 2 MB, 4 MB, 8 MB, 16 MB, 32 MB, 64 MB, 128 MB, 256 MB, 512 MB, 1 GB. You can use 'k', 'm' and 'g' modifiers to specify the size in kilo-, mega- and gigabytes, like -md64m for 64 MB dictionary. If no modifier is specified, megabytes are assumed, so -md64m and -md64 are equal. When archiving, RAR needs about 6x memory of specified dictionary size, so 512 MB and 1 GB sizes are available in 64 bit RAR version only. When extracting, slightly more than a single dictionary size is allocated, so both 32 and 64 bit versions can unpack archives with all dictionaries up to and including 1 GB. If size of all source files for solid archive or size of largest source file for non-solid archive is at least twice less than dictionary size, RAR can reduce the dictionary size. It helps to lower memory usage without decreasing compression. Default sliding dictionary size is 4 MB for RAR 4.x and 32 MB for RAR 5.0 archive format. Example: RAR a -s -ma -md128 lib *.dll create a solid archive in RAR 5.0 format with 128 MB dictionary. -ms[list] Specify file types to store. Specify file types, which will be stored without compression. This switch may be used to store already compressed files, which helps to increase archiving speed without noticeable loss in the compression ratio. Optional parameter defines the list of file extensions separated by semicolons. For example, -msrar;zip;jpg will force RAR to store without compression all RAR and ZIP archives and JPG images. It is also allowed to specify wildcard file masks in the list, so -ms*.rar;*.zip;*.jpg will work too. Several -ms switches are permitted, such as -msrar -mszip instead of -msrar;zip. In Unix -ms switch containing several file types needs to be enclosed in quote marks. It protects semicolons from processing by Unix shell. Another solution is to use individual -ms switches for every file type. If is not specified, -ms switch will use the default set of extensions, which includes the following file types: 7z, ace, arj, bz2, cab, gz, jpeg, jpg, lha, lz, lzh, mp3, rar, taz, tgz, xz, z, zip, zipx -mt Set the number of threads. parameter can take values from 1 to 32. It defines the recommended maximum number of active threads for compression algorithm also as for other RAR modules, which can start several threads. While RAR attempts to follow this recommendation, sometimes the real number of active threads can exceed the specified value. Change of parameter slightly affects the compression ratio, so archives created with different -mt switches will not be exactly the same even if all other compression settings are equal. If -mt switch is not specified, RAR will try to detect the number of available processors and select the optimal number of threads automatically. -n Additionally filter included files. Apply the mask as an additional filter to included file list. Wildcards can be used both in the name and file parts of file mask. See switch -x description for details on mask syntax. You can specify the switch '-n' several times. This switch does not replace usual file masks, which still need to be entered in the command line. It is an additional filter limiting processed files only to those matching the include mask specified in -n switch. It can help to reduce the command line length sometimes. For example, if you need to compress all *.txt and *.lst files in directories Project and Info, you can enter: rar a -r text Project\*.txt Project\*.lst Info\*.txt Info\*.lst or using the switch -n: rar a -r -n*.txt -n*.lst text Project Info -n@ Read additional filter masks from list file. Similar to -n switch, but reads filter masks from the list file. If you use -n@ without the list file name parameter, it will read filter masks from stdin. This switch does not replace usual list files or file masks, which still need to be entered in the command line. It is an additional filter limiting processed files only to those matching the include mask specified in -n switch. Example: rar a -r -n@inclist.txt text Project Info @listfile.txt -oc Set NTFS Compressed attribute. Windows version only. This switch allows to restore NTFS Compressed attribute when extracting files. RAR saves Compressed file attributes when creating an archive, but does not restore them unless -oc switch is specified. -oh Save hard links as the link instead of the file. If archiving files include several hard links, store the first archived hard link as usual file and the rest of hard links in the same set as links to this first file. When extracting such files, RAR will create hard links instead of usual files. You must not delete or rename the first hard link in archive after the archive was created, because it will make extraction of following links impossible. If you modify the first link, all following links will also have the modified contents after extracting. Extraction command must involve the first hard link to create following hard links successfully. This switch is supported only by RAR 5.0 format, so you need to use -ma switch with it. -oi[0-4][:] Save identical files as references. Switch -oi0 (or just -oi-) turns off identical file processing, so such files are compressed as usual files. It can be used to override another -oi value stored in RAR configuration. If -oi1 (or just -oi) is specified, RAR analyzes the file contents before starting archiving. If several identical files are found, the first file in the set is saved as usual file and all following files are saved as references to this first file. It allows to reduce the archive size, but applies some restrictions to resulting archive. You must not delete or rename the first identical file in archive after the archive was created, because it will make extraction of following files using it as a reference impossible. If you modify the first file, following files will also have the modified contents after extracting. Extraction command must involve the first file to create following files successfully. It is recommended to use -oi only if you compress a lot of identical files, will not modify an archive later and will extract an archive entirely, without necessity to unpack or skip individual files. If all identical files are small enough to fit into compression dictionary specified with -md switch, switch -s can provide more flexible solution than -oi. Switch -oi2 is similar to -oi1, with the only difference: it will display names of found identical files before starting archiving. Switches -oi3 and -oi4 allow to utilize RAR to generate lists of identical files. Though you still need to provide a dummy archive name to make the command syntax valid, in this mode an archive is not created and nothing is compressed. If -oi3 is used, file sizes and names are displayed and every identical file group is separated with empty line. Switch -oi4 displays bare file names and skips the first identical file in every file group, so only duplicates are listed. Optional value allows to define the minimum file size threshold. Files smaller than are not analyzed and not considered as identical. If this parameter is not present, it is assumed to be 64 KB by default. Selecting too small may increase the time required to detect identical files. Switches -oi1 and -oi2 are supported only by RAR 5.0 format, so you need to use -ma switch with it. Examples: 1) rar a -oi -ma archive Save contents of current directory to archive.rar. Store identical files as references. 2) rar a -oi3:1000000 -r dummy c:\photo\*.jpg List all duplicate *.jpg files lather than 1000000 bytes found in c:\photo and its subdirectories. -ol[a] Process symbolic links as the link [absolute paths] Save symbolic links as links, so file contents is not archived. In Windows version it also saves reparse points as links. Such archive entries are restored as symbolic links or reparse points when extracting. Supported both for RAR 4.x and RAR 5.0 archives in RAR for Unix and only for RAR 5.0 archives in RAR for Windows. In Windows you may need to run RAR as administrator to create symbolic links when extracting. RAR adds all links regardless of target when archiving with -ol switch. When extracting, by default, RAR skips symbolic links pointing outside of destination directory, with absolute paths, excessive number of ".." in link target or with other potentially dangerous link parameters. You can enable extracting such links with -ola switch. Links pointing to directories outside of extraction destination directory can present a security risk. Enable their extraction only if you are sure that archive contents is safe, such as your own backup. Links that are considered safe by RAR are extracted always regardless of -ol or -ola switch. -oni Allow potentially incompatible names. While NTFS file system permits file names with trailing spaces and dots, a lot of Windows programs fail to process such names correctly. If this switch is not specified, RAR removes trailing spaces and dots, if any, from file names when extracting. Specify this switch if you need to extract such names as is. Windows version only. -or Rename extracted files automatically if file with the same name already exists. Renamed file will get the name like 'filename(N).txt', where 'filename.txt' is the original file name and 'N' is a number starting from 1 and incrementing if file exists. -os Save NTFS streams. Windows version only. This switch has meaning only for NTFS file system and allows to save alternate data streams associated with a file. You may need to specify it when archiving if you use software storing data in alternative streams and wish to preserve these streams. Streams are not saved for NTFS encrypted files. -ow Use this switch when archiving to save file security information and when extracting to restore it. Unix RAR version saves file owner and group when using this switch. Windows version stores owner, group, file permissions and audit information, but only if you have necessary privileges to read them. Note that only NTFS file system supports file based security under Windows. -o[+|-] Set the overwrite mode. Can be used both when extracting and updating archived files. Following modes are available: -o Ask before overwrite (default for extracting files); -o+ Overwrite all (default for updating archived files); -o- Skip existing files. -p[pwd] Set password Set password to encrypt files when archiving or to decrypt when extracting. Passwords are case-sensitive. Maximum password length is 127 characters. Longer passwords are truncated to this length. If you omit a password in command line, you will be prompted with "Enter password" message. You can also use file redirection or pipe to specify a password if parameter is missing. Examples: 1) rar a -psecret texts.rar *.txt add files *.txt and encrypt them with password "secret". 2) rar -p texts.rar *.txt < psw.txt set contents of psw.txt file as a password. -p- Do not query password Do not query password for encrypted files when extracting. Actually you can specify any invalid password to suppress the password prompt and force RAR to issue 'incorrect password' message when extracting an encrypted file. This switch just sets '-' as a password. -qo[-|+] Add quick open information [none|force] RAR archives store every file header containing information such as file name, time, size and attributes immediately before data of described file. This approach is more damage resistant than storing all file headers in a single continuous block, which if broken or truncated would destroy the entire archive contents. But while being more reliable, such file headers scattered around the entire archive are slower to access if we need to quickly open the archive contents in a shell like WinRAR graphical interface. To improve archive open speed and still not make the entire archive dependent on a single damaged block, RAR 5.0 archives can include an optional quick open record. Such record is added to the end of archive and contains copies of file names and other file information stored in a single continuous block additionaly to normal file headers inside of archive. Since the block is continuous, its contents can be read quickly, without necessity to perform a lot of disk seek operations. Every file header in this block is protected with a checksum. If RAR detects that quick open information is damaged, it resorts to reading individual headers from inside of archive, so damage resistance is not lessened. Quick open record contains the full copy of file header, which may be several tens or hundreds of bytes per file, increasing the archive size by the same amount. This size increase is most noticeable for many small files, when file data size is comparable to file header. So by default, if no -qo is specified or -qo without parameter is used, RAR stores copies of headers only for relatively large files and continues to use local headers for smaller files. Concrete file size threshold can depend on RAR version. Such approach provides a reasonable open speed to archive size tradeoff. If you prefer to have the maximum archive open speed regardless of size, you can use -qo+ to store copies of all file headers. If you need to have the smallest possible archive and do not care about archive open speed in different programs, specify -qo- to exclude the quick open information completely. If you wish to measure the performance effect of this switch, be sure that archive contents is not stored in a disk cache. No real disk seeks are performed for cached archive file, making access to file headers fast even without quick open record. -r Recurse subdirectories. May be used with commands: a, u, f, m, x, e, t, p, v, l, c, cf and s. When used with the commands 'a', 'u', 'f', 'm' will process files in all sub-directories as well as the current working directory. When used with the commands x, e, t, p, v, l, c, cf or s will process all archives in sub-directories as well as the current working directory. -r- Disable recursion. Even without -r switch RAR can enable the recursion automatically in some situations. Switch -r- prohibits it. If you specify a directory name when archiving and if such name does not include wildcards, by default RAR adds the directory contents even if switch -r is not specified. Also RAR automatically enables the recursion if disk root without wildcards is specified as a file mask. Switch -r- disables such behavior. For example: rar a -r- arc dirname command will add only the empty 'dirname' directory and ignore its contents. Following command: rar a -r- arc c:\ will compress contents of root c: directory only and will not recurse into subdirectories. -r0 Similar to -r, but when used with the commands 'a', 'u', 'f', 'm' will recurse into subdirectories only for those file masks, which include wildcard characters '*' and '?'. This switch works only for file names. Directory names without a file name part, such as 'dirname', are not affected by -r0 and their contents is added to archive completely unless -r- switch is specified. Example: rar a -r0 docs.rar *.doc readme.txt add *.doc files from the current directory and its subdirectories and readme.txt only from the current directory to docs.rar archive. In case of usual -r switch, RAR would search for readme.txt in subdirectories too. -ri

[:] Set priority and sleep time. Available only in RAR for Windows. This switch regulates system load by RAR in multitasking environment. Possible task priority

values are 0 - 15. If

is 0, RAR uses the default task priority.

equal to 1 sets the lowest possible priority, 15 - the highest possible. Sleep time is a value from 0 to 1000 (milliseconds). This is a period of time that RAR gives back to the system after read or write operations while compressing or extracting. Non-zero may be useful if you need to reduce system load even more than can be achieved with

parameter. Example: execute RAR with default priority and 10 ms sleep time: rar a -ri0:10 backup *.* -rr[N] Add data recovery record. This switch is used when creating or modifying an archive to add a data recovery record to the archive. See the 'rr[N]' command description for details. -rv[N] Create recovery volumes. This switch is used when creating a multivolume archive to generate recovery volumes. See the 'rv[N]' command description for details. -s Create solid archive. A solid archive is an archive packed by a special compression method, which treats several or all files, within the archive, as one continuous data stream. Solid archiving significantly increases compression, when adding a large number of small, similar files. But it also has a few important disadvantages: slower updating of existing solid archives, slower access to individual files, lower damage resistance. Usually files in a solid archive are sorted by extension. But it is possible to disable sorting with -ds switch or set an alternative file order using a special file, rarfiles.lst. Example: create solid archive sources.rar with 512 KB dictionary, recursing all directories, starting with the current directory. Add only .asm files: rar a -s -md512 sources.rar *.asm -r -s Create solid groups using file count Similar to -s, but resets solid statistics after compressing files. Usually decreases compression, but also decreases losses in case of solid archive damages. -sc[objects] Specify the character set. 'Charset' parameter is mandatory and can have one of the following values: U - Unicode UTF-16; F - Unicode UTF-8; A - the native single byte encoding, which is ANSI for Windows version; O - OEM (DOS) encoding. Windows version only. Endianness of source UTF-16 files, such as list files or comments, is detected based on the byte order mark. If byte order mask is missing, little endian encoding is assumed. 'Objects' parameter is optional and can have one of the following values: G - log files produced by -ilog switch; L - list files; C - comment files; R - messages sent to redirected files and pipes (Windows only). It is allowed to specify more than one object, for example, -scolc. If 'objects' parameter is missing, 'charset' is applied to all objects. This switch allows to specify the character set for files in -z[file] switch, list files and comment files written by "cw" command. Examples: 1) rar a -scol data @list Read names contained in 'list' using OEM encoding. 2) rar c -scuc -zcomment.txt data Read comment.txt as Unicode file. 3) rar cw -scuc data comment.txt Write comment.txt as Unicode file. 4) rar lb -scur data > list.txt Save archived file names in data.rar to list.txt in Unicode. -se Create solid groups using extension Similar to -s, but resets solid statistics if file extension is changed. Usually decreases compression, but also decreases losses from solid archive damages. -sfx[name] Create SFX archives. If this switch is used when creating a new archive, a Self-Extracting archive (using a module in file default.sfx or specified in the switch) would be created. In the Windows version default.sfx should be placed in the same directory as the rar.exe, in Unix - in the user's home directory, in /usr/lib or /usr/local/lib. Example: rar a -sfxwincon.sfx myinst create SelF-eXtracting (SFX) archive using wincon.sfx SFX-module. -si[name] Read data from stdin (standard input), when creating an archive. Optional 'name' parameter allows to specify a file name of compressed stdin data in the created archive. If this parameter is missing, the name will be set to 'stdin'. Example: type Tree.Far | rar a -siTree.Far tree.rar will compress 'type Tree.Far' output as 'Tree.Far' file. -sl Process only those files, which size is less than specified in parameter of this switch. Parameter must be specified in bytes. -sm Process only those files, which size is more than specified in parameter of this switch. Parameter must be specified in bytes. -sv Create independent solid volumes By default RAR tries to reset solid statistics as soon as possible when starting a new volume, but only if enough data was packed after a previous reset (at least a few megabytes). This switch forces RAR to ignore packed data size and attempt to reset statistics for volumes of any size. It decreases compression, but increases chances to extract a part of data if one of several solid volumes in a volume set was lost or damaged. Note that sometimes RAR cannot reset statistics even using this switch. For example, it cannot be done when compressing one large file split between several volumes. RAR is able to reset solid statistics only between separate files, but not inside of single file. Ignored if used when creating a non-volume archive. -sv- Create dependent solid volumes Disables to reset solid statistics between volumes. It slightly increases compression, but significantly reduces chances to extract a part of data if one of several solid volumes in a volume set was lost or damaged. Ignored if used when creating a non-volume archive. -s- Disable solid archiving -t Test files after archiving. This switch is especially useful in combination with the move command, so files will be deleted only if the archive had been successfully tested. -ta Process only files modified after the specified date. Format of the date string is YYYYMMDDHHMMSS. It is allowed to insert separators like '-' or ':' to the date string and omit trailing fields. For example, the following switch is correct: -ta2001-11-20 Internally it will be expanded to -ta20011120000000 and treated as "files modified after 0 hour 0 minutes 0 seconds of 20 November 2001". -tb Process only files modified before the specified date. Format of the switch is the same as -ta. -tk Keep original archive date. Prevents RAR from modifying the archive date when changing an archive. -tl Set archive time to newest file. Forces RAR to set the date of a changed archive to the date of the newest file in the archive. -tn

Assign work directory as

. This switch may be used to assign the directory for temporary files. -x Exclude the specified file or directory. Wildcards can be used in both the name and path parts of file mask. You can specify the switch '-x' several times to define several exclusion masks in the same command line. If mask contains wildcards, it applies to files in current directory and its subdirectories. It is not recursive without wildcards, so "filename" mask will exclude 'filename' file only in current directory when archiving or in root archive directory when extracting. Use "*\filename" syntax to exclude "filename" recursively in all directories. If you know the exact path to file, you can use "path\filename" syntax to exclude only this copy of "filename". If you use -xpath\filename syntax when unpacking an archive, "path" must be the path inside of archive, not the file path on the disk after unpacking. By default, masks containing wildcards are applied only to files. If you need a mask with wildcards to exclude several directories, use the special syntax for directory exclusion masks. Such masks must have the trailing path separator character ('\' for Windows and '/' for Unix). For example, "*tmp*\" mask will exclude all directories matching "*tmp*" and "*\tmp\" will exclude all 'tmp' directories. Since wildcards are present, both masks will be applied to contents of current directory and all its subdirectories. If you wish to exclude only one directory, specify the exact name of directory including the absolute or relative path without any wildcards. In this case you do not need to append the path separator to mask, which is required only for directory exclusion masks containing wildcards to distinguish them from file exclusion masks. Examples: 1) rar a -r -x*.jpg -x*.avi rawfiles compress all files except *.jpg and *.avi in current directory and its subdirectories; 2) rar a -r -x*\temp\ savec c:\* compress all files on the disk c: except 'temp' directories and files inside of 'temp' directories; 3) rar x -x*.txt docs extract all files except *.txt from docs.rar. -x@ Exclude files listed in the specified list file. If you use -x@ without the list file name parameter, it will read file names from stdin. Example: rar a -x@exlist.txt arch *.exe -y Assume Yes on all queries. -z[file] Read archive comment from file . This switch can be used with any archive modification command to read the archive comment from file and add it to archive. Use with -sc switch if you need to specify the character set for comment text file. If is not present, comment is read from stdin. Limitations ~~~~~~~~~~~ Command limitations: Commands 'd','u','f','c','cf' will not operate with archive volumes. Command 'a' cannot be used to update an archive volume, only to create a new one. Exit values ~~~~~~~~~~~ RAR exits with a zero code (0) in case of successful operation. Non-zero exit code indicates some kind of error: Code Description 0 Successful operation. 1 Non fatal error(s) occurred. 2 A fatal error occurred. 3 Invalid checksum. Data is damaged. 4 Attempt to modify an archive locked by 'k' command. 5 Write error. 6 File open error. 7 Wrong command line option. 8 Not enough memory. 9 File create error 10 No files matching the specified mask and options were found. 11 Wrong password. 255 User stopped the process. Glossary ~~~~~~~~ Archive Special file containing one or more files optionally compressed and/or encrypted. Compression A method of encoding data to reduce it's size. Checksum Value calculating for data block or file and allowing to check data or file validity. SFX archive SelF-eXtracting archive. Archive in executable format, consisting of self-extracting module followed by compressed data. It is enough to run such executable to start extraction. Solid An archive packed using a special compression method which sees all files as one continuous data stream. Particularly advantageous when packing a large number of small files. Volume Part of a split archive. Splitting an archive to volumes allows storing them on several removable disks. Solid volumes must be extracted starting from first volume in sequence. Copyrights (c) 1993-2017 Alexander Roshal