rar/0000755000175000017500000000000014462150076007153 5ustar zzrar/rarfiles.lst0000644000175000017500000000223114462150076011504 0ustar zz; File order list for solid archiving ; ; Here you may modify the file list which tells RAR the order in which ; to add files to a solid archive. ; ; This file may contain file names, wildcards and a special entry - $default. ; The default entry defines the position in the order list for files not ; matched with other entries in this file. Lines beginning with the semicolon ; symbol ';' are considered as comments and not processed. ; ; Place this file in the same directory as RAR.EXE. ; ; Tips to provide improved compression and speed of operation: ; ; - files containing similar information should be grouped together in the ; archive if possible; ; - frequently accessed files should be placed at the beginning. ; file_id.diz descript.ion read.* readme.* *.nfo *.doc *.txt *.htm *.html *.shtml *.css *.xsl *.xml *.js *.php *.lst *.log *.ini *.bat *.cmd *.h *.hpp *.c *.cpp *.java *.asm *.bas *.bak *.cue *.rtf *.hlp *.inf *.com *.exe *.dll *.obj *.lib *.sys *.drv *.bin *.bmp *.wav $default *.mp3 *.mp4 *.m4a *.mov *.avi *.wmv *.wma *.gif *.tif *.png *.jpg *.chm *.pdf *.cab *.7z *.arj *.ha *.lz *.lzh *.rar *.zip *.gz *.bz2 *.xz *.jar *.fla *.flac *.ape *.bik *.mkv rar/rar0000755000175000017500000251521414462150076007677 0ustar zzELFС4 4 (444  TTT   p hhh Ptd̨( ( ddQtdRtd  /lib/ld-linux.so.2GNU T!t (ȁ ҝcŬKx fUa&?9ByIk3 {9(_ zLXOu'/@+qsaW$HeP;bi@Gr=Oelm .EmG  N2|{m`_r3&  feQ$&0,!|,!4* \!|$* !;,!$ p !libstdc++.so.6__gmon_start__pthread_createpthread_join_ZTVN10__cxxabiv121__vmi_class_type_infoE__cxa_call_unexpected__cxa_end_catch__cxa_throw_ZTVSt9bad_alloc_ZTISt9bad_alloc_Znaj_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEE10_M_replaceEjjPKwj_ZSt9terminatev__cxa_begin_catch_ZTVN10__cxxabiv116__enum_type_infoE_ZSt20__throw_length_errorPKc__cxa_rethrow_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEED2Ev_ZSt17__throw_bad_allocv__gxx_personality_v0_ZTVN10__cxxabiv120__si_class_type_infoE_Znwj_ZNSt9bad_allocD1Ev_ZTVN10__cxxabiv117__class_type_infoE__cxa_allocate_exception_ZdlPv_ZdaPvlibm.so.6libgcc_s.so.1_Unwind_Resume__udivdi3__umoddi3__divdi3libpthread.so.0writepthread_cond_destroypthread_mutex_initpthread_cond_broadcastpthread_cond_waitpthread_mutex_unlockpthread_cond_signallseek64pthread_cond_init__errno_locationpthread_mutex_lockpthread_mutex_destroyfsynclibc.so.6_IO_stdin_usedputwcharwmemsetfflushstrcpysprintfsetlocalembrtowctowlowerwcsncpystrncmpstatvfs64wcrtombwcspbrkftruncate64getpwuidmbsrtowcsclosedirgetgrgidstrncpymkdirreallocclocktowupperstdinmemchrgetpidstrdupchmodflockfgetws__ctype_get_mb_cur_maxstrtolisattylchownsymlinkgetpwnamstrlenwcschr__cxa_atexitlocaleconvstrstrutimensatrmdirmemcmptouppervfwprintf__fxstat64getgrnamstdoutmemcpyfclosewcscmpstrtoulmallocgetpassumaskremove__lxstat64opendir__xstat64getenvstderrwcscpyreadlinkfilenogetcwdfreadrenamelocaltimestrchrmktimereaddir64qsortwcsdupvswprintfwcstolfopen64wcsrtombsaccessstrcmpstrerror__libc_start_mainwcslenwcsncmpwmemmovesysconfwcsstrfreewcsrchrGCC_3.0GLIBC_2.0CXXABI_1.3GLIBCXX_3.4.21GLIBCXX_3.4GLIBC_2.2GLIBC_2.1.3GLIBC_2.6GLIBC_2.1GLIBC_2.3.2             }0P&y ii @ӯkqt)`ii si ii ii ii ii ii ii ri ~0\p|$$$      $ ( ,  0  4  8  <  @ D H L P T X \ ` d h l p t x |     ! " #  $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; <!=!>!? !@!A!B!C!D !E$!F(!G,!H0!I4!J8!Kgt$LtT$@oAo fpfpJ u9t$)D ffff.IuD |$  D$P11R)؉D$fff.E;$lsQt,RT$9u$h\$ D‰苬$hA|Ջ|Fu1ꋄ$hL^_[]@WVP ФD$1AF=Ф $hVP\LJD^_SWVT$t$D$ffffff.8 t tu1tJ11@t "u$@"t tF tAt39s/tg|$\$ V~ @fy/t H}j.QttWh V$^_[^_[DVt$t%4$<~ @@y/tH}1Ή4$D$.Y^@WVPt$tx>ts V~ @f.y/t H}|$j.QtWh VTWh VB^_Vt$tU4$\~ @@y/t H}Ή4$D$.}tL$$L$1^ D$th+ P1  D$$o1 f D$$O fDVt$4$t|/tA;L$s/D^USWV $, $$ $ \$hVSN 6 St"|/tAwD /DhUSWS$4  ^_[]fffff.SWVt$||$N W~ P@y/t J}\$)9r(~4@f.~/t H})VWS^_[ÐVt$4$~(L9/tHP} qM^fWVPD$|$t$t Hv(1K h, t#WVP%W4, VWh+ V^_USWV |$$t$(l$ ft+V4, WALfff. h, #t VWPAVh+ Wffff. Wt |/tA9s/DVUWE|$,t W,C6 ^_[]fffff.USWV t$ 4$=~ @Dy/tH}>u v΃>to4$ |$9vtfD݋E$]9vu9v.t$u9w ^_[]É4$D$.j9C߅D߉fff.SWV|$ \$$!<$R~ @y/t H} $D$.oƅ~t,4$D$+ ot4$D$ [ى4$D$+ ))L$>.~D$(F$j*F $W4$wLA:LD9@H.4A0H@:t\$D$+ $_\$<$D$+ <$~ @fy/t H} $D$.ƅt >.^_[É<$[Ƌ@:ufff.9F0r@$Kt2@:t뮍F)D$ $)\$w닉<$=N9t9P@u1_aTfffff.Vt$j:Vt1^Ët‰D rt.uQ/uf.Quօth+ VTf.SWVt$>tL\$, , EFffffff.ǃPW utF_>Fu^_[USWV t$ .tu\$$+ , Efff.UW ut __t" t.t :t D~/u_nu ^_[]fSVT$D$Jt.t$ 1ffff.\/tt߈<A9r1^[fff.SVT$D$Jt.t$ 1ffff./\tt߈<A9r1^[fff.SWVT$D$Jt/t$1fff.<\/ttA9r1^_[fDSWVT$D$Jt/t$1fff.) @hPUFFFFFF0hWPF#F ^_[]@USWV $$$ $(l$hUV) @hPU{GGGGGG0hVP>G#Gu#VhԤ2mjhԤ] ^_[]fUSWV $$$ $(l$hUV) @hPU軷GGG0GGGhVP~G#GuVhԤpl1 ^_[]Vt$FN!t~tFFF^É$FFFu׀~t0$Ԥt$]1WVPt$|$0WVHtWVthWV1^_fUSWV l$(|$ \$$Gu"O!u jGOUSP_9G0D$ff.jt$hԤidtP9s.~*݋X WP)jRPWӉl$8USwӶ9ut$ jhԤa1G  ^_[]fffff.USWV|$01 dD$D$u WPD$T$D$4\$8O01L$ D$f.u1GG GSt$ P读ʼn\$tQ|$0\$)Gl$tffffff.LJ0 tG11t$t$0L$T$jRQVPBÃ~u1FF NPt$ Q迺t$DŃD9|$fD$D$D$utPuG u#t$hԤ\1|$0\$AB1w D$PD$PD$Pt$$hԤX] |$u|$uuu~w$G(1^_[]ff. T$L$D$zuBB1RQPR{Vt$t$t$t$V6u~t0VhԤa^Ã^fffff.USWV $ EM!$($$$,}}tu`M$E(9|R)dz)E$M( EB΃QL$QUP1}yat]E UPtBD$EjjjUPE UPD$E$jSt$UPD$$ƋE1E SWVP@!ƒÉ؁ ^_[]ËEt$hVUP~ff.E$M(EhVUPfff.USWV t$  VPD$jjjVP VPËjWt$VP؉ ^_[]Vt$F#Ft~u(F$V(=~t-F0PhԤ_~tjjjv!^ø^ffff.ffffff. D$D$ T$jRPQD$ f D$jPt$fDVD$p PQRPV螶^Ð D$@$螱 f.ffffff. D$0t$t$PÐUSWV$4$8t Ft G1Ʌu1ۉ<̓D$ hP$<t3 W+\$D$ W,jhʚ;RP:\$D$?D$ t/ V+D$ V,jhʚ;RP ?D$D$jSD$$Pjk^_[]ffff.USWV L$$|$(t$ t"ʚ;^LnHՃUPQ:,\$,t"ʚ;NTnPՃUPW,t$ʚ;NDn@փVPS+ ^_[]ffff.SWV`t$x|$tD$pL$Qpj蜱t$ʚ;L$Ll$HӃSPW+|$|t$ʚ;L$Tl$PӃSPVX+t$ʚ;L$Dl$@փVPW0+`^_[fD L$AI!t$T1 USWV,\$Ll$HD$$ƅu $ԤkP؃D$t$5D$$ ȉL$D$1D$ '|$ى\$(EŁML$@ʋ ID$t$$щŅD$l$D$D$D$\$$D$ |$(T$ L$DD) \$t$WٹF 1D$t 4$輯T$,^_[]Ët$D$ ut$Džt4$芯<$±fffffffD$H#HfffffffSV$t$hV$۸t$PV{1uʬ19@^[fDUSWV ($ (B8f)$9$ |$t$É$D$ DŽ $D$lj|$<$D$觩tG$((u=$, y"$ $L$6D$? Z"D$$ DE*$$(uF4$8$u0D$ 4$D$lj|$<$D$À1ۉ؁ (^_[]fD t$ t$t$D1ffff.WVd($hhV$|(|$hhWVf|$d> EǃL$QP蘯1u$L$d$ʁd(^_ffffff.Vt$ hV$jVҧ^fSWVP@$`@4$x$H <$Ht$<$EHDŽ$, DŽ$( DŽ$4 DŽ$0 DŽ$< DŽ$8 D$<$D$D$HÉ<$G-|$4$D$|$<$D$É؁P@^_[Ɖ<$zG4$­ffffff.#D$=@fffff.L$tɁt t1D#D$=fffff.Vht$lhV$|@D$ PVjuD$@PV襥h^f.#D$=fffff.V$t't$ hVPhV:^ffffff.Vht$lhV$|pD$ PVjM1uD$h^fDWV$|$hW$VW蛤^_f.USWV$ $ W菨D$D$ \$$SM' S"jhRP6D$عZ| )t$l$ t$$L$ iP)Ð St$$hD- j2V苧 Vt]D$;$ sPt$ Vt$h$W$ jWͣCMt$ 1^_[]fffff.USWV$$$$ QPʼnT$ |$ t$5 u $D$ T$tR8\ fnfpfD$0fD$@fD$tD$pfD$`fD$PD$x D$l^_[]ËD$0D$8\ fnfp$DŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$:DŽ$$$$`D$$F"l$Åt$,$'É4$KÍD$x$ $CUSWVW)$jjPt$<tQ\$D$k9ʼnl$vET$ tD9Չv@Rh8* hԤ= hԤ70L$D$14$A| 9GWt$ oƅu hԤ/4$|$D$|$4D9os+oUW谟oD$0 uw7t$ Z9|x$uwQPZSQP 7Ҏ9GsO)ȃPW)G$t P؃^_[]Ƌ$t P^ V蒑 ffffff.USWV,l$@*^W)D$E@,$ЉƉ׍D$,$D$ËE@|$t$,$D$ ЄtB\$|$D$$赐$@9 $L$)DljD$ $;+D$t${,^_[]ƋD$t$_4$藐@USWVLH$lH$hH$dH$`HD$uE UP uLH^_[]Azt tu  D$ VPtt44 jjjjW@ jjjjW, tt6UW1۹@. E VPN0o0Eu1ۋ VPtGp UxjRPUփ SjjUW] EjUPL ^_[]Éƃ Sl V` ffff.USWVL $` |$<$ӛ*D$p: `$X`tF$x. *`L$$*`D$<$1ۄu# $. $JD$ *1ۋ$\$_ƅu $Ԥl\$t$<$誢ljt/u< < t$/ $d $L$$@9 $` |$t$D$ $t4$)\߳<$轚؁L ^_[]À> u~ u$P/ T$d $L$$@9 Džt4$[$U<$]f.USWVl$- V4/x$|$@D$XxD$8\ fnF0fpD$ fD$$ uR jjt$j$P  VP)SU$V٩!jVP*U$*(hfoD$D$ D$$D$48\ D$88\ D$<8\ GG GGGGGG$G D$h(D$`D$ D$,P(jhԤfDwt%Jul4$tu$t$$\tv$t  QPjVP+QP$Vۧ&@l4tjVP1I VP,1l^_[]Ë$55VP?^USWV|$0t$8\$Muڋl$ D$\$0D1탻 L$4D$r!9uyu 1y@WUQ}1lt7 GǃD$PjYŅu1 hԤ 1D$Vt$y u]|x t$TL$ƍ\69D 9GÃPUXDžud1 hԤP t$|ƋL$9sSD 9GƃPU4XDžu41 hԤ FSWPt$y\$0VWt$gzD$ t PTjPVjh@. jjVUSt t WT,^_[]11볉A1|$ u$Ɖ|$ t t$GTuƅt W/T VcV USWV,|$@t$H\$Tl$P WPD$T$LJ\xxhSP&jT$h|$Dt$L Dž l$t*ht u@u2 D$  L$T$HD$(tV D$ ƇƇuoD$t$HjP誥LJ<ƇL D$ €ƇT$Ƈtt$HD$*؉L$1" l$P 2T$ DȉЉtxt U \$fnfn1ɅfbfpDjQVP1ɋ |$L$$Du1ɄۉtʃxxujjPWܟLJL jjjjWN *l ptFD$X1Ҩt>Pt4dx<98}D$jPjW踻1Ҋdx\$ɉƈL$tL$ރƃ9u8T$(<)9־MMމ<84tF*@t7|$tT$ރƃ:u)8< \$PjjjW h) U*d*%L$QS*P*%PR u,4*0**\$P D$D$8u! hbJƃUV聁 hJƃUV **%VP$*t$,PQ|$tW1 gT$* S\$`R<Vt$$QPjU0Ƈ)WSU1|$(uat~|$hjQƅu hԤ#hVUPVU֍XxL$Ƈ)))ut$$t$LU|$n*jjjPQ* PQ*** *Pt$Tjt$ t$ WP jjjjW5 jjjWP,^_[]Åt VZMc ʉT$ j}Idh hpP1Oǃ VK"ǃ VKDžt VL W#O D$jPQÐUSWVL$d$`h0$P`hSUqv0$P@hWVpWSbt$h;$l$P hUW|b\$PhUSfbhh0 SPmhS_GS$pT,W$l9tI $p# uj 6j,W$pُ8\ fnfpD$ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H<$t$D$@|$ D$ P hԤrj hԤp1L^_[]USWV\$t u !t0VhԤ<l^_[]Ê$pt 44* P*@S至8x PSD$ D$*|uD$jjPVΗ*|u** tL$T$ uWHuND$L$ t\lp4x4jjQSP jjjjSӺ D$ D$ tD$jjPS7F0 D$(PdlōC0 D$POlNj SP  VP jhԤ|$WUVSl$ $, SĆj |$$WS衈$pt $, PS1ۃD$$hWP^t V觇$`@hWPQ^$``hWS8^hh0 S"ihS1t,SV0t $h@P^jhԤo UWhԤ|$t|$t D$9D$uD$(Pt$umjD$(PV诉t$UohhVUD$ D$ tD$jjPV@ VЃ UEhD$(Pt$\ $, P9D$$p D$ tD$ jPV赒t t$]jhԤ;t h 0 蒺 PV\ƃ $, P袄 V6H USWV $ $$ dž8xƆ,x8xt` uB*0xLRhh%jPV' Ɔ9x44xfdž:xjjjVP jjjjV *lp؉5  VP)Ӄ؃؃|,*pl؃9}fD$h jPiFfD+s ؽ LLVD$P$, +)ظ| ^_[]fff.SWVt$\$* Pv*@V~PV*|ux** tf *uIHu@lp4x4jjQVP jjjjV% jjWV藏 VP *|u#* *t*jPVitF0 Pt h 0 X P^_[DWVP|$t$+dUhUjQRWPhUdUVW蝑^_WVPt$|$ jjjVW ttfffff. jjjjW +dUhUjQRVPhUdUWV jjjVWa u^_@ffff.USWVD$L$tڃʃ uы8<׉)σ19ѺMM݉<8^_[]USWV\$0$8 - 4$Ih)<$t$*|$ǃ*ǃ*D$$|$44\4ǃ4ǃ4ǃ4ǃ4ǃ@UǃD$$R ${D$ $^?ff.WVPt$- **ht$V;g$gt$<Rua|>SuZ|>FuS|>XuLrBau=|ru6|!u/|u(|u!Thf8f@I96t V7 8\ 0fnfpD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H<D$@,$ D$ PEw4jVUP>x4 Up tNfEjUP*t3u *u# U" u1ۀ*?1!$t <8\ fnE0fpD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@$ D$ PJ$Y4ۈ{*t e}[E UP*Ɖ)D$P U*ttZu!t 41EjUP Ufu#U4{ L$PE@jjQUЃ uE@jt$TUЃ V+4g1ۉ؃l^_[]1foD$P*EjWVUPt tT0hUPJ뛉Džt V3 W5 @VXt$`D$dD$4$t4$D$!8\ 0fnD$fp$D$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P9D$Ht$|D$$ԤxX^SVTt$`D$dD$4$7t4$D$8\ L$fnF0 $fpD$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P9D$HD$4$P 1ۉ؃T^[fff.ST$ t)rbL$9Ru]YEuy~uy^u[1[Ãr=au<:86420.,*lj$&"  $D$Pd1 t$Tt4$^4$$t$#<$[VXt$`8\ L$fn $fpD$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HF0D$1Ɔ D$$ԤX^ÐUSWV |$ <$ƅtNl$$fffff.t *t)u&9*t<$<$Cu1 ^_[]ffff.USWV |$ <$mƅtrxfff.*tPtt-f&*uD$$,$D$@t<$t<$Cu1 ^_[]fUSWV l$ 44 4tzE UPNjEj44UP Uƅt1 u(*uxh PEjSWUP U7ƅtrx*tYtt.f$*uh Wt! UB UCu1 ^_[]WVTt$`4$@11 u33 8\ 0fnD$fp$D$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P8D$Ht$D$$Ԥ輙T^_fDVXT$`L$d8\ D$hfnfpD$D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P"0T$L$ L$D$HD$ $1D$$ԤX^VXt$`*hgN0t$dPQjur VP 8\ fnfpf$fD$fD$DD$@fD$0fD$ D$H D$ PhhԤz*ƀ*X^DWVP|$t$*u4$*u4$c^_ffff.VD$ u1Ҁ P$T$(f0/t6\tu3ff. uu_/^fDUSWV $ $ K);Kc KW $ $ q(ABt$4r0h |$\8\ D$`t$5$ $UB$ $TL$$D$ $e$ Ɖ4$:U4$2U$ Ɓ D$ $D$L1 D$Ɖ4$D$4t$D$$Z$ $TCD$XT$T$ T$ $D$ J$ $TË$ $@@ƁBƁAt>$ $GTƸ|$\C$ t$|$$,U7$ t0<$T\$`Ƹ<$Ct$\$T3$ @t<$SC@t<$SCƆ@$ uF1)ʋ|$D9WsЉ+G<$D$WT$4$D$[T4$>S$ $ 4$:R< $L$ D$81 D$É$tfo$L$$ $O%?=ɚ;w#L$$D$D$ $dff.$ kC)x1/# ^_[]$1 { )|$t D$$sD$t$c4$D$UDVt$=("u$("$VtWu85u)("u3%1("Ut%A("% %%$85^ffffff.WVPD$x4 u444P}1ƒ^_DUSWV$0 8\ 0fnfpD$TD$d8\ D$h8\ D$l8\ D$tD$pD$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$P D$\PŲjhԤ蓈1Mxxw 2D9tx8\ 0fnfpD$TD$d8\ D$h8\ D$l8\ D$tD$pD$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$P D$\Pӱ1m u h) U/d|$XUWn=jDWjC$8)t_*1ۀhgDˍ W|$`S<RQPjUq0x*jS~fpD)Ɔ)$<VUjp$<Xx)))dž)$L$LƄ$LxxjtxWC=8\ 0fnfpD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@4$ D$ P華QPUI1ҀEуRPS8\ fnF0ƀxfpD$D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H$D$@t$ D$ P谮jhԤ~$4t&t PFF1ۃ W=؁^_[]Ë$4t(9As<+APQ$4 Ɔ)AP1Udoƃ WQ= VU f1ffffffVt$F N T$ RjvQPt$4jjv3/0$;F,u L$1;N0t^fffffffUSWVl$4\$8|$0EhW{SjU4?AO1҉1D$L$nffffff.l$ D$aL$8)9=uD$0l$ |D$FE8@uခu L$4BeL$4D$$4SPVu _D$D$$SPVjNlj|$t$ L$?G|$t$D$$WSVU$tL!1҉D$\$8l$4C9BDD$tD^_[]8TuJD$0D$$D$SjUWSVUxD$08u1u@USWV,T$Dt$Hl$@D$ L$D$$D$ l$PVQR2t} 1҃\$11|D$DL$lD$D$T$ 4SPUVtrLET$ L$ut$HG9suL$DE4l$@B t$H@fD$D$SPUjT$ t$Hl$@NL$G9)t$H1ҋL$DF9Bt D$DDЃ,^_[]USWVL$D$t7t$1f.\?;\$ s,?(V>tG9r^_[]@SWVL$D$t-T$\r|r \t9΍vr^_[USWVt$l$|$OD OVwEEωօuf.=w)O|!$? ]Ef.ǁu!:u 8$=w0I|3 ]$? ?ˀ]EO=DI8] ?ˀ]$? ?ˀ]EE^_[]fWVL$ 11t|ffff. @XCw#u#q!ցux B@qu@^_fUSWVT$D$ t$$ $Nffff.JxFʅSk<$uIDu. ˁ? υuT ˁZ݁??  ˉ߅'فutju`D$Bub???  NjD$!N8| $$$$^_[]ËD$$fff.SVPt$4$Qu@IFtuy@tg t4t*t tu5fff.IFBffff.tu JIF}1^[ffffff.SVL$tsT$ 1y7@t_ t(ttt u-IBr FtuNIB}u1^[fffff.USWV \$ |$$$Ƌ$9u-f|+t,+$Ƌ/$9t19D 1 ^_[]USWV \$(1tjt$ l$$$}NjE$p9u8|t29t.$JNjD$$$9E9t19D 1 ^_[]ffff.USWV t$ >tI\$$;tB1D.$Nj+$9u|+mu~vu1 ^_[]ff.kff.WVPt$t~$HGu^_@WVPt$t~$HGu^_@+ff.USWVD$0H-E19WЃ w01 1Z9ӃЃWЃ r܉مHȃ-Eȉ^_[]fDUSWVD$x-E/EЃ w=1 1ffff.Z/ӃЃUЃ r܃-ƺŅڄDDӉ^_[]WVPt$$1f<$Gu^_@ D$t$[ USWV l$$\$ 1ffff.D==r$Z fD 4D$(8=r$59u|=u 9tD1 ^_[]Ðffffff.ffffff.ff. =thhԤrà fffffSWVt$|$Ɔ& fdž$ t1G1110È$ % & Gu^_[f.SWV|$ t$$$+4$\D$t$$-f( f* LJ, t2F11fҋ11f, f. FuՃ^_[fffff.Vt$$*dždž( eG!dž, sR^D$ǀfǀ$ ƀ& MÐSD$t,D$D>$D$<>>L$4D$,jjj Py>PD$d>HD$\>8>@L$TD$L>X>`D$ L$>hD$>pD$$$t+D$$CD$CD$ L$K$t<1@T LA0 uD$Tj Pwt($  L$8WhQPV2~ D$4j PPwl^_[]fSWV0|$@t$D GD$ D$\$ jjjjPjS] GfnL$fnT$f`fafnD$f`faf`faffnL$f`faffnT$ f`faffnL$$f`faffnT$(f`faffnL$,f`fafffo2 f 2 fpffpffpfpfbfpNffpff~OuQG\$ jjjjSj PW D$(GD$ G~D$~L$fO fG0^_[ÐUSWV |$ 1<$YsG1$D$uG$D$}uG($D$huG8$D$Su_<$rGL$D$+uGT$D$uGd$D$uGt$D$t_x$r$D$t$D$t$D$t$D$t$"r$D$Wt$D$At$D$+t$D$t1$q1$D$s$D$ s4$D$s8$D$ sX$D$ sx$2q$D$gs$D$ Qs$D$;s$D$ %s$D$ s$p $D$r$D$ r<$D$r@$D$ r`$D$ r$&p$D$[r$D$ Er$D$/r$D$ r$D$ r $vLJLJLJD$D$<$ɳ ^_[]Íƍ $ $ x$ $ {ƅuOsƅuƉ$p)߃ff.$( ăT$ 111fȉ݉0 B߉u$ % & 1) Py  D$W7PWj f( f* dž, \$ L$ 11fD11Auf, f. eD$PV%R P$PUQV 6 $L $L $L $L P$,PUQV0hD$P\mh$PDm ^_[]@USWV\$D$$l$@D$DD$@,$6+,$&Ɖu(=@2 ,$ơfnfnfbfpDfofofofofofofs0fs8fs fs(fsfsfofsʈ(02 fnfp( 2 fo5P2 (WffWff(WffWfffo-2 fffffgfgfgfD$]\$,$D$yt$ ,$t$艝$ t$ BD$$$ Ĭ^_[]DUSWV$h3 h3 ]ƅt)VjU$蔦ǃ V֭9D$,D$( t$4VN) V$Ɖ膫‰=1ۃL$ T$|$JD$fo=02 fnfnfoP2 fo@2 $fbft$fn<fpfofofffL$0fo 2 fofofffofofpd$Df$ff\$fD$Pfo`2 fT$pfrf$foft$@f$ffl$`fo\$fofofrfrffffrfof$fffbfjfo$fofoffpNfpNffofffofffofjfbfofoffpNWfofWffpNffoffofjfofbfffpN׈fofpNffo$fofffoffofb-2 fj52 foWd$@߈W\$ffpNffoffof\$PffpNffofo$ffol$0fo52 ψ($WL$pfffWfL$`fffgfoT$pffot$@fgfo p2 fgfo\$!fofffffffofoD$Pfl$0fol$`ffX9Ӊ֋L$ T$tQ,\$É΃8֋T$ ؋\$L$ D։$1@T$C9uD$^_[]ÐWV|$ G$D$fG$D$fG($D$fG8$D$f^_AfƉ<$7f4$/ffffffWV|$ G$D$tfG $D$ afG@$D$NfGD$D$ ;fGd$D$ (f^_eƉ<$e4$蜰ffffUSWV |$$t$ 9GʼnL$)͋N)9v5@ UǃUt$ WIYvt$)։9s*t_Vt$ R t$ G~+Gt$ tTUt$ RA1t P>F#t$ L$|$1ҍ )tPQW诧^ ^_[]ffD$xtfo 2 fo 3 fo3 fo%3 fffofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvffffffff.USWVPl$ \$D$u1f 8t GN039u)3A׉$Ë3%33$33%3؉3wD$ ))t.D$Lfffff.A03Mu؃^_[]VL$D$t)T$ fffff.2BƉIpu^fo4 L$fo 4 fo%04 fo-@4 ffofoff54 ffvfpϱffsfofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffoffffnffff.USWV L$@T$8D$4|$<1ffff./4$t/ E0334$N9uW) L$ $t/l$9L$Gtt$33S\$ȉމt$4|$׋D$34 %33 343D$3343343\$3333;\$=L$<L$L$ˋL$ t7 $ff. C033Fu߃ ^_[]fff=tfo 2 fo 3 fo3 fo%3 ff.fofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffff.3 3 3 3 3 3 3 lfffffVfo4 fo 4 fo%04 fo-@4 ffDfofoff54 ffvfpϱffsfofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffofffffofsffvfpffoffffof.3 33 33 33 33 33 33 3^ffffffD$@@ @@@@@@D$@@@@ffffff.L$D$AA AAAAA@USWV T$ \$$ztjjB)9)ȉ߃ǃWRFWRPQƋD$ (WUpD__;t5SR衟OGSPQRw ؉މB1 ^_[]fff.SWVt$t+|$\$VSCCVWP s^_[fDL$A;As PQ 1DL$QB;As Q1ÐVL$1Qr;qs Q^ÐUSWVL$1ҋqAn9s9^<7Y119Ÿs9|$$|00\0 (1q |$ ڋ$ ^_[]USWVD$($HX9ˉL$D$(C111D$fDT$(|$4$1ZT$||$  EE|$4$|$ IIy?w;\$[$r$ $1ҋ$^_[]ffffff.WVt$ L$1V9v!61<y |@9r1@^_fUSWV L$ l$(\$$yA)9BtVPSL$09s)UjSPq ^_[]fffff.WVP|$t$D$OTq;WsVPQ舺wVjP^_DVL$1yr-D$qEPRjK^fffff. T$JrQPjЃ ffffff.USWV D$,L$$);l$(sY111|$|$$t$n/|$ 4714$ EEt$|$<$IIy;l$(rD$,11 ^_[]fffffD$@@@ USWVL$8t$E ^_[]fff.VD$L$ Pu&T$(p,2P rp P@Pʈ^USWV(|$LD$H1ҾD$tD$|$T?97l$\$|$PD$ D$B;T$Ds;T$Ts D$@mыl$Ll$<ft MD$H 0FME<,<D<l9F$D$H0+|$DƉ+D$T9D$ G)v9ʼnD$F݃l$l$PDl$@D$D$ 9GD$9F)|;|$v|$Pl9D$ |$,D$)|$:1fnT8fn8f`f`fafafrfrT\9|$uƋD$;D$4$9smD$H|$P0F D$RfF9sJD$H7|7 NjD$P<%f9sD$H|$P0FD$D$|$LB;T$TM]s9D$TNɋL$PE(^_[]fD$ff. hht$g fffffUSWV @$(@$$@$ @<$KMÃr$$$@\$<$D$:t~D$ <$D$D$e$$@$ D$\$$CƃtuPD$ \$$Š$$@ #/\\ ED$ $eubt <$Tt_|$ D$ $9D$D$ \$$5u\D$ \$$όt1u<$$@exD$ \$$uD$ \$$臌u$$@<$褨lj$蚨uxD$<$襟‰4$$D$<$6 @^_[]fDUSWV ֊T$ ffffff.O?t-*t1 9tԃ.t׃\t҃.tuO_.uv/*u"4$D$.蛊uG4$D$.胊txt-Ή$D$+ GunD$.,$PtST$ t/ffffff.ى<$u1~vu1 ^_[]ðɰty#|$ tl$<$Ɗ l$<$WVP|$t$Gf^jhʚ;PQx$ D$ PelHHANH NHN HNNHN@F jhʚ;w7}F^_Ð D$Hf^jhʚ;QRWV4|$Dt$@GD$GD$ G D$GD$GHD$D$D$D$($蠅ʚ;GjL {V4^_ffff.ʚ;L$d$jL {Qf D$jjdp0+Vdkt$dL$d$ ։q^@L$Qf^ff.jLL$ D$T$ {HSWVD$ Hf^jhʚ;QR蘅D$ D$P脈HPxp @  ` ȃ^_[USWVP?L$MT$|$\$l$ D$$D$D$0$ʚ;jL {V<^_[]fUSWV L$ I f^jhʚ;QP}D$ D$PiplH xXhF|$,tcD$jhʚ;D$(p0L$苂Pt$SWt$VUh4 t$Pt$P04t$,hp5 t$0lSWQVUh5 t$@t$@谂 ^_[]DUSWV\|$tWD$$D$ )D$tt1ۍl$fffff.$蘖t%rC@wDW LJЉCuƸl$L$$T$ \$|$D$u 1111wL$0T$4\$8l$<Dt$@D$DD$0D$P$ʚ;t$pjL {V\^_[]f.USWV |$$tp1D$@$1膕wB$P4 iŀQD$/iD$#k<D$l$$htDtCЋuD$D$$ʚ;t$d$׺6eĉ)t$ jL {V ^_[]ffffff.Vt$D$$\ʚ;d$jL {V^fffff.D$T$L$ Jfffff.[ff.VL$t15Q°kd9ui9^fffffUSWV \$ CCCC <$k4$|$Y,$K$~C|$0 {lj<${t$0 {lj<${xCǃǃC,C8CPCLCXCTǃǃǃǃC\fǃƃCHCDfǃ$CaC]ChCdǃǃǃǃǃǃǃǃǃClCpǃC(ǃǃfǃǃǃǃǃǃǃ ^_[]D$<$}D$D$D$ D$,$q4$iD$$]t$~D$$ffff.D$@ǀǀ@,@8@P@L@X@Tǀǀǀǀ@\fǀƀ@H@Dfǀ$@a@]@h@dǀǀǀǀǀǀǀǀǀ@l@pǀ@(ǀǀfǀǀǀǀǀǀǀD$ǀǀƀWVPt$~tt<$ M<$b{~xt<$L<$K{F|t$|~(t<$}<$%{$$ $~Ft$l|^_fDUSWV |$ T$(!9ՃMD1WO)9C݅u^9uGGPLG^O`ƀQLWhRUR05PƀQLWO)uHOSQt$0w_-G 9BUw$t$0wo$)o !Ӄt)‰Vt$,P蠀Ght Pt W肩 ^_[]Ë)9BG|SPt$0wt90"G`T$$)݋URPQÃDWVP|$T$OG)9CtGVPt$ vG19uG11G^_ff.SWV$\_d*LtJt$hjV菓|$jjW[uD$dVjWh5 wD@@;tMD@pUlUE0^_[fff.WV|$ Ght;$ƅt*c$L$%,c^_ffffff.USWV\$0l$8|$4$t؃ŃUWst^PSdD$ T$Dt0L$8<9ʃ}ںʺM‰ƃVWsd踼tVWt$^}ChT$u {l8<9ڃ}'\$0Klt7Spt0SRQt$d@D$)<\$08E P)Kh AD$SL$QPt$ChD$@f)葥^_[]fffffff.USWVD$8l$0\$4ǃ%D1D$D$fE`},D$ u0u4t$@ru0E0t$MTUX)‰MTUX &tD$%jUt$)Of.UTMX9ȃL…Vt*%Dt9}L$ƍ )΅NƋL$  QPgE`VSPQ}_L$ El5EȀ VSt$z1D$E`+]L}P}\}L$ *T$L$Rt$WSD$ vT$L$Lu:;t2t$t$WSpUlUB t!%t t$ t$wFd^_ffff.VhZ$"]t$h$D$t$8\ fnD$fp$D$D$,8\ D$08\ D$48\ D$<D$8D$DD$@D$LD$HD$TD$PD$`D$\D$Xt$.*h^fDL$D$t!u!8w-@Ãtu8u@Ã8 t@Vt$ D$$D$D$4$ $2$: 8D$$:  F$V $D$D$* \ f t$jt$ USWV\$p$x F~ $t8\ fnfpD$`D$p8\ D$t8\ D$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$XDŽ$\$\ l$dUN(VW PsZhUP|8\ fnfpD$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$PD$LD$Hl$ D$P'~ t\^_[]Éً$$|D$X SPUWQ(1 |$XtF ;tF fff.Vt$ D$$L$(L$D$4$`$0$: D$$: HF$CT$D$D$* Y fWVd$x$t$p8\ |$`fn‰<$fpD$hD$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$d%T$W|$$D$_z8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$ %Fd^_fUSWV\$p~ $x$tS$Vl$\$D$l$Py8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$Pl$#É<$D$;.uF 1ۉ؁\^_[]@WVd$p~ $t8\ |$`fn<$fpD$dD$t8\ D$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$D$`"R$$U|$$D$w8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$4"$8+$: D$$: |>wF$rO$D$D$* $U VX $d $h $XL$t$PhVS8\ fnfpD$\D$l8\ D$p8\ D$t8\ D$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$X t$dV O PShVPxu8\ fnfpD$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$PD$LD$Ht$ D$P X ^DWVd$x$t$p8\ |$`fn‰<$fpD$hD$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$L$`DŽ$D$dBMN$kQ|$$D$s8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|${FM~d^_@ t$jt$ WVd$x$t$p8\ |$`fn‰<$fpD$hD$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dr}L$O|$$D$q8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$ Fd^_fWVd$x$t$p8\ |$`fn‰<$fpD$hD$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dJ$M|$$D$Op8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$ Fd^_fVXD$dt$`8\ fnL$fp $D$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HD$@> tFX^ffff.VXL$d8\ D$ht$`fnfpD$D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PL$L$D$HD$ $> tFX^ffff.\L$d8\ D$hfnfpD$D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X!L$L$D$PD$ $=Ԥw Ԥؤ\WVt$$|$ u u^_Åt!t$:  D$$: t$<$.$E0$D$D$* xK D ޤ$: 製$k@s $IVD$L$ATEVj'HVjH^ Ft( PItt$t$P!l1 @ XF fVt$CF0^ffffffD$D D$t$kH Vt$>u$E^WVPt$|$FGFGFN O GF t?PWJ#NN$w< DG~ F ^_ffffff.USWVXL$pAm|$l$(; G=KW7T$1҃1$n_t9 $t9rffff.U\$xсy) x U9rOA=Qw1ҍF9GD$ L$ t$)T$1ҍ \$0$DD$1ff.9raL$\$\ 4L$\$)Ή)L)ߋ\$L)މL9t$9\$O9͋L$ OƋt$*<$C9r1T$D$0RDT$1D9rgL$t <2L$t$)ω)щLt$+t$L+|$L9|$|$|$9t$O9ϋL$ O֋t$*C9r$T$D1҉D$@9r[D$L((4 L$D$)Ɖ)щL+|$L+t$Lt$9t$9O9ȋL$ O֋t$*$C(9rt$ A9T$0L T1T119rnG=1XO1҉ȁD$4AGD$^_L$ D$ʀ +L$!SWVD$ |$\$+L$ ƃ7҉  7D7 L7"D7L7"T7ӈ\7^_[fffffffVt$=u ^f1fffff.; @=uUSWV1D; 4I1ʈ     ʃIэ ։σ҉Iэ<Չ҉Iω11111و        1    @    =F^_[]ÐUSWV,L$Lt$@tt uS  T$H~1fffff.:G9l, (uL$P\$DtaFAF AF AF AF AF AFAFAFA FA FA FA FA FAFAFF FFFD$ 4$D$u4$,^_[]fUSWVTD$lL$h1@yD$(O|$0@L$D$ HL$D$(111)D$DD$hH(@L$4D$8;l$4$L$DBӉT$ 4)9G1ɸރrXt$<։|$@$,t$ T$4<1f.D D 9u;D$<|$@t?4$ǍTt$ D$8E< ^;l$<}|@1ڹ4$DыL$h;l$I}|$099~|$09 D$D$ 1ø)D$DG\$HD$LD$hÍC([D$4\$8D\$|$T$ 4$l$P2; \$2< D2; |$TD$2; D$Td$2; |$d$\$t$Hff.2\\2||2DD2ddB9|T Dd\l|2; T 2; 2; TD2; d\|fT$HfD2DD2dd2\\2||Bu4|'T$Lt$2^^2~~2FF2&&Ju4$9 D$ tT$ Affff.T$ 1f.;l$4$L$DB<)9G1߃r`|$<׉l$@|$ 2$\53,$ߋ<3<33<͉|$<$3<%33$3<T$335t$Bt$$fff.3n3T$3~L$t$3N\$$,L$T$3,%33, $͋ 3 3\$(\$3 Ƌ$33ڋ\$L$3T$($,$4343t$3T$J fL$,$T$@<$f3]43}(3M,3E0\$<$ fn \$\$ ։t$fd$f`faT$$$|$ t$fnfl$fnfD$ fnf`ft$fafr|$f`fafffD$@frffoXftfًt$T$L$ foIfoP,^_[]ffffWVPD$|$1Gt% h&ƃhjV*w ^_ffff. D$xu@ t$D( ËD$HL$ʃHD$P  +H@WVPt$|$F t~u$'~ F^_fUSWV\D$|l$xL$puUD$tE8@8E0@0E(@(E @ E@E@EMH9Eˋq|$ {D$(ES[ MD$,D$ ʉ1!1ٍyZ1!1ً\$,ˉ]ى yZ]\$$ˉ]1!1yZ} |$0ω} 1!1>yZut$8ΉuƉ1!1Ɖ0yZut$ Ήu։1!1։2yZUT$ ʉUʉ1!1ʉyZ‰L$M1!1L$4ɉMىыT$1 yZU T$DʉU |$!1ډyZU$\$HT$ʉU$‰D$1!1‰yZE(T$D$@ȉE(t$1!1׋T$HyZE,D$ȉE,1#t$1yZG04$D$ȉG0ȋL$L$1!1ȉyZO4D$L$ɉO4ыT$1!1yZ1!NjF81߉D$<‰D$HF8t$@<yZD$LȉD$ËD$(1!1Ӊ3D$DyZ1!3D$13D$$ʼnD$(D$,݉+yZ3D$1!13D$<3D$0ƉD$,މ3yZӉ1!ËD$$13D$@3D$L3D$8D$$ى yZ1!ËD$013D$3D$ 3D$(ljD$0߉;yZωD$PD$81|$T1ˋL$ 3D$13D$,‰D$8D$Pډn1ËD$ T$13D$3D$43D$$ƉD$ D$<މ3n1ljD$1L$n|$ t$x3|$H1ЋT$41ȋL$3|$03|$|$ ʼn(n$l$ (> > 1H > @P4 0 p  fhjPG > (> > GH > @PG0 1Xp CuƆD Ɔ<^_[fUSWV D$ H'D$ hffffff.D$ @L$l$0)9SUP0Q@1҃P @x@8@p@0@h@(@`@ @X@@P@@@HHH)߉DfWUPL$l$ ^_[]USWV D$ H'D$ hffffff.D$ @L$l$0)9SUPQ@1҃Pr@x@8@p@0@h@(@`@ @X@@P@@@HHH)߉DfWUP8L$l$ ^_[]USWV$$$D$ H ])9NH L$Q$P1ffffff.iL$H @T$f)E9VSPCuEQ@1҃PUL$E@x@8@p@0@h@(@`@ @X@@P@@@HHHE)EWDWSP}L$$AD$$D$D$ )D$rP \$E1l$1ffff.t$$iD$ @\0L$ L,t(ʍD(rPh L 詒,L$׉D$L$@|$0L$@|$)9UWPpQ@1҃P@x@8@p@0@h@(@`@ @X@@P@@@HHH)뉆DfSWPL$D$t$$Fw+D$ l$$\$@9_ffff.$\$l$L t PD$ށt%D$L$ )H كVQPD$ƉH Č^_[]fff.USWV $ 1ffff.H )@@Ci H |$L$@)G9SUPcGQ@1҃PWL$G@x@8@p@0@h@(@`@ @X@@P@@@HHH)މZiVUP7|$L$T c$ G@ @1@L$ t )0 9SVPP$ @ $ 8 Q@1҃$ P0 $ ދ0 @x@8@p@0@h@(@`@ @X@@P@@@HHH@ )݉@ (&fDUVP$0@ @ L$A$$ ^_[]fWVPω֋ArQQ@1҃PP@QRPQt@)ƒRjQBHNHNH N HNHNHN@F^_SWVB8(< D$8B0D$0B(D$(B D$ BD$BD$JL$$ofD$@fp9oHfL$P)T$`fnfnZfn``fbfnfbflfp9fo > f%= fpԓfT$pfD> > > > fnfnfn,> > > fbfn> fn<> fbfn,> flffffpNfofrfrffffofrfr ffn> fpNffp9fbfn> fbflfn,> ffp֓ffofrfrffpfffofrfrffn > fpӓfn> fbfn > fbflfnfffn4ffofrfrffffofrfr ffn ffbfn fbflfffpNfofrfrffoffpffofrfrffp9fp9fpNfpɓf\$@fd$pfL$`fT$Po ohff ~\$pL$PflffXĀ^_[ffffL$D$Qw@Ãu8@ O@Ȁ@,@t@~%@ 2@v?C@WVL$ 1t'T$:tut uu A;B^_1uuoAoJftf=uoAoJ1ftfɁtfffff.D$@@ @WVt$ ~ t<$踄<$F$D$ Ft$D$T Ft$^_É$ifDSWVt$ |$$F6$T ك?)?)? )? )? )?( $)?0 $(,)?8(,04)?@0 4 8 < F\$(>ttuF$FBÉF^_[ffff.USWV l$ \$(|$$EtAt\urEvou uk h/ƃjV_u ECESWPWEEuSWuWVEEt u ML P SWQ^_[]Éǃ V$ W DUSWV\ $p $t  ttt%gHJuHщJGX1|$L,ڃ<9ߍ ,, ,,t5h+P(+,+, @v)89ߍ9@999$8 $< $@ $D t1h0 P@ $H D $L $P H h SPc$t PW\\ ^_[]fffff.L$19uAffffff.WV$t$8|$Wt$<t VW@$t(L$41tut uuD$;A$^_1uuoD$oIftf=uoD$oI1ftfɁtfffffffSWVp$$<$1J%$O4$D$D$G\$p<$D$\$$p4$D$|$|$$8\ fnD$fp$D$D$$8\ D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XD$Pt$$Ԥ荙D$ $ԤY.8\ fnfpD$tDŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$pt$pfD$`4$foD$`4$fD$pf$fDŽ$DŽ$f$f$DŽ$\D$ $Ԥ(1ۉ؁p^_[f.USWV $ $( $$ uO9BWVPy3Bكl$SPUPD WVUM ^_[]ffffff.USWV$$$hWVD$\PWj8\ 0fnfpD$D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PX\$D$Ht$ D$P hԤ蠖jhԤn t$| ǃ $ƃvƍvi$ vL$pxi$ thQPvD$txwt.hUPļ^_[]USWV$$$hVSRD$\PVj8\ 0fnfpD$D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PXl$D$H\$ D$P hԤjhԤ辕ļ^_[]à t$|TDž# $ƅ 7à 6rLD$XxCQRv7St$6S[ƅJjPjh? jjjjU% "8\ 0fnfpD$D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PXl$D$H\$ D$Pi hԤYjhԤ'dffffff.USWVl$$$lD$L$$D$l$<$m<$HDt$l)͉D$4$l$D,l<$3h4$0Džo$4$DD$hGl$D$$l$8\ 0fnD$fp$D$ D$08\ D$48\ D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`\\$D$Xt$込D$ $Ԥ芒D$h4$D$C-<$ 8\ fnfpD$ D$08\ D$48\ D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`Z|4$? 8\ fnfpD$ D$08\ D$48\ D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`[0L$\$D$XD$ $|D$$ԤHl^_[]ffff.USWV\$t$p\$\D$\$<$ vt3v,$t@xwu@vwt*w,$mt @x vBxx$L$D$58\ 0fnD$fp$D$D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X\t$D$P|$D$ !,$8\ fnfpD$D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XZ|,$8\ fnfpD$D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X[0L$t$D$PD$ $ԸD$$Ԥ蠎\^_[]DSWV00$@0$4(hSV* $4 hWS!=8\ fnfpD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H]D$@4$ D$ PϷjhԤ蝍$D0Ƅ0 ǃ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$$ DŽ$ D$jPV"$ @ hSW 00^_[USWV$8$4$0 t$ hVPx  Vt&M <L 98}WjjSKRfnE fpDP $tDžT ؃P \$SjSpVD$$PSh PS jjUj$PX VD$$PWn S,^_[]Éƃ S VB ffffff. D$tD$ ut$ Pà fffff.ffffff.VD$t^Àtt$ u卆xh? P@uʃt$ V^ D$t'D$ uvtt$ P}à D ff.USWVL@$`@4$1=$d@|$t$D$<$,$ƅtt$l$<$1ۅDދD$$h@t11D;us%M;u$E9G؋DFuօۉt"lfff.E$ru<$6|9$(@t$ffffff.$6td$ CC CCC4$D$D$$%@tt 4$AtO9w$h@Ë$`@slj<$zD$|$ t$$D$؁L@^_[]1ff.USWVL@$d@$t1$l@1ۉ,$$h@D$fKE.ttHf.}.}u׋E$u}u…tE$tD$멃|$4$=X$L t$D$$$XH 9$( f$ftjD$EEE EEE$D$D$*t$% $$ 9w$d@u$`@ǁ@,$Åt*\$l$4$utF$u'T$99 ˉ؁L@^_[]f.SWVϋ1w.uHG$<uÃ?.\$u*.u$G$uÀ|$tCFB1ۀ|$u7-ff.$tt$nu1^_[USWV ($0($(( \vVh St$hVSN VuL\$jh> S)jh> ShSSt $hUV$ 1ۅufffff.FʀҀsCffffff.u܍$1p҃sAu9ua$ (LU\UT$WP$8(1% 854tdUv1ۉ؁ (^_[]Ãt$UV$0(h19uD, $$(|UD$j|UU= VPVUt$UUUDÃPt$U@P$hPV_-$ 1ۅ$,( f.FʀҀsCu더$1p҃sAu9$ (t}\$h> S$0(LU\UWPUR U e<5U$0(PV@ $Sg %<5SUPVNffff.USWVL$`OփPjS. S:|$PhWSWV+$h$d UU$?E E?t UVjhʚ;RP&D$ SUD$ Ct SVjhʚ;RPƉt$ hPWjuUf88\ fnfpD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H^D$@$ D$ P蹪8\ fnfpD$D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H$D$@\$ D$ PjhԤ1L^_[]fffffUSWV\$0k$CC CCC,$Yt$4tAlAǃpAǃtAD$s ǃdǃh!C$@C$D$@D$WǃPƃiA$jljl$<$4L%D$<$:^_[]ÉƉ<$ƋlA;D$t$,$]t$4$8DWVP|$<$Lt4$74$GGt$8lAtA9t$ G$$\t$^_ÍlAƉ $G$$f\<$C4$vSWVt$ ~tD11f.L8t $@68$D8$C;^rʅt$FFFD$@D$$^_[SWV@ $P ƇhAG %t ddDŽ$$ DŽ$ DŽ$, DŽ$( DŽ$4 DŽ$0 $D$t$蚑tY\$f\$4$D$\xt $ $ G t$D$$AuG g+gDŽ$`DŽ$`DŽ$`tU@ PoƋgg $`$`$`)t9UPV(DŽ$`DŽ$`11퉜$`1$$`h$`D$$UD L$dQt$@Ut$DP$`WUjt$TuL04$1ۀU U;D$XuU1;L$\t$d!foD$@$ $h DŽ$x 8\ DŽ$| 8\ @@ @@@@@@$@ D$ DŽ$ $` $@DŽ$ $d $l PVD$j hԤa11foD$@$ $h DŽ$x 8\ DŽ$| 8\ @@ @@@@@@$@ D$ DŽ$ $` $@DŽ$ $d $l P{gȃ P4{ WzSjhԤ`1ɉȁĜ^_[]à jjjjjjjjQJ0D$|$PuPdƃhA1D$`d1 D$t$dt V7 V苹ۋ$4$t|$Ptt>I$@ǃ $l P VɉL$,D$0|$PW$M$;h!D$` D$$P L$` <u:LU L$ljPpUlUQht$ƃ WdiD$`d1 |$dt Wz Wl V ffff.USWV `$(`$$`t$ PhVUD$@hVWۿ$ hUV¿WUEtA Wt;ShWWUu̓$4`D$PVX$4`V$8`>`^_[]USWV t$ \$0|$,l$(F t\$l$<$r@\$<$D$F @t3@$04$u4$u \$<$t$ N wrD$$$`? T$:\$D$<$T\$<$D$S\$<$D$?T\$<$D$(<$\$<$TN (((D؉$æƅt*,$赦9rt$l$$追|$,t$ N %Xu#du$:t 1ۃEu1ۋF du,$/L$0D$L$ D$0l$D$<$ݽ$cƄ_u#G$(ƿwt G:?__u{/G/lD$uD$u |׸9G)lE$u}|$,t$  ^_[]fffff.SVTt$d052 tȀ45 À0t$lVhԤ-[8\ fnfpD$ D$8\ D$ 8\ D$$8\ D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P$D$Ht$ D$Ps؃T^[SWVPt$`\$l|$hF hd!D$dU h\B 3WP9F x hB  P>tuRhhԤBEF gSPWj{u$1"gSPWj{tF ƀ*P^_[ø8\ fnfpf$fD$fD$DD$@fD$0fD$ D$H D$ Pr1Ɔd!ff.USWVl $ $ C tSO. h@ UP9 h? Ph 9| 1ɀ$ h!85QV V\ts V Pt'C  85VLU L$tjPpUlUQhVjs %0C OPjVC 1ɀ85QV 8 VftO058\ o0fnfpD$lD$|8\ DŽ$8\ DŽ$8\ f$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$tDŽ$l$h D$tP3phVD$tP護jVOfo$D$h,$D$$D$48\ D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`#l$D$D$Xt$ D$$Po Vt( Vu P)t $ C t $ ,iA$ t@lAQPV[C OPjVRC 1ɀ85QV $8\ fnfpD$pDŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$L$hDŽ$t$l D$tP n hԤBj hԤCe!uVC Ou> h, ^VP!5 h? APh 5ƃe!Ujh2VWs fC LUDʍTUDӁ\UDWRQVl ^_[]fDUSWVl $ $ F %EtXtP;E/"$ h!LU T$jt$VpUlURhVUPP0|$ $ X0VShԤN Vt} VE Pta8\ fnfpfD$`fD$pfDŽ$DŽ$f$f$DŽ$b D$lPk V 8\ fnfpD$dD$t8\ D$x8\ D$|8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$tDŽ$\$` l$lUjhVU$ njVE u%iAt@lAQPVE OPjV jt$$ pUlUD$'PhVWu &08\ fnD$`fpD$D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X#\$D$D$Pt$ D$PiVShԤdK1ۉ؁l ^_[]fUSWV $ t$lVjUVhj虝ƅu hԤ:11f.hVD$lP/Džjjjj$ $ USUh WV$ 뜋$ $ XtE(11t5$ 譜u D5G9rҋ$ $ ShԤr;$ 8\ fnfpD$ D$8\ fD$PD$$D$ D$,D$(D$4D$0D$<D$8D$DD$H4$\$D$@|$ |$ WgfoD$PD$D$8\ D$8\ D$8\ D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@4$ W+g1ۃ D$lP؁Ĝ ^_[]ót݃ V:ωËD5L5 ‰σT5|5 $  $ xWStc$ @jWQЃt$ @jjjQЃ$ Nj t0蕗D0jW$ jSD$lPDžt V' D$lP WK USWV D$$ƅu $Ԥs6\$(l$$ )ËD$ t$D$$Dž~&9M~ҋD$ |$t$$.#볅t4$p ^_[]Džt4$X<$萘ffffff D$t$+ fffSWV|$ GOD$$9ȉGvmW t.9v*T$D$8* $ԤB$Ԥv5GO\ 9G؋L$$还ƅu $Ԥ=57_^_[ÐUSWVL$`2t L^_[]Ë$d*ƅ2ۉD$$h$l~fփP tƃ ƃ h PWaEj$lq1UP jjSsUu dždžD$ %h W腗DŽ$LAt ƅAL$ƅƅƅTM0hQP自1ۃ h C U*4Ex4jjQUP jjjjU UƉT$ hCΎXxǀ, ǀ( ǀ4 ǀ0 ǀ< ǀ8 ǀD ǀ@ ǀL ǀH WPD$ ( D$jU Ot$Wy $XAW`tY $U9L$ $L!jjhhPhWUQ\0à U^$`tWU&8\ fnE0fp$DŽ$$8\ DŽ$,DŽ$(DŽ$4DŽ$0DŽ$<DŽ$8DŽ$DDŽ$@DŽ$LDŽ$P$$ DŽ$H$ $P` hԤ5 U<j hԤz2}0Wjht%8\ fnfp$ DŽ$8\ DŽ$ 8\ DŽ$$8\ DŽ$,DŽ$(DŽ$4DŽ$0DŽ$<DŽ$8DŽ$DDŽ$@DŽ$LDŽ$PDŽ$H$ $P_$d8 DPU_ƅfDžDžDž4Dž4Dž4Dž4Dž4DžpDžlh|$ W$Vy|$PhV輷hh4)9s ~fևl@4 $Uztlp11 u1x$ UP;lpxu`<uPl$@!PQhU[guhhԤ0$@!tuƇlD$ jjdt$(S8\ D$T$fnfpfD$ fff.Ɔ UƉՁ'|DD$ 8XjjdS1W1诊 t9Ɖ|;t$l$$  j.ffoD$ $`!f$@!f$P!f@$@ f@fDŽ$! $L!P\t$$xut$ $D!PhUeuhhԤ.$@!ƅlphh)u2T$ Gڃ1$`$d8\ $fnfpfD$ D$ƀ jjhhjhVWt$40foD$ $`!$D!DŽ$T!8\ DŽ$X!8\ DŽ$\!8\ @@ @@@@@@$@ D$DŽ$!DŽ$!$@! $L!PZD$xut$ $D!PhV$duj hԤ,$@!D$fnfnȉڍqL$ fbfpDՉfofoffo0. foo fofffofffvfpfpǠfoffpfo=0. ffofffoffffofffvfpfpfpfffffofUfo0. fo|$ 9fofofffofvfffpfpfpffffffofpNfffofvfffpfpfpffffffpf~f~t%D4|9ΉL΋t$ LE9rL$L$D$@T$t$$`*11T$t$0D$ D$<1f.\$0l$ l$߉l$4|$89Љ|$\$0‰ƉˉL$fffff.T$SVD$D@$l N+|$l$ljظ|hL$ T$ 9ЉL$  ىu|$ L$D$t$L$|$ l$ \$0;t$T$h fD|$ l$ |$ l$ D$L$t$|$ ;T$4T$8T$$`1ںʺLLЉt$T$$`1HL_0@D t? t9jjQP^VWRPR@ Pŝu 1C1ɃfoC T$P@B uq jjjjWy t' uLJ4 jjjjWI jjjjW5 D$p0W  hDC ƀt hC 8\ t$PV]$ht@ WЃ$hQǃT ǃP fǃ s WD4t,D$@ts W)8< jjSsW< D$Ou hC (SPD$Ƈ2t PB t$賄"ǃ U NjL$t P t$c W D<$ hhE UD$DhPU|hh0E Uf$D!hSW轛h+ W u.h+ Wuh W Wƃ$PahVSS))QUV7hSW赛$PAhWV $`ThVPahUWdhh+ WN9D@0AfDUSWV<|$PL$XD$T*ʉƁ uG0 Pʼn19ͽLL良8< DȃQWA@<8\$(D$1n*111T$8l$t$ t$ l$D$41fD|$|$ \$\$\$,T$0ڃ9|$ ωT$‰ʼnΉL$f.T$$VUD$<@D$\ +\$8|$Éظ|qL$T$9ىЉL$ u\$L$D$$l$L$\$|$t$ ;l$T$ k)f\$|$fD\$|$D$$L$t$ l$;T$,T$0|$P8<\$1)ً\$(8< WP8<)։8<4t>@t5jW?8<t8<19|LJ<LJ8<^_[]USWV,@$@@$D@**5D$XxDY …D$JB tD$l t$1 h ED$VQP߈8\ fnE0fp$0 DŽ$@ 8\ DŽ$D 8\ DŽ$L DŽ$H DŽ$T DŽ$P DŽ$\ DŽ$X DŽ$d DŽ$` DŽ$l DŽ$p $( G(DŽ$h $, $4 PNt$ D$1ҊT$$|$ D$ E UP|$D$T$t$L@Tu0 u't"t U UɑE UP }0$, hWS`1PhS袦D$|$thS0WD$t$EWSUPG$L@|$@w8s.$L@TD tD Dȃ QWPWjhjUBD$ t$88\ fnfpD$,D$<8\ D$@8\ D$D8\ D$LD$HD$TD$PD$\D$XD$dD$`D$lD$p9D$h|$( D$4PELjhԤC|$$VU 1ۉD$ ff.|$t$D@ǀǀuGht$$D$4SQjhS螤EWSUPD$ uit$u $4 P^xuh$4 VTtcEWVUP'jt$$t$EWVUPD$ D$\$t$8\ fn$( fpD$,D$<8\ D$@8\ D$D8\ D$LD$HD$TD$PD$\D$XD$dD$`D$lD$pED$hD$( D$4P7JEWt$$UPEjSVUP12 UNL$ $H@*u6 UdE+dUhUjQRUPL$tUD$OuH hD 9<5QPL$D$Lu hDB L$|$tzu $D@1~P $D@fpDFLψUV dždžD$%h V}؁,@^_[]òQhD$0PVDRffffffUSWV,$@1%Tu %AË%D$4$0hPU3*t$Tg\$H$D$DD$0T$L11 1ۈD$1D$8T$PhK uG hG 5 h0L PhK u h(I E3 |$~(tWh: Č* D$\ ʁD$ X Á u$jh(B PZ$jRQP複$jPT P 膇~|$u. .IDȍD$LQhL jPSm F$ .IADSDL$CD˨ DL$HDӨDD˨RDÃ\$TPQW|$,RUt$,t$4h U jSl0 D$Pjh(B P2l--E@dESL$LrD1ۉL$J-E@ɍ\sDݨ w\$rDڨ\$ wDډ\$1D\sDߨ߻rDڨDt ЃtRUSWt$,t$4t$(Qt$4hU jD$|Pk0|$ tt3D$(j hL Pht/D$(j hM PKD$(j hM P5\ X T P 螨L$$Ph(M j Q k$*8 $<Pj2QUStI hL WPh 4$`4$D$> `}\$4$D$foD$L$x$ $$DŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$;D$xDŽ$\$|0$@\$D$$w$@|$xD$<$D$x<$踀<$`Ɖ$`=މ\$<$D$Mx$@<$D$$@D$|$$Ԥ@E$`ƅ;1|@^_[]^8$@, 1۸8\ L$(fnD$H $fpD$4D$D8\ @@ @@@@@@$@ D$pV|$(D$,8\ D$h\$0#/1C$@|$D$Ɖ4$vdž(  $跴  $$@ Ƈ 4$D$ 4$bt4$D$ b$@<$D$D$DSWV`$t$pƆ, \$dhSWπ$xt-D$PSjb_t-]8, 1D$PSjuauӋD$  ㉆  D$, RQPSihWV'udž(  L  腳 `^_[ËL$D$AASWVt$ ~^;u$>P~;u$P>P~;u$ >P~;u$=P&^_[SWVD$$\$ CCC$sƉsC$` {C$K sC$6 C^_[f.D$DD$D D$8t$\ fff.USWV |$ t$$9trt D$ $D\ D$R,,$XL$tD(X7$Ԥ1ۉ؃ ^_[]f.USWV |$ hjP](U ȉPkT)RD$R)ڍD ؉T\L$1ɉU GGU G 1GG \`dhG$lptxfG(|ƇT19؈D*Au ^_[]ffff.SWVt$ |$$у%tlQt\L>)ˍ IT) |9t#K9T)Ӎ+P @19~A)ʉ\T)ȉT)Ɔ4$0^_[ËD$ǀJǀHǀPǀLUSWV |$ phjPO[JD$LKhjP,[J@K(U ȉKkT)RD$R)ڍD 艇KDKKL$HK1LJJLJJ fLJJƇJJLJJX\`dLJJhlptfLJJx|ƇJƇ>KƇJJ1ۃ9؈>KAudЃOЉlHK;DKtHKPH?LKt LKjt$PHd@`=KLKt LKEJDKRDK;HKv#Jk‰DKQt$HATlH1҉hƇq Dp‹pƄpDŽu֍ 1fffff.^V 1@)fT)fT)fT)fT)fT)fT)f)fT)uF送u1 PfD?fL=u@@uփ ^_[]à jRdh hpP8X j[Rdh hpPXfff.USWV t$ D$$Ɔp d V+{fdžpƆzdžvdžrhjP^WfdžpƆrO1ۍipDDBudžt džp dž| džx dž dž dž dž dž dž dž dž dž dž dž dž hjP]VƆC ^_[]ff.USWV,D$Dt$@T.FD$;Vt@fff.BfD$D$BfBBD$BD$fBR;Vu̍E|$D1ɉD$Bl$t$fB)Ã`ȉL$ BfDmDBD$ D$i\$ \YfY:YvFqy|$(ωt$$f~f~ >~|$@;wt:^~w|$$>^~t$|$()HuD$ xt l$@ED$1ɍ@DBfffff.A8@t)l$@EP)f9fEueul$DߊVNf.(|$G=JLKLK\$|$@TGWO|$D@)fL$A9u]JJ]8LKt+L$ @LKPSVlNL$؉YJJ)@J7J9u)HKIHK7J)э4RJʋLKLK]T,^_[]USWVl$0t$8D$4HDžtJDž|JJ L$@| ˍFVUUUىЍ@؍D)ƄɈL$|${fDžpƅzDžvDžrD$D$$lGfDžpƅrN1ۍypDDBu㍅ Džt Džp Dž| Džx Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž D$D$$eFƅCH^_[]fff.USWV,|$@HK9K91Tht$ p r D$iq AYmT$D$(p \$\$\$/o4BxJ1҃ |Js +tJ\$|J|JT$r TtJt$$T$9T$T4ЋT$L$AE LJJJ؍fT$ JƇq BhJY99|$ $T|JJD$$TD$tJD$JtE Jt$(JJ)ŋD$D$f( LJJ@?V \LJXp 7pƇq LJT(3L$D$ T$ T$)΅҉ tr*` B9KPH#DxJJ$ xJtJ|J|JtJ1rw %룋KH`@99K0A9Xt݉`H|$$eD$ L$0L$ )ʋT$$ Z<$Pp u%pƇp D$D$$BtJ|JA@xJJ$٭ xJtJ|J|JtJ1rw%A`H,^_[]fff.SWVt$~t211ffffff. 8Q0 CJ;^r^_[ffff.USWV<|$TD$P,t GD$#O0G,wGQPt$VRv#tGO$W9~ ƇJLJJO 4Dt$ JD$9t$Nt$$;T$$|l;T$u G;G;T$| Jx;J|3kfffff.D$\fD-fJJq9v] JIPJAu hԤ)JD$JWffffff.JL$h@JD$OG $);\4s-)ȍ_ƃ։wGqNw&L$T;\8rNv FL$Tƃ։ʹrB)+\0\t;_0Cٍ_ T$\$\$ wFL$ iy_AR@fA\Jff.r(|$T,$=D$,Pt$t$\&D$ L$D$(fDD$,DJJQ IJT$4fTT$0Tfff.,$W $‹,1)L$)ЃL$Ɖ,$|$TwWD$ @D$ D$\Wowx-*)%;,)|-G|1Ή_w|$TDT5); s<)ȍWŃoGffff.MwYL$T;$rFMv:KL$T;,KvEL$TŃιnF)+`;CэW1w L$FfQL$FtLr uw $ $‹<)+L$ω $)Ѓ $|$TGWL$ r1\C $) $|))% ׋T$)эD͋|$T $oG)); s3)|$TȉOGW";O$L$T;OvCߋL$T͹]u)+,8-;,CG|9(wUGt8)Ϲ)|$TՉƒډWG|$TD$L$flwG<$$|$TOG$+)L;CЍW*L$Ɓ@D$ D$f\tW;T$$;T$ eƇJ<^_[]@USWVu~ t ~t1$@5F $D$@D$ 9~AFJEPXBPX@‰$4Džۉ]OiEȕ$1ۉMED$D$<DŽJJ9]u֋}EMGL$$D$V8]EKJ<0u<f.GKJ<0u D0A$ 27}tu:f.$ԤuiEȕN $D$D$7^_[]ÅۉEt9ffff.Jt$54$ Ju؉<$5E$7fUSWV,$@$D UPU?MEt ɍJ1@FBJ9r选L$$H(H @E0hJL$(QP31111D$D$E Ϲ@)ك؃QPuڽffffff.~4},E @)ك؃QPu落y@c9[D$L$M1JD$fu$> |>t:D$\>D>D> >>4>4L$}E L$Ѓ>$PQ DŽ>(DŽ>$+$D>L$T$D>Ƅ>4Ƅ>LiJT>D> >D>$>8QPU>>IL$u Z$ƅZ>8D$u=} D$D>T$$>DAD$)x,=|%>HuEt$J9Ɖ$L$-$1D$%D$D$D$D$ L$D$Mt$1҉ǃtp1l$(L$D$@iJ)B9Bσ|$EMuPR2!ffff.Uh^rL$9w|$ $Lp¹1D$D$@x7J,7u.l$ UP7J$@l$tUPtv7JN7JucD7(uL$JA;L$L$n$L$t$@)ց 9T7$@l$T7i щl$))URt$3D7 $@+D7D7D7$D7 C |$D7D7tXCl$$JJL$hJt$ P{,CL$\$JJD$Ƅ7JD$$D$ȋ$@$ Hx,1ۅt3E ƒVRP)21҉ 1!Ep U EiL$Jt$$T(VDL D0NhJPt$,+<^_[]fff.SWV\$t$uwhJjP0FXFTF`F\FhFdFtFpFl@=@B#0KFHFFdžLLdžHLF|FxdždždždždžPƆXƆ@džLdžHdžDhpjP/Wh?jP/ƆYhjP~/dždžTdždžt-1 t Q+G9rdžt,1fD t Q+G9r܄džuƆZ^_[USWV\$8l$4|$0C }GxH9MO)x)@|%~Gt$$L$.Gwx=u 1*W)Ɖt$‰ $T$wOx~OxO|Wt T29NщW|E,$؃D$,$Ɖ,$D$1 t$ٍG1ۉt$A Fq,$D$,$D$G1,$UƃЃEOEUuҋL$\$|$8/1ˉ111ӀZt11L$0GDʋJ|9NL$B|$GO^_[]ff.USWVD$4JVJt$0INDL$\$ fff.Vp0K!)щVpt4!w* V ȍ~ŃՉnFeMw;|8rMvEعŃ)ՉnF+|0|t;~0C~ rfS=lD$,Pt$l$\U}H r U}H rEHEp}t)T$,1WtL$؋4))щL$)L$֋t$TNFl$P}ht$ WUVUG|$|$L$NF+)L;CЍV*ŁfD$P‹B\B`BTJXJ\BXjTZhUSUuVƆJe^USWV,t$@Ft~HNpnD8KD$1ۉ|$$l$ )F$!щD$L$L$ D$V(L$8$L$H|$9)耾8L|$$tu$<$x F <$D$@1ۉ؃ ^_[]fUSWVt$0~H r4$~H rFHVpFtL$4nD)u Y1Y!9ӈA !YI,$D$L$D$NHFDD$L$LD^_[]fff.USWV\$4t$0É4$D$Buddž`Wdž\WdžhWdždWdžpWdžlWdžXW5džW džWdžWdž|WdžTWdžtWdžxWFxFY)ND$L$$͛Nx~NxN|Ft D9NF|tFtfoV fo V f.foffqfFRRFRNFRPfFRTuRTRURPD$D$$|$\$1Fp)s<#L$<$D$覛4KVpT$D$ $苛ƆELT$L$<$rE^_[]DD$|$udǀ`Wǀ\WǀhWǀdWǀpWǀlWǀXW5ǀW ǀWǀWǀ|WǀTWǀtWǀxW@xÐWVPt$NxF)xI)=@|#~NȃWPQDF~xu 1+1SF)ȃRP6ȖNx~NxN|Vt T:9NщV|^_WVfoV D$ fo V ffoffqfHRRHRNHRPfHRTuRTRURPD$D$ $t$|$^_DUSWV |$ _$Ɓs$D$j12ؽf.94,\ kvl$$6(\ ))4X wRR@TWRVńRVuORRRVl$\$wRR@TWRVńRVtORRfwRRfORR ^_[]fWVPt$~pFt9tƆFL4K)s5#PQRvp4K6ƆELWQRʗFpFt^_ff.USWVl$0u4$XWÉt$D$vr'sO4$D$1`^rg4$D$q19Y wvD$t$$BY )ÍY ){6rf4$D$19Y ~vD$|$$Y )ÍZ  rh }4$D$19,\ ~vD$|$$b(\ )ÍX sU4$D$01lf9L\ ~vD$|$$H\ )Í Y >fD9HY ~vD$|$$DY )ÍxY )tWt"Eǁ|$FDž-H'pWHpW||Wu DžtWXW)ȉXWW=WrDžWѭWUp}SL4KrupEp@!AEpufDUSWVl$0DžpWW=WrDžWѭWdW}<$D$ƋdW|$ zr'sH<$D$1a@rssz<$D$U1@94(X _vD$ \$$"$X |$ ))4XX sU<$D$sfD94X _vD$ \$$X |$ ))4X 0fffff.AtAΉ<$D$sdWt$)ȉdW<$rË\W=)r!sH<$D$%1e=rq <$D$19,\ wvD$ t$$(\ |$ )ÍX se<$D$1|fffff.9L\ wvD$ t$$RH\ |$ )Í Y >f9HY wvD$ t$$DY |$ )ÍxY )\W)ȉ\WuRPC RU„ۈ RUuUt$RPRUf|$t$D$ERPC RU„ۈ RUt̋|$ t$ERPfuRPfERP<$[Ɖ<$D$ މ T$hWt.t)u;Wv tAA)ЋT$hW;WB BºwXW) Fу|$@CщWMdQUd\TedEh]l)MpA!HMpuۃ^_[]USWVl$0EDžpWD$$,xWuwD$D$$rOEhMl)MpA!@MpufDUSWVD$L$)@A5ffffff.USWV T$ rF9Bx@tpBj<0)iH L$ X;W)ȉXʼnBj{\BZ<0)ٸ;sl)ȉ:É؃BZz A\$w]D$W;fffff.w(D$$ܦƃu$SD$ <L$D$$lD$ L$D$$X-D$ L$D$t$D$,$ļ^_[]ÐUSWVl$0MpEt҉L$)1!t$\L$t$ffffff.4o~t F`)#|$;|$LV9L$T$uT$|$T$ %QPU L$}p)ωD$ !ljȋT$9,|$  !ǍG|$ 9s>4K)ȉT$RPjt$詍W|$4Kt$ W葍4KRPj|$WvHLFN,PẂV0v4T$t P:CL$;f.Nj,9M9U}Rt$j\$S辌HLEM,PSE0U4D$t) P~ f.GL$;B ߉߉Rt$ uTUƅFLHLLLMpD$ L$)T$!ыL$C9uƃt$ VUs EpEt^_[]Ë9s닕f4t ~tFC9rUSWV\$0Ș,$wtYD$tu_,$Wǃt7uO',$?ƃt,$0ǃtu&1,$}ǃT1ǃG $GljD$_ƅu$Ԥf11f,$踂t(C9rD$|$ t$D$D$0$,$3}D$01ۅǀTt4$؃^_[]ÉDžt4$<$fffff.SVD$ HpP1)fx&ӃHPY1^[BуHPƀY^[IfUSWV|$0_oW+)уփȉwWŀt"uC3F)щwW܃.3)щwWu1OÃC GÃPju hԤe1D$ Wx1\$D$CD$Gffff.J9||)xg=@|#~OȃVPQGwx)WPR7#NWx~‰WxJO|;l$sua1;l$r@GOw)L$ <)EȋL$Gw9BQt$Vt$WR t$ 1ۅt VX؃^_[]É t$ Džt V4 Wh DUSWV<\$Pl$\D$X|$TǃǃBՉD$T$ $\,${t$ x4$#Džt8O9;l$0D$L$,ǃǃt'1D t $F9rǃt,1f. t $kF9rǃl$01D$D$,$8D$8蔽9C4Cuu t$4,$D$6$8TL$@4@D$(uDt$8JD$S 4$8D$,DEt$4{ D$(D$Pt$ tv11҉|$\$$fDӋ<4)41ҋ1<tE9r҅tl$ \$$|$t$PAt$ \$$|$= r $i $D$5t$P)Љ,$踃L$T@DFpL# uT$,1;:s L$8 t$PKD$ $jCFpNt)u1 #9CCCC,C CC(t$ CC$D$TtW4$莘ʼn4$D$\un @f;|$4l4$蝂ōE=w;D$\1ɉȃ<^_[]É|$ރ<$d|$u4$ICh4$3C[4$C N4$C$@A4$C(f44$ہC,;|$4) \$$$GʼnD$:Åu$Ԥ^11@=w\4$ $;4$D$ٖG9rԋD$(@L$0D$ l$\$ $$轾\$$D$(@C$蘾 ƅt$}4$fWVPD$t$uKdždžt#1 t $諼G9rdžt,1f. t $kG9rdž^_USWVT$8\$4L$09tƁFL)sƁEL8L!D$08KHLLLL$T$D$ t$USQD$D$0T$L$ ~‰Ѓ؉FVmfffff.|$,l$ fD^9}H9F;z WUV* t$0WUVu Hffffff.;rqHveD$))ʋL$$@|)~FÃWSPD$D$8=1@Ѓ)؉FV+l$ ;C~ |$w28LNp4KQVpfffff.r|$c>ˁD$Nx~T$ |$T$T$(T$$t T9Nщ`Np4~hD$ 8LHThpT$T$)fff.HL$\$!؃PR$UV $D$ hpE!OhpD$uLtDPJDTuFV $NTL$-<);\-)>-ʉՃō~1nV |$<);s2)>ʉу~N $VMw$f.;MvMBff.;`-'MvT$9w49w*9w 9w9w 19v D$ )9CЉfff.SWVt$LLHLGދ9.D$8t4K8Lt18Lʼn$l\$ \$$D$D$舠tW4uQL$0D$ ~ʍ@jp4KD$ML$D$L$C!M#t$19v݋|$0t$4Kt$C\$ 4KCrNuJ4Kt$LJ4K8K\$$Ƈ8LK^_[]$d$D$ D$pş f T$#wLL$D$$(W 8Lu4QP蜥À8LuQPÀ8Lt- ÃxrQLu 8Lt"QPÃQP[ÃQPzgfffUSWV D$ ;t1щ׉T$T$@t3DًQyOL$f|0fyuԉF&u9tsfDqލ[uJf.[|w.\l]ߋTjfy[tfI9uL$9QqVQrqrUҁF׉2L【ǀLʍƀ [)ލL\0)T9t TNK)֍pu鋆JJ^_[]ffUSWV l$ t$$MX)uAD$t]o+1)9Ջl$ <m,$,,i1;,$19Ѝ r lLL)ŃL$fll$ J1]p $k8.ptS;l$( t@$ψ.pJuĉJD$JJJfD$ XT$$JJJt&ff.o8.ptoJuJT$JwJuf"BBD$TCD$ f@{}r VPCCp lh ^_[]fffUSWV<|$PTHh1΃HQJuA< Aȃ`urB8tKfff.8X@uP:Pr/PfT$T$PfPPT$PT$fP@Prw Pf`trKl$QKK;KL$L$\$tl9L$rPjW] D$`tfHD$ H}PjW( TAPHeMTL$HHD$ HD$)HHL$ 19P)KL$L$P9@J)L$t$81\$0)ڃT$4D$,ML$u3JLKtZLKff.q΋U7J7J8É\$(FAJDKRDK;HKv%Jk‰DKQt$:fMfHMEHrx ff.ɈHɋ\D$,T$$LKtLKuZJDK I DK;HKv+T$PJkщDKPt$L9Dž.vPt$,VWJD$PT$(LKLKL$}T$0}1 69э 499 ͍HfEJT$4L$844v9s#1919fÍ|2fD<41ۍ<994R19Tҋ\$t$L$fUE[CtP P|$PLPf]D$ m;(cD$HP|$PE W-9Ƈp <^_[]fffffWVPt$N~x))t,FWQPݔF~xu5FFxF)QP6[Vx~‰VxV|Nt D9N‰F|1 FQV^_ffffUSWVD$0|$41XJxJh|J+tJ1҉|J9U9}R1ɉJ9؋D$0q hTUf@}r WP<LJJ1Tt%Ƈq L$ M]49~ED$ EC1ۉ؃^_[]ËT$0)DEY49~iAl$ iJJT$0TfBt$ :vAfD$D$EfAED$fED$ET>}XWR;FD$ p r Jp pD$0)ЉXLJT1p @7pu鋇JJfffUSWV $ $$Xȉl$)uA $~$ oR1)9Í Y1$ v9r Í 19\LL) $f\$ J\$T$ 1ɋvp Dn8/pt$ 9n2HuӋt$1ΉJxJ|J+tJ1҉|Jl$9<9}t$ V9}u1JJ$ $D$ )ffffff.$ 9p EpuJfXl$fff.$ 9uV 9~މJJ$$ FKw)Ku$f#$ˋ,$È]$  $YTfE8}r WU8p lh1 ^_[]fffffffUSWVl$t$$L$ Up)994K, kpil$D*T$)f\Z\Z\Z\Z\Z\Z\ZwL$<$)uDt{f4K!@7UpB!IUpuHt@t7XZr,XZt$XZrXZtXZr@B^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$8* $Ԥr8$Ԥ+GO\ 9G؋ L$$]ƅu $Ԥ*7_^_[fffffffUSWV$0$4THɋxtl$D$l$ ~trN$8u-uAӋTA8t 8P@uΉڋH9u$95ENu΍D$9ʼnD$uF\19KF\$8t 8X@u^@C)ˍL9v[ۍD1H9ظGJD$L$|$ffff.HK];DKt?HKL$fHL$HxpCtLL$9u?fDLKtLKuσjt$ .|$(u1^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$8* $Ԥ5$Ԥ(GO\ 9G؋ L$$݋ƅu $Ԥ[(7_^_[fffffffSWV|$ GOD$$9ȉGvmW t.9v*T$D$8* $ԤR5$Ԥ'GO\ 9G؋L$$?ƅu $Ԥ'7_^_[ÐUSWV t$ D$(|$$f l$8jUWSQA u.L$0t&ftf jUWSV 41 ^_[]@USWV `$ `jj$4` D$ Uf$@hSUMWf S触ǃ 7x$$`tt1$,`u+fthhC Sɝ$,`t\ SctL|$uhD$ P$4`|$4`D$ PS4@jjSlj?*uJ w謥t6DŽ$ .DŽ$ /hV$ Pw$ $4`PWuhSU1 `^_[]f.USWV f$ W豐\$hSW蛒tk$$ S褄ƅt|$LD$|$$|$LD$ |$$|$LD$(|$$D$|$$L$@؈D$|$$L$@؈zD$$|$$zL$@؈\D$|$$\L$@؈>D$ |$$>L$@؈ D$(|$$ L$@؈@.#,^_[]ff.SWVL$T$ tz92s11  t"Z9:s u T$ t#Z9:s   tZ9:suku^T$ tZ9:su5t6 tZ9:su t1^_[DUSWVT$D$5 u1/|$؉11 ŋl$t 9ʉ| 11 9 ^_[]fWVL$ ff   uu ug uY uK11 u231 u9uyuy u ]^_@USWV D$4t$$l$ t |$8t ~(f jjWSP] usft#1ۍf jjWPQ1 tGtD$0tWUu*H 8 @ RQPUuF$Et 1 ^_[]Ê t}u} t Eۉ|$u$\ X ‰΁ (f U U行Džt\$,ffffff.St$ Wu/F UaDžu@8} Y)\$(tt$ WǓD$4t$D$ FD$ RD$ ^D$ ht$Sv,$7t$wt$wD$t$wD$t$wD$t$ywD$ $yf.Vt$4$(fdž%dž(Ffdž%dž%fdž%$f$贁f$要HӃ)T$a LJh,$D$D$x 蔕uE} E E4$艉9u4$载`  t$D$$蛀Eu$-}UT4$視XE$耖Vw$|^ Ƈ}$h Bl$$$@9 D$$Ԥ E$Ӄ#C$<] LJpLJlTl$<$D$<$D$%Ƈx`}l$u+aEu${4$D$D$i $FV$_ T$ U L -Ƈ^,}E EȉL$<$D$~5Ƈ`)<$D$D$p: ~ E$藔BwC'LJ<Ƈt$D$D$D$D$ D$,$D$=$z4$D$D$h 7]1}-@0H@LJh1}%u0$P0ǁpǁlhhƁ%D$4D$02111D$,D$( $ytP L$,ŋD$( J΃й l$0Jt$4$T0T$,?.D؋D$(DO{ L$,t$(Ɖ߉,$peD\$,+$] T$(195 H5 X5@ 4D$4D$0|,1D$(|,E$9R ,$5@ƇwƇkcLJdTLJ,$d9LJh*u4$őr8$h l$$R$@9 FD$$Ԥ4$D$:ft^$c=|>$h *l$$$@9 D$$Ԥn$$WE 0t - 1} " 8\ fnD$0fp$D$8D$H8\ D$L8\ D$TD$PD$\D$XD$dD$`D$lD$hD$tD$xdl$0D$pD$4R 2@E 0t - 1}  8\ fnD$0fp$D$8D$H8\ D$L8\ D$TD$PD$\D$XD$dD$`D$lD$hD$tD$xdl$0D$pD$4R 1D h gD$ D$$|$N:$@9  EЃ8m Eb -LJLJLJLJ LJ,LJ8LJDLJPLJ\LJhLJtLJLJLJLJLJ u4$OG ,$`D$ G6K5G 0E$SY } O Ƈ)C }E $8 D$$EȉL$w$8  ǘg|$($D$;cƅt+{.D$L E<$at|$|$0D$<$#w |$ |$0D$\ D$<$a_D$(|$$ls .d_ E$%H@|? LJ@0 LJ@! u 1$蠌Vt Du G  EuEG1$dVt Du G Eu 7 $P0D$4D$0 LJ<r LJ4c LJ4T ƇH EӃ$c LJƇE$褋A Ƈ @LJ4 Ƈ LJ/LJ Ǽ}E$ JE21~ LJo E-u } $FǨ Ƈ2 E$轊StRILJH Ƈ](ƇLJdLJd( Ƈ<$D$ <<$D$ PLJ|uLJ|f<$D$ l$D$B<$D$ l$D$<$l$5 ƇƇzƇƇ 4$D$D$ D$D$諂ƇyLJTE$ $4a T\TP}Ep: E$?o!,$,E$o,$1}- T$GHe1 wG 1 7$nt&,$ƃDE$rnu1}:]t$(u5$Snt'$ׇD$,$6nuk D$,E$莇w,$@d 1 -t +u1҃+E])ыl$(t$,݉mƇǨl$<$D$pD@4,$φƉ,$D$ [߅D@D,$莆Ɖ,$D$ Z߅DDLJ,$4$D$D$< 资4$D$L -z4$D$\ WƇKG G =@G v$$h l$$qG @=~1========LJLJLJHyƇmLJ)LJLJLJƇ%,$D$:NZ $+======EHσ$d LJ$h  l$$$@9 D$$ԤQE }1ۉ$ȃw"$a $P0$h l$$F$@9 :D$$Ԥt1D$(>D$4D$01D$(LJ7LJ(fffff.SWV$ ~RDžtt<$PCt2 $GD$ Wƅu$Ԥ1\$t$<$Ww|$ t$<$7Ƈ%t4$S^_[ÉDžt4$S<$U@USWV t$$jjVoÅt}l$ ff.) PODžtPSWVtoƅt9?-uPUw W SjjV;oÅu ^_[]f.USWV, \$\S9]jjjjjjSh< ( F$@%|$ \$Pffff. Saƅu f 6Seuj hX V<}uF$PU?tjWD$P`h|$ t$m~ǃ t$ \~O w.$sRD$t uVuD$D$Ph j $SJP SPǃWSV~|PUD$Pt PMQ,^_[] ƋD$Pt P Q VTS Vt$$h \t$$ $@9 D$$Ԥ^ff.SWV|$$$ct<$D$D$QStI\$(1ffffff.$|VtDuf u1^_[@L$Q -Kw8\t|{PtjtbaHtPtHGt>t65t,t$# t@t@t u1A @SWV`\$x0t -1{D$t8\ fnL$fp $D$D$(8\ D$,8\ D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XdD$D$PD$R :)t$|#$zlj$D$ 8OޅD`^_[fDUSWV윑$%t%%tt$$t  Pt(F(F(Fu<$DƉD$%,$oƅ4$D$D$E xF$`,$ؠt$xl$D$4$c4$D$D$+ 0d4$蘠tNt$,$D$c8,$vt,$$袡t,$D$D$+ c$ D$Nu tN1)t$(ȉщ)tQPVT$mET$|$0D$Gl)ЉtPRU?ED$|t P7AD$ މ1yA ^_[]f>fffSWV|$GG hh=ƍ7_hjVD_G fƄ@u^_[ÐUSWV,|$@l$DG O)t @@Iu}7G  UA7@)9BQUV >=1Ƀfnfo@2 fo-02 fo= 2 ىfpfD$foP2 fot$@f$fo2 fofofo $fffffgfofffffo$fgoMfgfop2 f% fffffew9t))Kf0FOu,^_[]à L$A Q)tfff.@Jut$> L$A I)tffffff.@IuD$tL$tAHuSWV |$@D$8t$<9CPt$tt$$, Q^_[f.VD$t$tD D Eщ$Mt$$^fff.ffff. D$(L$, tQPt$,t$,mt$t$t$t$fmPh< Ð t$ t$ t$ t$ 8mPh< wWV$ FH`=6$@ >$p  $ PD$K $D$x>$D >$ >$ VL$ T$>$ $@9 $ Ϥ>$,8 m>$ _$$ r$ f$@9 Z>$ ->$X >$ 6$ >$ Q>$H >$ 56$H D$4$>$l >$ $\ $ ڣD$$$t 辣$@9 }6$ 6$ 6$ >$ &6$ 6$ >$ 6$ x$ 1N|$D$D$<$L$ b-N|$D$$L 6$ $0 ~$ r>$\ 賢N V$6$X $t j$ 肢:6$H 6$ 6$P >$ x$  >$ .N $| m$( $ $ 6$@ >$ ˡ}6$ >$ 訡ND$<$L$U$@9 I6$H 6$T 6$ $0 S $\ B>$ /D$<$L$ݽ>$ >$8 >$ NVT$ $$ ӠV NVD$ $T$L$ D$a$4 蕠k$ T>$ *>$ >$X >$  >$h JNL$D$<$~$ $ 6$ L$P $$ N $ $ ԟN $L$$@9 y$  訟VT$ q$x m$ 1$ t,$8 c$ R $ A$ 0$| N V$ $D $| $ N V$v(t$ $ О$ 连w$ b6$< $ K$H B$L w$| |4$ $ $ $D J$ .$ +L$D$$_$  VT$$h $躾$ԤD$6$ D$4$tw$ 覝a$ ~$d   Dȃ~  $Dn$L$0<$X$ JN L$$ ^_$  F $< D$$ C $ $̾$DB $ D$$t f.Vt$Vt$t$t ~ 1^1ffff. =\u(V+,"=[|$+V," Vt$$  <$$B ($^fff.Vt$$d t$$谼$ ԛ$|^ÐUSWV t$,\$0l$(|$$$ 蝛$e$\ 艛$1EM   ^_[]SVt$ \$$$@9  X Eȉ $ t$D$$̷$l $^[fff. D$ $ʚ fffWV|$ GG GG<$D$-G^_ÉƋt$&4$@(ffff.Vt$FFjV/-F^USWV \$ |$,1K D$(+t=ލYE] } QPj݁ЉىEemYrzL$l$1?1fffff.@9׉r|$,l$ pr'h` hԤjhԤL$))L$ff.pʀɀuшut$VUj\$ ЃED$${t4CΉL$ ރ0)9Ss"+SRS+C 0 ΅uHTS9rffffff. @K9rt$VUsrD$$tVUPht/ ^_[]fDSWVL$T$΃r,?@9ֺʉډr^_[SVP\$t$jV*NQV^[SVP\$t$jV*NQVNQV<^[DSWV\$t$jVJ*NQVNQV<Vz~NQV^_[USWV \$$l$(t$ jV)NQVNQV<Vz~NQVjV)NQVNQV<Vz~NQV ^_[]USWV t$(\$$ˀjD$,P )T$ D݋l$ JQUu ^_[]ÐUSWVD$@l$<|$8\$4f‰ ݃ˀt$L$ T$ D$jD$;l$$D$uFtit3;l$(u-|$ Ftct/;l$,u)Fu#Qˉu‹D$uΐ|$ ul l$@9It$Pt$Pl$|$ t$Pl$C DhQPWUSVQ\^_[]fUSWV T$$|$,HL$(p1t$49t$1@ׁ1݋;\$9A ;L$rƋ|$,@u%hjPǃ1҉ ^_[]1@tfUSWVD$ $@֋9u;u9I|܋$$$9JD$,$1ۃDÉD$,@D D$(D$ 9| C9} t񋬜19}OT$$1fffff.؋$tX;\$ }9tًT$$@$9OȋD$ )zJj |ju|]ȉT$$=|E$l$L$ t$|$|t%D$,T$$L$(9t $D$ D$ T$$$$91^_[]f.USWV,l$@1|$H\$L11TbD$ D$L$HD$)T$$UB|$|$ ,:l$D,(D$@#D$|$$l:D:D$DŽ:D:D:r|$usl$@D$,$ fl$@@aD$D$ $袚D$L$TbD$ DD$A9щL$+@aD$ $YP@aω$@;L$Hiffffff.@a$|$3L$P1i DmD$T$ |$ Tl$(|= +T$D|$ |$ T$=D=DD$$= 11ff.9s,|$ t%P)erL$ F L$ KL$PS9s.@T$EFKS8T$$x;*r|$ t@l$@9sD$h4$l$,fffff.L$|$x8hfff.fnӋ\$D$HT$t$ fff.fn\fn`fn,0f`f`f`fafafafffffgfgfgfgf`f`fofafafrfrffofrffffffffeD$fpN4$l$,ffpf;D$L$L$t  >|$f Vt$t L$ T$$L$T$fAL$T$T$ L$T$x@9etaD$L$ ffffff.\$] 3i iL3]ЋT$ DtFOuȃ\^_[]jWVSvlUSWVPt$ tVD$|$$fD ;]i iL;]Ћ$D|GNu̓^_[]DUSWV< $X $\ $P pp@EE1L$ 1ɉT$0$X Tb)C1҉|$ ʹ\$t$=GȅۻL$,$T <|$4L$T$11IL$()D$ $P !D$$$X )9\$(|$,$P L$$\$T$D|$ 9Btb4(L($T #L(щ|( +L$`bӉ\(dbӉ\(\$hbT(lb L(\(`C(Pt$(@aT$ d;\$6T$ $\ @a$\ t|bfDxb$P t$D$1|$8+D$D$ ffff.t$#D$4GD$ GDaG 6HaGLaGE`bCGo(G,O0Wt$8@aE49l$u @a~L$;$X < ^_[]fDUSWVD$8FL$0D$4LaDaHaD$1T$t$ L$f.L$0ʋL$4 8l8is'L81t8|8is'?1is'1is'1ߋ#sf\$\$T$T$0 \$\$4 T$0fqt$L$|$\$4L$f<H8D$($(,0,0ƇLEʉD$HƇ\|D|$t=D$Pu |$r|$ t$RWShD$P҉~^1f4l$T+H@# 1w |$TL$ щڍ_]Ӊʊl$ 9ˆl|$TuD$<8PWSUƇL<^_[]Ã|$C V6fff.USWVD$4L$01D$84@T$<t$ZډT$\$f.`;1au9)#ff.L2:L0vu9|D$=D$=D$=D$ƍ0Ń;t$|-r(t$ L$t T$tD$L$ 9OMƉL$ D$D$4L$0t$fDEL$}1T$ <8^_[]ffffff.USWV,l$DD$@EDžtDždDž`DžlDžh}ƅLƅ\DžTD$@hjWF$(Dž,Dž0|$EN1$D$ l$$"ffff.L$)މt$ ,4$)йT$=C@E!ȉ4+PaDa!2T$HaLa>t$ǁ!9B77!΋T$9B|T$)l$T$1l$$<$t$(T$$Dž<|$$DB;,|8\$|$Dž,u{D$8|uqD$T$:Tu`D$T$:TuO@|F$+T$#z|$w*;s"Dž<8$W|$D8\$t$ uvD$8|ulD$T$:Tu[@|R$+T$#B=w;<| 89s%Dž<8$P fff.8\$<\$uKFD$(8|uI@|@~*$Dž<)#8$A<| Dž,UW<1ۃD$|1au+ $98v $\uY|fffff.;@D$UW7fff.\t%UPM z}|$Dƅ\LtDHUWVƅL<$t6D$T$P8<TXƅ\FfDME QUT$TT$"UW<T$TEB9\t%UPM z}|$Dƅ\LtDHUWzƅL,^_[]Ã,^_[]ffffff.USWV,t$DF16Pt$t$LVt$L#<L$Lffff.)Ⱥ\$@L$=C‰@Vʉ|$!4T$dž<T$ 3L$@D$|$ L$(OL$$L$T͊l$ @t$(,#l$8,/l$ t$$14.ffffff.o9s >8 :trp;l$~jt$|$@+t$ #t$N;sKl$ |$ wtD$ w L$ t"L$Dl$8<l$ l$ |$ l$ [6|$|/D$@1aD$D8N;D$Df.t$DNF QVt$ tL$FA9D,^_[]fff.USWV8|$LT$P<L$ X4D$D$ \$$D$ȍ is'D$ L$L1is'L1is'L1is'T L$1#T$(T$1ff.D$ ى,|$0l$)#l$99ʉ :L$tDTis'1is'T1is'T1is'T1#;T$(:L$‰l$4 d$8$ +T$D$Pt$,#T$@D$<T$Dr:Du9|D$ 9PD$1ۃrhFL$1D$D$ D$D$@l$l$\$ 8! \$+\$)!!9؉w\$L$GD$݉L$;|$|L$|$)!E;D$0A \$\$$! |L$is'1is'|1is'|D1is'|$L1ȋL$ #D$(|A9}D$P89+D$D$rCA9@L$P;8D$ v+w}f|$L\$$TPD$P$l8<;@}i4+T$D$L$T$D$@l$t$ t$,l$#l$T$4NAD$ L$P;,~,8^_[]Ét$ ffff.USWV\\$t89`t 9dt9ht9lt;Tu 1\^_[]Ël$pSUtߋ D$tϋ4D$D$<t$HD$Px!ljD$ :L:l:|$8D$is'1is'L:1is'L:1is'<1ōD9L$$D$D$p!ʼnD$,l$(l$pD$@Ӊ\$ T$L;T$Xl$TiID$4l$@l$0l$L$DD$T$8L$<<1)#T$ 9;T$4T$<:D$tBLis't1is'L1is'L1is'1#t$,;t$(hD$0L$8 {ЋT$1)#D$ D$fDD$X8G:9u;|$T|x;|$$)T$1Ƀl$|$rSL$1,L$ :T$t$t$P!ˋ)!)!ʉ9wL$T$GΉ9|ʼnЋT$8L$)1#L$ ;L$Lyt$Hl$;|$4|$ y9\$;\$$9;\$Dm e\$#D$  TL$is'1is'T1is'TD1is'1ȋL$@#D$,)щD$(L$0|$\$ T$#|$ 1MfUSWV T$81< 48L$A|$ L$LL$@ IL|$~މt$D|$ t$f|$`Et$E>L$4; ;|$vL$41at$T$4)#@n;l$} T18T3t;l$ T$8L$4)wt w8u3T$ƒփŀT$8u^tZlL$ǁƒ ÃŀT$8utu#ffffff.@1 ^_[]ð D$P0f.USWVfffff.D$D$L#D$$ PD$D$(0t$0V fD$(@;A,^_[]USWV \$$|$ 1f.Nu􋏌bbbfDDb@b;br,$tOfffff.bbfDDb@b;br,$şFu ^_[]USWV L$ T$$Ɓ1aFL0ajt9BN9BƀELEƀ8L$tZ<$$8KML$!ȃPR L$ GMDKL$9<$sB<$t:4K$MD$D$AM!8t$ ƈ\J9 $sڋD$ $‹!|$(ȉ,aPa?D$ 1ɉ4$D$D$ T$$D$ D$ ltT|is'1is'?1is'1is'1ߋ\$#$#ËD$ (D$ fLul$ A;,a=bt^D$ 1틸ffffff. /]i iL/],L$ E;,arɃ ^_[]ÐVbt$4$+4$^fffff.D$L$bbfffff bD$$ܜ ffff bD$$茜 ffff D$P0f.USWV\$4t$0C{L$=ǃ|$_~11C4u\$4@u2hjPUD$0ǃsz1fffff.1Cu|$4@u2hjPշD$0LJOr191Gu\$4|$@uhjPgǃ1L$)ƸLƅD$ Q~gD$T$11AD$D$ D$D1ߋ\L;\$9B ;T$rЋ\$4|$@uhjU藶ǃ1҉t$ QD$9 t$0ffNtXtD$|$D$t<]~'tSVtC Xu#NXttWt$ V$$HhQPWt$SV<^_[]fff.USWV|$4 t^_[]Ëw\$01ɉD$3\$0|$4DŽwff.t$ w1ɉD$D$)#D$tt;slL$:5u@;|$ }:1DÍ 3D:D u CL;=w;L$ |ف:L$\$0A{|$4t$ ?9@u^G D$ G ,$W 1Ґ0)8 |$4t11҉݃t$ fo fo $ffɃobo*fofo fffvfffvffffuf9fpNffpff~t+fFÁA9rދt$ D$ ōGhjP~G@DNuZRfo fo ffɐoo ffffffffuffpNffpff~=D$ 119O L$ G ff.USWV |$$\$,ۍQT$(q1t$4t$1fffff.*1, ;l$9B ;T$rҋ|$$\$,@uhjPYLJ1҉ ^_[]1@tfUSWVt$$B$T$@Ѻ?3rd;$t_T. x(uR\.T.t.  $ 09L$0̃A$L$fDι?rd;$t_\$$L+P~|+ T+L+ 4$  9uL$gAL$t$$$0t$$@;l$|)t$$$0$0^޻0Ǹ ^_[]øffff.USWV$z@u @1ۋLFى$zLu 1ztɋ$L$Hȹ=BȅۉȉL$ t 1*~*D$ D$D$$$ȬD$ H1ɺ \$8D$@$ŋ$D$0D$ fff. ӉL$D$h4$l$,fffff.L$|$x8hfff.fnӋ\$D$HT$t$ fff.fn\fn`fn,0f`f`f`fafafafffffgfgfgfgf`f`fofafafrfrffofrffffffffeD$fpN4$l$,ffpf;D$>|$0$T$fF\L$ JL$ fJ $ L$ D$CH^_[]WV4t$@D$HL$Dt$L$ D$|$ Whp +Whp  D^_ffff.USWV$8$011ffff.$8 L$ )ȹ=C1ƸFt$T$ 1|$f$8)D$$0T$9ʼnC苄$4#GЉo+D$ , ʉW 0ʉW4O8GwWh T$F ; ]T$ $< <L$ |$$41)ύ|$$D$/#D$GD$G)G F,CGw G$Wh` L$ڻF(9u  T$;$8^_[]USWVT$(BJ49T$ fff.L$L$ T$|$T|\lis'is'?is'9T$T$ZfT$T$9L$ T$f_\$L$^\$@f^|$>IE^_[]ffff.USWVD$,L$(9T$$D$ D$$T$|$T | D l is'is'?is'%ՋT$$:\$\$Cf\$\$ :T$$f GD$  ^\$If^|$>HJ^_[]fUSWVPT$BJ49vk$,\is'lis'is'lis'l#I,$\@u^_[]USWVD$L$9vnT$,Tis'lis'is'lis'lՋT$#H Iu^_[]f.USWV\$0CS 9 k {sT$l$|$ {t$L$D|$$1ffffff.$l$TtL|is'is'?is'is'ӋT$#l$tt$l$ t$|@9u^_[]f.USWV\$0KC9k T$,{sD$l$|$ {t$L |$ $1ɐ$l$,D T t |  is'is'?is'is'ËD$#l$TT$l$ 4t$|A9u^_[]f. D$P0f.USWVP\$S$KsC t|D$1҉Nj<$C [$;);,$sT$TL|$ANuSffffff.\$:\=L=$$NuYtU|$S@,_f _Af(Nu+t'|$S, A(Nu^_[]@USWV,l$@EED$$eL$9L$f1҉|$L$}<$D$/  <$D$/ <$ĉD$/ <$D$/$D$<$/ff.T$!ȉeDž P!:\$ uEfW$w\$ !8>t|$JrDž |$uƒtۉ\$ u'D$ tqt$$)!99D$ vf!ʉe<$D$. <$D$.$<)|$|$!ʉT$ |$\$()!ρC|$1f;|$Ws,8|$!!>8.tl$@|$\$(Jt$ ;t$ $t$ <$t$-9u<$D$-e1@#eEe9L$D$$$W,^_[]USWVD$(t$ e"T$0"EML$F$5F(FF4V8N<|pt$$1_=t9tA9|DfDA=(x"NÉÈAaYA9|^_[]ffff.USWV\$D$|L$xT$tt$p@$"@(@4H8P<@x$E11\$H@$DjPSU;t$xt$L1111D$ D$D$ D$D$D$D$0D$,D$(D$@D$4l$L$F9l$@HD5t$$jPt$VPD$t$1ɋT$4t$$T$ |KT$4\,1t$)݉)ʉL)L)݉L9\$9O9Oˋ\$0$|$l$8(ى󋶸E >F9l$@ht$D5jPt$VO|$8T$41$T$ |KT$4\,1t$)݉)ʉL)L)݉L9\$9O9Oˋ\$0$l$8|$(ى󋶸E >G9ыT$4t$l$@|$f*jUt$V"OjPVOT$4D$$\`m$1t`\|^_[]Ël$tl,$hd`u% r1)ÉK\JT@USWV<|$TT$PLHF4L$ <1D$D$8HAD$(+8L$0DD$4L$)苉@D$)D$)L$,MD$L$ (D$$fT$ 1fL$4ču #L$ ;L$8l$0;l$,\$(l$P#\$ d:d L$ ,L$$ tD9T$urf9T$u rX9T$āÃC u?ffffff.|9|$r79T$t)/$fff.| 9L$vL$t$J9D$|$TT$PL$ )€\wT9X~LTtBJu =u = s=ǃ\ Tw\$TPO ~{|$TD:\t+WPO rwDƇ\T$PLt!DHWRT$`ƇLWRto\t!WPO rwDƇ\Lt$PtDHWVƇL8<WVL><H8D$($(,0,0ƇLEʉD$HƇ\|D|$t=D$Pu |$r|$ t$RWShD$P҉~^1f4l$T+H@# 1w |$TL$ щڍ_]Ӊʊl$ 9ˆl|$TuD$<8PWSUƇL<^_[]Ã|$C V6fff.USWVD$4L$01D$84@T$<t$ZډT$\$f.`;fu9)#ff.L2:L0vu9|D$=D$=D$=D$ƍ0Ń;t$|-r(t$ L$t T$tD$L$ 9OMƉL$ D$D$4L$0t$fDEL$}1T$ <8^_[]ffffff.USWVD$4l$0@ǀtǀdǀ`ǀlǀhD$ƀLƀ\ǀTD$xD$hjWbD$$|$(LJ,LJ0G1D$l$,L$)йT$=C@w!Ή4+!ʍ)T,|%%!9BӍ((!ȋL$9|$BË9|1\$ |$\$|$\$1LJ<\$|$|$fDC;,|\$ l$LJ,:\$\$l$8\)|$um\$\:\1u_\$\:\1uQ@|H+\$#kl$w-;s%LJ<8$]l$\$:\$uf\$8\u\\:\1uR@|I)#Sw4<| 89sLJ<8$Z D\$<:\$uAW:\9u9|D$9PL$ 1ۃrhB1D$D$$D$fff.l$l$L$$!4L$ +L$)!!9ˉw\$t$@L$ ݉t$;D$|ȋL$ t$)!E;D$0? \$\$(! tL$is'is'tis'tDis't$HȋL$#D$,|A9}D$L89+D$D$rEA9BL$L;8D$v-uDOft$H|$\$(TLD$L$l8<;@}e4׋+|$D$ L$|$D$|$L$ T$T$ L$#L$OQD$L$L;,~,4^_[]ÉT$ffff.USWV\l$t89`t 9dt9ht9lt;Tu 1\^_[]Ë\$pUStߋD$ D$tNj4t$HD$Px!ljD$\$$;L;T;|$(D$is'is'L;is'L;is'<D9L$,D$ D$p!‰D$4T$0T$pD$ @l$Ll$T$TQID$L$4; ;|$vL$4ft$T$4)#@n;l$} T18T3t;l$ T$8L$4)wt w8u3T$ƒփŀT$8u^tZlL$ǁƒ ÃŀT$8utu#ffffff.@1 ^_[]ð D$P0f.USWVGjjU,^_[]ÃwDž< wDž<Dž<f.USWV t$ \$$h@jFtfue9vOhjF hjoFPjRF^_[]Å1ۉL$T$,LT$is'lis'is'fjT$lis'lC#;er ZfSVP\$D$t$uSdž džefdžfƆdždžEdžEƆEdžH dždžfdžfdžEEPuQhjPDdžFt'Nf,HHuFFF(F4F@FLFXFdFpF|dždždždždždžƆdž dž^[fff.WVPt$  t$!Bt$Bt$At$At$At$AEt$AFt$AF t$AEt$UA,t$sAdž,0t$WAdž04t$;Adž48t$Adž8t$A$t$@ t%1D t $? G9r⋾t<$<$>@$<$E4$^_É$Jffff. D$$ >fL$D$ H ÐUSWV|$0l$8\$4@ÉD$PV;HPDP@P;Lr V=ۉt$h@j6Afue9hj@hj@Pj@t$T$ PE9Eu hԤ D$ T$ E$E0WVR2D$fD$T$ CC CCCCCC$C C,C(C4C0C<C8$ȉD$ D$($$#$ $L$0"e"ŋD$0D$fD$1D׍<5@D$(PETE|$ Ƅ0EDŽ`EdEhEl$J1҃t$ 1_=t9tFDf.F=(x"NÉÈFf^F9|$L$T$004L$(\$ DŽPE $DŽTEDŽ`EdEhEƄ0E4ED$11t$$ff.|$D$|D$0DjPt$8[D$ 9}>t$$1ɉfD$E(ш +\$ E9|ff.t$$׋D$@9u|$~D$0jPt$8W$ESx/R$L$4S0t$$PX S RS$L$0t$$P -$f QSL$0t$$P T$ $L$( `ED$ hE dE dE<9Es@\$ ӃWEX5Eu hԤEڋ\$ EуP3QW.D$>0D$4L$@ 0;(E$})~}$ 9EEsDT$ Q34u hԤ&$T$ 鉨E$$0WVR-$$эEM|$$D$E,E1t$ T$HL$G;D$L$ 0`E0dE 1D9iu+;u%C@;\$|9uXff.9C)/T$ωfffff.F8D$pF0D$hF(D$`F D$XFD$PFD$HNL$@D$8EME8F8E0F0E(F(E F EFENF@L$@D$8ML$HML$PML$XM L$`M(L$hM0L$pEM8ONj$L$G9?f@E1ɉD$ T$ȲL$ D$,EE~01ۉT$$9,Et C9| fT$D$ VO $EtLjjVo jjV_ DžEDžEƅE11%f1|$$1EyE,EL$$;EtCPUWET$ `E€@T$+e#wD$Gʍd$QUd$|$$t+D$L$lEdEdEKfff.T$lElED$dE9u\$.fL$\$dE L$PU|$ =0Ety=0EPjV v @t$(LEPL$|$$u ]f|$$tR$/TEW/TE~,$1ۍ(TEGPjV- C;|勜$+\EtcL$+\EPSm?~E+XE1fff.(PjVE;/|括$ffff.݃ Vu EsɊD$L$ue|$WbjWTD$PWBCPt$fCPt$P)HPT$T\P@P;Lr t$0)1EHP8DP@P;Lr t$(G9uc@$(4EPm$(8EPP$($\Ťu؉<$P4$ ^_[]ffff.USWV M < PX]ƸBK8{4PX@ȹC @‰$QC4$Fƅ>taiE Hl1Efff.D>$DŽ>DŽ>DŽ>DŽ>Ǥ9}uEp0 ^_[]ÅEt-ߐt$$\Ǥu؉4$E$fL$?#AD$?@+T$#H9s@USWV,$@A1111D$@ؾ@T$=@CƋq0 .IщL.D.D. PT$$PDŽ.D$@ŤA9wD$|$q811ۉŃt$|$l$1AT$ ʉ$iƤ)B09B|$ D(|,tatPR3$P|,rdD(PR$PEǤ;l,r)D(Ph D$ 08$Pl$|$C9K t$ 6|$$@11L$ iŤ)B09B|$ D(|,tatPR$P|,rdD(PR$PCǤ;\,r)D(Ph@ D$ 0H$P\$|$F9K D$ 0 $@A Pv>D$t$|$ D$L$111ҍt$ff.sD.t$ )v_1Ʌ҉T$$1Ҁ<.ƒ RQt.P$\e T$$L.)уQP\$ St. $փ S S&D$t$tS P踨ڃD$t9L$ <)ujPڃjP蒬ڃffff.G ;>t$l$<$ӋD. )vEL. L$ 1Ʌ jQt$0P$\i L$ D. )كQPWD$ $@@;D$4D$(q q 6$@A<t P$PA,^_[]ff.SWVt$~t211ffffff. 8Q0 CǤ;^r^_[ffff.USWV$$x~t?1$hjPW)$0)$ )$)$)$)$)$)$)$)$)$)$)D$p)D$`)D$P)D$@)$)$)$)$)$)$)$)$p)$`)$P)$@)D$0)D$ )D$)$F41Ɂ111 H1ɅLDUD@ $GfD$ G_rM11,1 DMɽ1ɅL\ oD@~$uG_rM11,1 DMɽ1ɅL\@ $D9$N(QP$Ph2A}T$@QPRj@$}RQPRj }b0$@VPQj,|^_[]fffff.SWVt$~t211ffffff. 8Q0 CǤ;^r^_[ffff.USWV,|$Du|$G}ow L$t$ \\$fDEC$ Et(G)L)É GGPt$4 )ىOw,PVE0QVU1ۃr[1141 Nɾ1Ʌ4LTt$ Kb0PVE!ƒRSV VL$DƋy jt$(j L$DD$D IDT$'TT$%fT||$Dt|$t$ Ƈg]D$ru1141 NɾD$1ɋD$֋t$ D$D$JT$LL$DO\$@))ˉЉ GGPV )؉G V4L$DƋy jt$(L$DD$D IDT$$TT$"fT|t|$D$(PV#fff.E u mPVE9}tO wG W\$t$WtL!)s;)ÉL$D ‰ΉVRt$ )NT$D$D HljȉT$WuD$rh1Ɂ1<11 J1Ʌ< LL$ z|$Dt$‹)s3)ÉL$ NQt$ )ډщV D$щV D$\$t$GD$rpL$(HL$K!t$)t$ )Љ؉L$L$ OQV+ +L$OnK!)s9)Љ؉L$L$ OQt$V +L$O_uD$O ؉G{D$O ؉ʋL$(D$GR)s<)ӉL$ NQt$f )ىN~t$ \$D$N F\$t$ 9,^_[]ffff.USWV l$(\$$|$ 1fDNۉuL$,T$0 o ЉD$G(;G,u ,$G(PO$W(T$ى11G(1уZL$;G,u ,$|G(PO$W(T$t*DG(;G,u ,$PG(O$PW(Fuۃ ^_[]WVPt$~<$<$F$Dż u؉<$PƼ4$ ^_[]f.USWV M < PX]ƸBK{PX@ȹC @‰$QC4$Fƅ>taiE xT1Efff.D>$DŽ>DŽ>DŽ>DŽ>Ǽ 9}uEp ^_[]ÅEt-ߐt$$DǼ u؉4$E$fL$?#AD$?@+T$#H9s@USWV,$@@11111f.ع@t$T$=@C$@q .$@IщL.L. D. $$@DŽ.T$t$@ż @F9w1$@11HƒL$ |$T$1$@L$@D$fff.$@iƼ A)9Bʀ|$D(L,tXtr$@D$ $A|,rX D($@ $D$CǼ ;\,r&L$D( D$D$  $T$|$E9Ot$$*$@1۽LH L$$D$f.$@ۋpt2..p<.D$L$$-ff.L$$D$$L$|$|$C.hż 9uT$w|$ 11L$f$@iü A)9Bʀ|$D(L,tXtr$@D$ $|,rX D($@ $D$EǼ ;l,r&L$D( D$D$  $肉T$|$F9OD$$Q$@1ҍf.$@iʼ T$ L$@D$D$L$11퍔T$f.zD)v,6 D$$L$l$^$$@tE$m$@t,<u$D$趑$D$D@T$F;2cL$T$D )vlD$$l$T$ L$B9te$@i ËsD$>D$D$$$>L%$@p@$资t$$襄$@t$輏$@@,^_[]SWVt$~t211ffffff. 8Q0 CǼ ;^r^_[ffff.USWVl$$x^t;1 $hjUWD$P)$)$)$)$)$p)$`)$P)$@)$0)$ )$)$)$)$)$)$)$)$)$)$)D$p)D$`)D$@)D$0)D$ )D$FrA׉i3n3F uyb~XoAoNftf=uoAoN1ftfɁt\$\$3$ PxD$v$ w Ë$ K@@8utu4jD$4PD$$pp?D$ 0D$8Ph pjD$4Pss3D$8Ph xp$ @8u3h: QpT$\$E4L$D:CG;D$ ~D$$@É;l$(|$ 1ۋ$ @8t9<9 4C Dȃ Qo h MSPo t$$ 0t V` Vl ^_[]Éƃ S&ƃ D$@ SPWdtlS0WrduT wkt wIu) 78t w&t _G_SWWG(PW (t(SWWVY^_[fUSWV< $P $\ $X $T G8(t h1ɈVBO8LIQUSPtDG8l p S t SJǃ0  0 ƆPj!UV+G8 tU l$ UG8 PUhhVUV UG8$T Tt8tƆjUPj茛UhԤV U:#tm U% P^$tQ8\ fnfpf$fD$fD$DD$@fD$0fD$ D$Hb D$ P9j hԤ7pG8l pt7ǀpǀlƇX-jSl SuUhԤKp S?jSQitjhԤo SltjhԤiojUPj SP $` }uG8$d VkjjSV0l" PW$d USW }t'1SUkx$C;]rG8|j hԤRr $h  hD A Pc1OG8 jjSVjkO8lp tQPVH؁< ^_[]ÃT*ƃ U  V8 DUSWV $4$GfDŽ$DŽ$fD$pfD$`fD$PfD$@4$$!1ۍl$@pXff.4$D$@tN$!D$`A8$l$$D$ |$t$|$$럋$!*D$($!$jF0$1D$D$ <5D$,UD$$8\ fnfpfD$0ffff.$Xt;$!*Y$!foD$0$DŽ$8\ DŽ$8\ @@ @@@@@@$@ D$ DŽ$0$D$,DŽ$($$$芙D$$Ԥk$!VwtJBu.H@@@@DŽ$DŽ$ J$ ~fք$$!$D$ $f$!f.l4@@@@DŽ$DŽ$ DŽ$ ~fք$$!$D$ $e$!,$f$!tD$$Ԥi$!U5D$u3 u*D$$T$~H$!HfUD$((hfoD$0$DŽ$8\ DŽ$8\ DŽ$8\ @@ @@@@@@$@ D$ DŽ$0(DŽ$($$$迖D$$Ԥh$!@05w u45t $ !$L$D$$ !D$ $!D$$!$5J$!Ãtu $ !&$!pUʋJHlUBLJH,$Xz$!|$t$ ^_[] Ƌ$t$4$#USWV\ $t |$\D$<$D$8\ fnD$fp$fD$fD$ fD$TD$PfD$@fD$0D$X)$h]Ɖ4$3M$p ƆC8%%džLL^^OO% $D$D$H. .[8g,$gD$h<$huBf$p @8.<$D$ٝtp<$tɉ|$4$~D$C (f$&ؤ$A4ljt$<$<$n<$&<$;ؤËht$s,$;gt$D$P$US}Quj8\ fnfpf$ f$0 fDŽ$d DŽ$` f$P f$@ DŽ$h  $, PpUSݿ!8\ fnfpf$ f$0 fDŽ$d DŽ$` f$P f$@ DŽ$h  $, PDp!$( PQ_$B7P_$|$111ff.SUF>x$tSU3>x$SU>;pHsSU>pxSU=xDu(SU=$HP$$SU=0$BP:$$C;$211D$D$PU$BP$4 P$$  $D$0Y$ta1fff.D$_tSU<x$tSU<x$uSU<@$C;$r$$ D$\$( D$D$tk$ux @r@ @8ux r@ utƀ$\$zL$\#L$t$0z|$t fTɉL$8H D9B|$8t$$9Ή9ىH w 1jPU?$8\ fnfpf$@f$PfDŽ$DŽ$f$pf$`DŽ$ $LVlU$蹻8\ fnfpf$@f$PfDŽ$DŽ$f$pf$`DŽ$ V6l$DŽ$DŽ$1ffff.VUV:x$tVUC:x$uZVU0:x@uGVU:xDu4VU :$HP$$fff.F;$r$@PD$CP$Pt$tr%|$?Vt$$hԤLFD$tL$x)$$t$PU4@$D$4$$$DŽ$@Dt$$hԤED$tL$x)$$t$PU 4@$D$4$$$$DŽ$D$ @D I$;$QPj5$$8$$$<|$(D$ T$L$$t6D$ 1ɋP X3T$ 1 uPX3T$3\$$ A;L$(rЋD$(P;T$`$NL$`L 9GʍL$`Pt$x袘\$D$Lu hԤ5D$LD$,D$lD$ |$>$xB$|B1@@;$σr7ˉlj ޾ξBBډ ޾D޾D19ljȹCBЃ\$6$?DŽ$|B<$xB19ljЃ@BB?ЃйййCJB\$?й?ййй\$D$(D$(@N\$D$(L$ T$HT$$TT$TT$ |T $T$(\$DŽ$3PU(0L$h$QPV+s \$s^\$$$ 1;$$}$$L$ L$ D$$D$0k \$оrҸIIЉ{w$ L$ j$wP$B@@ @@@ $LP  $$҈d$8T$$_t2t6$wPt$$脫$t"D$1ۀu ?u21ۋD$t!$ut$ $BPV|$8t\$dut ۋ\$tcu[΃P$"Pt$$&1D$@|$8t$$$B$Bt,91ɃtDŽ$PD$|D$@u|$uDŽ$|BDŽ$xB$$D#$Ht $LPVU-@$u<DŽ$;VU,L$h$QPWD$|$@t"Pt$ $LP$D$H!3|$@t$B$B$$|$L$t$jh"h$wPD$xP30D$0 $, S^Ɖ׃ S袩jRPSe^j$p@WVSP $ƋNVWL$9H(u(VW@<VW@(F;wrD$T$@HL$TR89D$T1ۃSWNx$SW7L$9H(SWx<SU rH<]{@$;}rBG;}s<WUx$u)WU@8tԃWU@$뾋$@C;_=D$T$@;APvAPD$`t$1Ҁ|$ 󥍌$ DŽ$DŽ$t$L$`E$P$@Wt$Wt$L$\fHDD$i^8cƄ@h@cch@p@cx@~ cfք@(c@@t@PU@l$ t\FjvvPQF uUPv,ҀF  jjUjP g0c,c\@X@t V u@u @V,;F @@NpN(h` P LF x ?F(/NV D$FjPRQD$P vճcD$F jjjPQ v,F,VT$~L$8T$L$L$<T$L$8L$o~Q$flfA(A$ u~`@fրN(%L$ 1PjF,1ɍ@T$ ǀǀǀǀD$F gF(D$@D$@D$@ t$D$P@t$(t$0t$$Qjt$H>0 v,L$T$A$PA B A@A@~IHftt$P脮Ƅ F,~fքP@@t@Ƅ@FjvvPQ jjUjvS FjjjPQ$4cF ߅V1Ʌti8cȜ9 PQ F x 8\ 0fnfpD$$D$48\ D$88\ D$<8\ D$DD$@D$LD$HD$TD$PD$\D$XD$dD$h`D$`D$ D$,PV3F0F($uWvP}$Fu VFl^_[]ff.T$1Jti8cȜfffff.L$iA8cfL$D$AAAA AAff.SWVt$ Nt)11f8t $cNCH9rt$xc^_[ÐSWVt$ \$$D$4$ FC, t $^`t*FHNލ<KDfLD^_[$B_d$D$ D$pd D$L$ffffff.USWVL$0A\h< jHP1 T$@J˃tQ11GL0$u1L0lu%t0H40xT$@u D0$BHH9rJ\$ 11ېt)$ωL$9sBɋ‰T$D$ P`L$)L$Pt$T$R`ttLD$T$0|)EEÉD$: D$ L$4ӀT$0 t D)$t)$υuT$0BCH9=^_[]DWVP|$t$76YwuO,19N,t D^_Vt$FlFrh`= jHP6IFF^ff.SWV@$@$ hW$@5lэhSV5l躍SWv@^_[USWV $ 1Qlqk L$l|$ ۍ,h|$Wl$ URDW$0 !vxt"C9r}fff.މ9rgl$t_$ ]H9sXfff.nhD$PU5lnjD$P$0 uu9ʼnw 1O ɍ 9vQfhD$VS5lhV$0 EuuOH ɍ 9r$( ))i98i98 $,  ^_[]VL$D$t$Ɉ ptt V(h`B jHv6^ffffff.USWVt$@4$ht$D$D$D$D$D$ D$$$ J4D$T1ۅt6 $GL$`ƅu $Ԥxt$, D$,10u <DCD$@$;lDžt<$D$X %Ӌ$zX1ɋύ ɉ|$0l(D$4D$@$MhD$4$D$<@1D$8fGD$@$kÅt;tރ*u){.u#{tD$+ D$($]tuD$4$D$D$ht$L$0ɋL(9uD(4T$(\$$D$+S$L$(D(8;|$<0D$(D$D$8$|r_L$0$A;Jt D$,$\D$@t$ \Ĝ^_[]ÉDžt D$,$[D$@t$[<$^@USWV t$ l$$F$M$t=pE(9F($yzËE$lzlj\$$D$.[É<$D$.[u ɸ`t O tL$$.q5D$|$$qFN}UÉ11  L$$ $L$p1~DMD.1Et1ۉ$yËEuD$$(Et1$syNjEul$$19w+t4F0N4;E0M4 M,19N,tD : ^_[]9fSWV|$ GOD$$9ȉGvrW t.9v*T$D$8* $Ԥb$ԤGO\ 9G؋ ɉL$$J\ƅu $Ԥ7_^_[ffffffUSWV $ PW\jVQ|ujD$0PV襒 h? 赺 Py1Nu hp? 苺 POL^_[]" ǃ S螄 ǃ V $l`P WH USWV=$>$x@D$t$,$W$x`l$<$ t$<$W)D$0D$0<$D$2(f<$?P$x <$D$t$$RË$x D$@$O*D$/|$@t$,$D$ D$D$D$D$ D$|$IZ$0 t$$<$D$<<$D$,|$41ffffff.D$0D$<$D$0DD$<$F;t$4r$ o$7D$P|$@]\$4D$8C9É\$4L$n^t%ffff.D.t$+u$+$0D$(E@D߃D؃Dߍ$<$.D$,;E|{u8\ $fnfpfD$0f$f$fDŽ$DŽ$<$f$f$DŽ$kufoD$00<$$DŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ADŽ$$D$ $Ԥ}E4$D$ D$D$P8\ fn$fp$f$f$fDŽ$DŽ$f$f$DŽ$k1E1ۉ<$ ؁^_[]$lj $<$2+ffffff.USWV8\ $fnfpfD$`fD$pfDŽ$DŽ$f$f$DŽ$h D$lP1 usD$4T$0x h qEHuHt P+(ELEPt$ʉƁ u'x h Yff.7QPt$$t$,K*ÀLu#;xt jjdPSh  xt$ t$(W ~G@D01f.xuF 9rMffff.96p0Wh ŋt$DtO@1 B9rV$h%+1ۉf$@@<u9@E9I t$qt C9r1ۉ|$ ffffff.l$ $1W@t tVS$4q F9uC9rtY1@$F@|u$t4 EG 9rÅt $14$1`\$LD$ |$,T$0l$qt$D$ D$ |$9ʼn$\$ R@)ʼn$T$T9B…t$$|$0T$,<4$l$LDtj4D$t$'r $Vn4ɉ)F9sWD$H9͉ˍ IGݍ[)ˋ0LyqA3|$3D$ uAy3D$,3|$0 B9rÃjt$TW$\$l$T$0|$,t$LA0I4 I\lT|tDD$ 1111ɋ$ L$l l DDDDLLtMt$.|t 3t3| u3| p|$D$XD$@vD$4PMlL$ Ƈ$ƇD$(t PD$ @9ȉD$ Ĝ^_[]ÉƋD$(t P V USWV$$$tK@1fB 9rl$P3UFh D$tUPWV3QM tl$$$$$$D>T> D$TPhT>D>|$D$$t$F*Lt ;t$X#jjjjjt$ljV? ;t$Xff.USWV|$$D$|$,$48\ @fnD$,fpf$&"$l$Ɖ4$|$4$4DŽ$Ƅ$L+$ Blj$K$G4G0G<G8GLGHGTGPG\GXGdG`GlGhGtGpG|GxLJLJGG@Ƈ$D$賷t$uU$ODDŽ$<$ÃuDŽ$$oDŽ$ <$XÉ<$N<$vuxu$D$ D$D$$YD$,$D$ D$ \$$R<$D$$D$D<$D$ u<$D$+ t$D$D$+ t$D$$l$4$華D$+\$t$,$D$ D$D$D$D$ D$OU$(  e|$$φfo$D$PD$4D$D8\ D$H8\ D$L8\ @@ @@@@@@$@ D$xgD$p\$0D$0$Ͼ$ *fo$D$PD$4D$D8\ D$H8\ D$L8\ @@ @@@@@@$@ $D$x@D$pD$0D$0$$$1|$+U\$$Ԥ}\$+4$$$$t$,$D$$t$,$D$fo$D$PD$4D$D8\ D$H8\ D$L8\ @@ @@@@@@$@ D$xD$p\$0D$0$4$$$ |$,$D$舧uNu$p? Kb$|^_[]É4$$$豰NuÉ<$*É4$茰Í$$w$fff.USWV$ x8\ fnD$ fp$fD$ fD$0fD$pfD$dD$`fD$PfD$@D$h辻E,$PƉ$ Ã$DC4C0C<C8CLCHCTCPC\CXCdC`ClChCtCpC|Cxǃǃ+CC@ƃ$D$$k$E|$t$,$D$ PfoD$pt$ 4$fD$ fD$0fD$dD$`fD$PfD$@D$ht\$?  Eȉ $_D$$ 蹁D$$Ԥ 8\ 04$fnfpD$$D$48\ D$88\ D$<8\ D$DD$@D$LD$HD$TD$PD$\D$XD$dD$h D$`l$ 蚹Č^_[]ÉƉ$E4$f.USWV\Ɔ4jjjVPjVïÄt j$%*Wjj1!8\ fnfpf$f$fDŽ$$DŽ$ f$f$DŽ$(h $P萸h Vt$ t @jjVЃjxV7t 8\ fnfpf$f$fD$ fDŽ$$DŽ$ f$f$DŽ$(k $P豷foD$ 0$DŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$DŽ$(ADŽ$ $ $Pj hԤ蹌 WjjjVP8\ fnfpf$%f$%fDŽ$$&DŽ$ &f$&f$&DŽ$(&k $%PM\^_[]1ɍ$1D$dždž @jUL$QVЃ@h $QVЃƅ3&1l$`ffff.<;x|z<Protu1Ɂ<ect+t<<j4PjB l$`9Í$y@<Protu1Ɂ<ect!tuK<<jPjB l$`9Í$tfffff.G9$%t$ L$< L$t$ D$D<$<ω$%$D$/<<t$ D$DŽ$ <L$DL$$σ$%j$SKSL$jPSO SRMD$D SbM$$$t PD$+D$DŽ$D$D$8\ fnfpf$f$fDŽ$$DŽ$ f$f$DŽ$(j $PD$6D؀t ؃\؍$L$ j($à SD$jD$Dp(p$S\$L$LD$$;\$ \$D\.D9GщЉT$(T$H)|$T. |.D.r$Vh D$0,wfL$@y(tdL$DT$Ht.1L$fV~D$F L$@D$YI$ |t$ WRUt$4D$00o D$@E;h(rL$L|$(9s\$C;\$D$ D$@ 0)<^_[]Éƃ S] V fffff.WVPt$>vv jj8OvT^_fWVP|$t$ww jjNwT^_USWV t$ >(tB1ff.o$FN WlDvPQSvvT C;_(r˃ ^_[]USWV t$ ~(tD|$$1fn$GO VlDwPQSww C;^(r˃ ^_[]USWV\8\ $t$pfnfpf$Pf$`fDŽ$DŽ$f$f$pDŽ$ $\Pm*Ƈx4D$0jjQWP jjjjW jjjWP WPՉy2k؃jhQPbƃl$݉Љ\$ l$$ 9͋l$CCھ$pBXxjPƃhxjP{jh jjjjSI jjjSPt$4D$ t&Wjɠƅu hԤC=1|$$WjV^\$$11D$D$ D$ff.|$(9|3DP)كQjPD$D$,\$,l$$pT$PϋISRWу LWD$PWL$`LD L0WD$pW$D L0D@LPW$W$D@LPD`LpW$W$D`LpW$W$W$W$W$W$ W$0W$@W$PW$` 0W$pW$ 0@PW$W$@P`pW$W$`pW$W$W$W$W$W$ of$0W$@hWj\\$,L$|$(d u1fff.` T ~` t6D$\`HD$$@+N (u$@)|$DŽ` A҃u$@$@t1 T rt @9ul@^_[]fffffffUSWVLD$D$ jhPj;<$`$ $@`$@hPh \$Sg W[,SW,$ `@@ @@@ff.jVWt,tUVtz W+h$ Sh D$P轳 W+SW+$ `@@ @@@jVW+tUV#t W^+h$ Sh! D$P W+SWD+$ `@@ @@@jVW4+tUVt= W*L$ A1jhD$PL$Q$  W*؁L^_[]ƃ Wa* V襐 fSWVP $` |$<$t$<$D$`tF$ 谊ƅt4t$<$D$ ~ $d D$4$L$J1 1ۉ4$؍<$p؁P ^_[Ɖ<$V4$ff.USWVj@h " j1=1& $4$0h jh#Ƅ$ t uFOupfffff.F1 t0 t#PwtOFЀ uN@1Ƅ$#uƄ$u1Ƅ$%1f. t u @O9uK1)À t8ff. t(iw9ˈ T u)ύ$Ƅ D$f t u FOuWF1ۀ t6ffffff. t"kw9ڈL F uN)DƄ$f t FOu1Ƅ t1$D$11퍜$Ƅ$Ƅ$t@ t uFOu1\ff.W1ۀ t-fD t"C=w9ڈtLOÀ utC1Ƅ$h$ PSYE\ Sc1ۃ P$ P脝t2$$Ѓ Pat$\A$ 1P8tY$$Ѓ Pt6$tA$ Pt$tA$ PœtY$$Ѓ P蟜t6$|A$ Pxt$|A$  1POt3$ $!Ѓ P,t$!DlAЉ =$"$ SPQI|$Ƅ "$ VWP!t$Ƅ4 t$$VWPƄǃ$UWPلƄ,j jW/D$ |$$W PWjƃ $$WPWVS$ QPt$$ QPlt$$ QPTU$ QP?;D$ kjhk" $$V thhU $hhPή\$jhk" S跇t"hhS轪|$u*D$hhPw|$t$"1j hM" S蓘tj hW" S|;C o\${ u P螙u CuCKj jSLD$j.S1tVk*tM@j jP U3tC PL- DIŋT$L$ $kd u"T$ \$B Ȁ|<Mt5\$T$ 1|<Mu$ƒ|$ыT$ Ȅj ha" S&tF|<\<iRC } u P.u&EEu|$vpmMj jUÄD$j.UaD$t>Ej jU蒄D$ j.U0t@j jPkD$D$ DŽ$ DŽ$ $$ Sp$ PSD$;$D$ ;$D$;$ $8 t$$V言$ Qh " PVY$hUW`h$ UW7$ hWP. W2ƍ$Ph " VW9Yh$ PW$ P$PVWUh$ PW赓$ PUVWXF1 t2f. t#PwtOFЀ uN D.@1! Rt$ h0! j2$4V. hX! VPhh 1ۉ؁^_[]f.|f.D$|fffSWV|$ _HGG GGGGG$DG8G<G$G G0G,G(G@GD$/G4^_[ÉƉ$+ƋGt$Xt$J4$肃ffffff.Vt$F4t$IF t$ F$t$+F,t$F0t$݀FHF F$F,F0$vFt$觀t$虀^@Vt$F t$yF$t$蚀F,t$[F0t$LF F$F,F0^ff.USWV |$ G8G<G t$G$t$G,t$G0t$,l$(\$$t$G G$G,G0,$ޏ$|G,4$ˏ$|G0G@GD$D$=eƅtj=tckD$踫w@$" G@0G@'G@GDfff.E=uFDÃ8tF$|Ɖw 4$}G(@uF$n|G$D$4$D$角G(G,O0D$8\ L$$LG< ^_[]fff.WV$$4t_$8$<tWfD<% tG u@fj&t/%t'z1wFu 8\ }19rB9)EEB |$QPWzh# WGztD 1fo fo # xo'oWfoffff~t ftG ftG ftG ffofff~tG ftG ftG ftG N9tf.| wD @9rD$x @t$0Pq0q,I$^_DUSWV $($$$ $L$L$ffff.n8thUv4D$P(x)CtD, VWPwVD$P$,VFUSWVPL$$1|T$nl$ 1fx)|@9KZBu=fffff.u0ru?B ff.uPZށu<rl$ u$??  f(ZށjuCr4$u.4$??  ݃? l$ tl$ 9^_[]fL$W0 GffffUSWV l$ \$(|$$E@tIE ;M(9Ifff.;IuE =r $xMH4=r$]9t fMH9u\}(9wUOtRE =r$+ MH4D$$=r $fMH9uOu1ۉ؃ ^_[]ffUSWV t$ ~>tK1۽ fD/t)/u$Q /t$QC >;^r…t<$vmFF ^_[]f.SWV @$4@\$t$h jVnhh8$ Sb~f PgÃ$# hWS"=u9@$=u*1$=u"L$=uL$=t u$0@$ h VShjWLiG h SPh1 @^_[USWV$8$0B$41D$#t$hԤ $0w*i 9\=b= t$L$  oL  l$ L$*F L$ 1t.|t't$PΕt1$0B9rD$$4t$l$ .DL$$4L$ L͉ыt$ h8 e D$PD$L$ D=tV t$L$ t=jt$QPD$jjjPQD t=jt$Q蒭$0fffff.D uYhD$$S$D^l$u SfPSV譮jhh$ u蘮e $DUhƸCh\$ SVU芎VSt$6Ejh@9 61$0t$$4BL$F9|^_[]Éǃ t$g WWk ffSWV|$ GOD$$9ȉGvnW t.9v*T$D$8* $Ԥ$ԤfGO\ 9G؋i L$$kƅu $Ԥ,7_^_[USWV,\$$ $@$D󥍼$% PSiUS/<^_[]@WVP|$t$PWVQdƐǐPWV*d^_@USWV$$L$\PVQc$ QPRcdž/Bt@1ffffff.kT A9vtML$ Dl$ 1l$ D$P%N D$dP##C19ݺvTـ9v؉Dt!uD$`P$dfff.u\tXD$XPD$`P$Pb $PD$`P$P$P$S9(Ĝ^_[]ffff.USWV,$@$D?"VWEtRw<rHDr% Tɉ ˉ HуwFF1ۃ?t:$WUǐD$UWP|$ t\$Hw%DrFu ^ˁNrZ9v fffff.A9v @=stF,^_[]@USWV|T$X$ $$$󥍼$% ƃVRnUWUJ9v9r'u,}DA9vU9sىEtV1ɺf.L DB9vt)@;Ev DELAщT@wۃh% U=}D$ h% U$Py}LPVW_t$ EL9Hw)LP@)ƒRjQd}Lw1MTUXfo%p$ EPfnBM\fn%fbfn ^fnfbflfMPM`-MdfnKMhfnfbʍMlfnGfnfbflfM`MpþMtfnMxfnfbʍiM|fn#fnfbflfMpfnPfnmfbfnDfn=fbflfrj$ffff.H;MLv DELLAщT@w.~*9r&fff.TL9T rI}taEP1ҹf.)18+| FA9vρwtIHELtLLuHELt LLHt|^_[]DUSWVD$l$@@ @@@@@@$@ @,@(@4@0@<@8@D@@@HUp1u8Jtyw<r_D8r+L ݉O˃w8l$O\w4Dsf.\8u ˁr89vff.8C9v  A1GD$ fET$9w7D$9L 9LwH}xtw'|rBD$DT$s -r%DDL  ʼnDJȃwD$D$PFD$ M9~)9r%Bfff.L9L rH}tsL$ l$1)1+\Fˉ EO9vˋl$wffffff.tHG>J?Off.xt tGtZD$t.T$f\ ʉډL@L$9rD(T$|JT$\^_[]f.USWVL|$`D$ht$dGG GGGGGG$G G,G(G4G0G<G8GDG@GH T$QPRW>X1fffff.D$ds4,$A9w@9v9s~/~f.,$w<rE$D,$r,fffff.L ‰MȃwD$D$nfDtL1DA9vt(ED;v  Aщ@wt$tW3t$tD$ PCD$dF;0L^_[]D D$ QPt$Vfffff.WVL$T$ 299w9r~F|9|w rN}1^_fUSWVT$D$:t\H1۾D)19+<ÁFF);2vЁwtJQtuIDɉtIt^_[]ffff.USWV$$ $󥍼$(% ELPS$$V#UVVSt$TVSh% VEt$PUVgT|$L$9Hw)@ )ƒRjQY<$w$1L$T$ D$fnBL$fn%fbfop$ fn ^fnfbflfL$L$-L$fnKL$fnfbʍL$ fnGfnfbflfL$L$$þL$(fnL$,fnfbʍiL$0fn#fnfbflfL$$L$4T$8\$<fnPT$@fnmfbfnDfn=fbflfL$4rK;$v $ Aщ@w"~9rOT9TH rI}tcD$1ҹff.)1+\LFA(9vρwtIH $$t)u"Iff.J҉$t ҉tA QPVjS1Ʌȁ^_[]USWV$ \$QPSgQD$L$ƒDщ$tXuL$9ffff.| DAT$9rDLL$|uIL$$L$TPSQP\$P1t{L$TT$TՁlu =ff.tT,6 ҉TPCl$P9rTP\P\$P|PuK\$P@u $ tQW- LJĜ^_[]USWV$u s$u AQSVQL$$PQU $SVW$TWS $0SUWtl$WU WUU[ $WUUI UVW> W$4PS, USS! D$ PSPD$ PUVkÐAQSPPtYdž<PSVƐNÐPSVN^_[]à Ve D$ Qt$PP1Ʌȃ f D$ QPt$"Nfffff.USWV$DŽ$<DŽ$@>]|$VW $VWS $@PSS$^D$tY +T$ f.t4t"ڍ..FӋT$ 4tHũWS S$VS $t$]PSWLf.WWWW  SWWMuۋD$L$ƒD;$tD$WVƐVNdždž@WWWWudžW)$ )$)$)$)$)$)$)$)$)$)D$p)D$`)D$P)D$@)D$0)D$ )$)D$^_[]W1)$ )$)$)$)$)$)$)$)$)$)$)D$p)D$`)D$P)D$@)D$0)D$ )D$pfWV$$$D$$VV&VVuĔ^_ff.USWVD$L$0<1ۋ<t,??F\0NtV=f1t,F݋,lNűD^_[]ø^_[]fUSWV\D$tt$p8|$x@ LHuhjV3OD$t} T\$ @t$t44t6|$xt,@|t,77F<1>FT$1UIuˋL$ T$t$1)ՅtT$| uIL$ uT$ f.9s(K$DŽ$9r$tOt$ L$t$ @Tt;;FڋT$1Nuы$t$ tfu K$u1ۃl$9L T$|$ 4)BʋT$ L$tgo@t@fT$ FL$ 1tL M4uɅu鋌$@l$|$ )D$t(t$@@u&I$@uf.t$f.L$ +9s*$fffff.w2D29rtW$ڍ ff.4t"l$<..l$Ft14Juɋ$1$tD|uNuu1T$AxtZT$$+ t!|$4 F֋Kuʋ$$PQUAW1)$0)$ )$)$)$)$)$)$)$)$)$)$)$)$p)$`)$P)$)$)$)D$p)D$`)D$P)D$@)D$0)$)$@)D$ ^_[]f.D$8t@1ffff.SWVt$t FuO|$PVW@f.WWWW VWWqKu1^_[DD$8t@1ffff. D$AQt$PA1Ʌȃ USWV$|$VWA$0WSU VUUUW UWWVS $WUV VSS WSSD$ PW$e?^_[]f.SWV $4$0\$PWS!?$QWPSV0^_[fUSWV T$$:wwt$(L$ rC1tS1f.,,C*9vt&E|%tPRQs> )1 ^_[]f.L$tc fx\@uV rR rP rN rL rJrHxH@uG uFuEuDuCuB!1HÃÃÃÃÃÃÃÃÃÃÃÃÃf.VT$L$ 129vȀD^fSWV $01?t9$WSǐD$SWP0<$tt$ ^_[@USWVt$>tq+T$wtOD>L$r5fffff.L$Dʼn ͉݉ L$Ow܋V‰F^_[]fff.L$D$Afffff.USWVt$.tUt>^+T$fff.DщL$ ˉÉ G.9rߋL$,<uH^_[]USWVLD$dt$` T$QPR;<$1twL$fT$Ӂ\u :ff.l\- ҉G$9r<<$<uO<$@uL^_[]fff.SWV=G1~^_[$C;ƅ5t`$+;t[f<@D߉Au1ɐ Au1끉=q=4$)>ODV5 ut$=t4$=^fff.|%@T1T1TDHyDy@y<y8 y4 y0 y,uw y(uk y$u_y uSyuGyu;yu/yu#y uyu 1yD$@@ @@@@@@$@ @,@(@4@0@<@8@D@@@HUSWV@$4@$@@$<@ @؃@LŃ|$ PWRQƅ5D$ L$ff.\$$8@l$$0@tfDVWU&\Ku\$l$@r`T$ t$ EEٹ@9؋D$ L Di$4@VWQPƅ\h@jW<$4@jjjQP,@^_[]fD$@@ @@@@@@$@ @,@(@4@0@<@8@D@@fffff.SWVp$$\$$ %<$6D$|$$8%F$D$I'p^_[fff.SWVt$ 1\$D$~\k\ P$jSW$D$<D$r΃^_[USWV$$$D$1\$ll$f.k\D P0$D$<ujUSH$D$D$9|à \$W$V$S $D$~|}1fffff.DPS% S#D$WD$ )D$D$9|% D$W$V$P? D$DE^_[]DUSWV$D$$1t$l\$k\D P#D$<ujSV#D$D$9|Å$t$fff.UWV"\Ku싼$$D$~eu1\$fff.DPS$ SS"D$WD$ )D$D$9| $D$DE^_[]fffff. hht$,t$,t$,_,ff.SWV$NANt4fff.LBˈLl9ˆ\Lr߃ |$lWr!L$ PQW!D$PW#D$^_[WVPt$|$<$GF<$uA9v D$VP$P1ۅá5 u t P_*t VO*؁Č^_[]ffffff. t$$t$$jt$(jt$,,ffff. t$(t$(t$(t$(t$(j,fffffUSWVl@$@DŽ$l tS$@t-$l $D$D$ D$L$JO$l D$D$ $?D$0$g$l tI$@$l D$D$0$ju'tD$$Ԥ1D$@D$$+Džu $Ԥp1D$ffffff.D$ D$ D$D$0D$$ynƅtkL$9v9ȉ<$L 9G͉L$L$k+Åu1$ԤD댍$l D$D$D$0$Mht$ \$9s0؉<$\ 9Gމ\$+Ņu$Ԥ1$@1D$(D$D$,D$rvEt$Qu苾t<$ơ<$t$\^_fDUSWV $($A$,VUV{$D$jV!NJ$ҹǃ V]|$@$!hUP0 ߈$$ |$1ۀ|$D$1fff. Ult[ h8 sǃ WWUWZ$ <D$FShU@땃$$Dy&κQ1ىkd9Ӊً$ F9L 0D$ 8\ fnfp$DŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1DŽ$$DŽ$DŽ$ $P)D$ 1҉L$X1D$<D$T $!P9ŅR|$> $!P`>ō$!9 uW*$!C9w8\ fnfp$DŽ$8\ DŽ$8\ DŽ$8\ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1DŽ$$DŽ$DŽ$ $P@$A V]^_[]1E 7`D$8T$4u V+Ã|$ 8\ $1ɍ$fnfpfD$`|$DŽ$D$AD$t"PS$!Ph& hUw )PPt$PVP$!PhD& hUL0 h8 Ń USD$L$, jjhhD$/Ph$PU$Py0uA|$uUjhԤL$ɸ DƒPhԤɵt$8t$@D$$L$4[`foD$`$DŽ$8\ DŽ$8\ DŽ$8\ GG GGGGGG$G DŽ$vDŽ$$ $PfoD$`$DŽ$8\ DŽ$8\ DŽ$8\ GG GGGGGG$G DŽ$DŽ$$ $PQD$;D$ { hDB 衩$$0,%Aȃ QD$ t!\$ 1t$S aG0,9rED$(D$DD$$l$\D$|11A$ \$`\$<|$ISRPу)t$ SjUa\$`l$\9Mߋ|$G9r1҉ۉ\$`A=L11);L$||$ T$$ L$tEi0,l$ \$xL$L ,L$ L$TT$p,L$,,T$<, ,$,r&t$Ph@| $,МnfL$ T$D$P ,JT$0L$HOD$PD$Hl$0ȅɉD$\$WD$, u}ՋD$T$P$9ډsT$ȍ9rKD$Hl$Ѓl$,D$荬$oC \$EM uD$,9D$t0\$,D$0D$)؍DCHu$Pt$$Pt$Xal$0~#1D_W@ ;G|E;o L$t\$`T$pD$xl$\A9 $,|$ ~2\$1>D$<D$Tt$dP3TG;|$ |t$4t$<:86420.,*(ƃ U ƃ Ww ƃ $AP V ffffff.USWV$$$CD$$D$!$U-ưD$`t4$D$& 5DŽ$l$$,$\$,$t$@$@D$,,$OD$,\$$D$D$ 9ƍ$\$D$<$$!)޹4)L$$D$&  $$n|$$袦8\ X1ɍ$X1DŽ$l?DŽ$h?DŽ$t?DŽ$p?DŽ$|?DŽ$x?D$@D$\D$Xfn1fpf$L$4|$0D$4$D$D$,|$,t'4$z*4$UD$,@ 4$Љl$(|$@$C$!D$|$,$G,$D$D$& foD$`$x$\DŽ$l8\ DŽ$p8\ DŽ$t8\ @@ @@@@@@$@ DŽ$uDŽ$$X$X$foD$`$x$`DŽ$p8\ DŽ$t8\ @@ @@@@@@$@ DŽ$w$XDŽ$$\$X$Sl$<$7X|$@l$(@4$D$ D$D$Ѐ|$,$C4$D$D$'=89Ƅ,u"$C$cD$D$ $QfoD$`$"$!DŽ$!8\ DŽ$!8\ DŽ$!8\ @@ @@@@@@$@ $CDŽ$("{DŽ$ "$!$!$foD$`$"$!DŽ$!8\ DŽ$!8\ DŽ$!8\ @@ @@@@@@$@ $CDŽ$("DŽ$ "$!$!$cC$4$1D$ȍ$CD$ $"!E;l$<8\ fnfpf$!f$!DŽ$"DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$("zDŽ$$"$"$!$4$|$L$48\ fnfp9[f$!f$!f$DŽ$"DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$("4DŽ$$"$"4$fo$f$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("64$aQf$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("34$1ۍ$$-f$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("|4$D$<D$0D$,~.11ɍ$t ?A<t@9D$,u 1ɍ$$$DB 迌1ҹ0,t$,$$%Aȉ $D$DL$0t$(t#|$D1L$<$DF0,L$0;t$(rD$($1DŽ$D$|H$+L$48\ fnfpf$!f$!f$DŽ$"DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$("4DŽ$$"$"$!4$fo$f$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("54$$C$ԤD$5t$Pg#|$,$t$P;1D$04t!T$D$$Nyt؋ڋIL$`ыډL$T$$T$`Nj$)t#$D$D$$D$0$9MNj$D$0F$;t$,J|$0GD$Xt$PD$ D$\4$D$D$|D$/;$t@$Lu/D$XT$\L$|t$$#' D$T$ L$$L$0\$(D$|1҉ȉt$Pk=L11͋|$D$t$T);$Ei0,$\$, $L$L ,L5,$,,$?$$,$(,,,r#L$L$D$p L$}~vL$DT$T$t$,D$8 ,JT$@L$HG1ۃ D$`D$TL$8t$4 D$44$!9t$4sD$4э!D$`9t$4rND$H$$!D$`oC F ut$4$D$`9t<L$@ʉ)ٍ!T$`CIuwD$8D$H\$@O$!l$L$ t$D$D$L$Co \$@~#1ɋG7A!G؈o 9|C;_ |$L$0$\$($B9$$x|$<t$P$$14t'$T$0L$$T$R5F;t$<|D$D$$c8\ fn$"fp$!DŽ$!8\ DŽ$!8\ @@ @@@@@@$@ $`DŽ$("2$!DŽ$ "$!$!$d`D$D$|$,1$<$4@<$ЋIT$D$<$D$ щ<$D$:<$D$:<$D$:<$D$:<$D$:<$D$:<$D$~:@ <$Ћ$F;t$,$c5$$! $D$$cD$D$$!$衽$!D$$r$!D$$$$L$$!D$D$ $莽$XD$ D$$!$1Ʌ~ XuA9|9u<$$L$$!D$D$ $&$!$G9$!$H$$Lu $& e$u$$Nu$p? oa$7 $!lj $ѯeelj4$|xqǍ$Llj4$ea_4$!R'L Ǎ$ $*-Ǎ$. lj$ٮ4$ч Ǎ$$$跇,$诮<$@USWV@$@<$g ƅtD9v=1$fu>_uF$RtC9wփ$ |$D$,$,$z>8\ $fnfpfD$0$?)l$$D$+c,$D$ D$D$K$@ _l$$Ӏ$DB ǀ$D$ D$D$73$5Ɖ׃|$t$$D$ 3$5D$+$5D$*$5D$)$5$@D$(1LL$,D$|$t$$D$ D$L$AT$*L$)t$+D$( ;t$,uG$? ^D$D$B $A fl$$ԤPfoD$0D$`D$HD$X8\ D$\8\ @@ @@@@@@$@ DŽ$l$@DŽ$l$DD$@$蜷D$$Ԥh,$D$D$`$$A',$;|$|$$Ԥ۝@^_[]É$' ƍ$Ɖ$&4$fSWV\$ D$$CCCC CC$C C,C(%s<Aȉ ${L$(C@tff.XJut C8/$ljt$<$m{8$CC^_[ÉƉ<$Ƌt$B4$zUSWV t$ Ft$FFt$7Ft/11fff. 9t  $PFC 9rND>D$uW|$ t$ j(ǃ W0D$1Ҁ|$T8C$K(uS0RQPW2l$L$Pt$|$ D$(\$ ;l$$l$LD9GыL$HЉT$T$T)؃|$L> l>T>\>D>r"Vh D$0|c@L$l$@~L$LT$ UPRQjt$`D$,0Y; tQt> U FNUƒv RQW6D$,0; G9uffffff.L$PD$9sl$\$@D$ E;l$m\$8 3_<^_[]Éƃ W V USWV t$ >~G(O4Dt?1fffff.W FNWƒvRQUv vI: E9uу ^_[]fUSWV t$$|$ ~G(O4Dt=1fff.W FNWƒvRQUv v9 E9uу ^_[]fUSWV $($ D$$D$$9vfDF$%t9w$294$D$C ))L$H$ DŽ$ aDŽ$ <$q\$<$qDŽ$`DŽ$`DŽ$`DŽ$`DŽ$`DŽ$`D$0DŽ$D$`1ۉ؁ ^_[]Ë$P$@<$D$t$uq$tË$$$D$藓$`ut$$t4$D$& $D$du4$D$+ TCu ƃ4@$D$ D$D$Љ4$%ʼn19r;1@E$%t!E$@ƍ<9sn$ $ H)9p)Ήt$$!1|$0$ \$D$ $%ŅD$0u$;$T$`D$0@4$D$0$ D$@4$z9D$@v|$4$D$wuu8p$ i  Ou$ at$@u;$ $ a$@D$ D$D$4$etŋ$ $ ;hY$ i Ƅ Dt$$D$"L$0u$,8\ fnfpf$f$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$yDŽ$$$4$x|$0$ auI$ D$D$+ $$ aD$ D$D$$ $8\ fnfpf$f$fDŽ$DŽ$f$f$DŽ$x4$軟$ A4y,8\ 11fnfpfD$@<;foD$@$t;$DŽ$8\ DŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$fDŽ$$$$Ӟ$ ;It<>$ED>D>$>$ a,$D$D$foD$@$$DŽ$8\ DŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$vDŽ$$$誘foD$@$$DŽ$8\ DŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$DŽ$$$ $8 =É$s$l$\$D$ D$D$D$D$ D$$$$y-uC$ul$$Ԥ)y$ɸ D‰D$$ԤriD>L>L$D$$ >I $щݍ>\$,$D$,$D$D$& foD$@$D$tDŽ$8\ DŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$uDŽ$\$pD$p$`foD$@$D$xDŽ$8\ DŽ$8\ @@ @@@@@@$@ DŽ$w\$pDŽ$l$tD$p$ȕl$$#>t$QDŽ>냼>D>$ aD$D$$ZT$0$  B;Q$D$<D$8$DB \G4w,4$ G0t?$11ۃ:t  1ɄɈ u9s $ Ei4C 9u11ҋ$ )ȉF l$p,$F$N(V0T$ L$D$,$$ $t:$ @ @$]$ 1ۉL$\D$dD$4H8\ fnfpf$f$fDŽ$DŽ$f$f$DŽ$7 $$ @0t$A1ۉ,$gOL$@D$4$ ~$D$T$@9Lr‹N L$0NT$XT$L$$5D$XD$0)\$ N$E 9rD$`\$hD$ $$D$D$4D$;l$d $$LD$`$L$4\$$ ' D$T$ L$]l$dN,t,11tI $ы$ N,G 9r؋F0t$$$$ l$pLu $& X$,u$$Nt$ l$p $p? $ l$px6$@Xc3]WUS!Ɖ$eA=;9ƍ$ l$p,$(+Ɖ$. ƍ$ <$]4$USWVL|$dL$L$<$D$P14|$Rar!u 1|$Revtl$$E=\$ |$|$(<$'l$<$-(9D$$D$D$$IL$(l$L$$519<$(<u<$)\$`C$<$(C(C$C,<$(ȋC,9vG=w@L$<$(D$D$hC,s9Cs3)D$$ C,9r%<1D$(t$L^_[]ÉC9si  F 9r{$t911<$( 1 1 <$J( E1  ;k$rˋT$t$i  iƋD$(t${4$USWV@\$th$@S SN$@$@8\ $p D$ fnfpfD$`D W7jSWu2ShԤ` Wg S ujjjSӌ h@ 2SPT hDB T1|$ PWVƅt~1LPhhjjD$(PW $@D$i D$ ; u+ h? M2PhB hA TfoD$`D$0D$D$(8\ D$,8\ @@ @@@@@@$@ D$X\$D$P\$ D$PjhԤajhS W SX$@ WĬ@^_[]ƃ Wl V ffff.USWV$DU$$8|$,${t$,$̉$ID$M6,$?$DD$ D$D$$DŽ$$D$$D$uD$$Ԥz[D$D$D$$ D$D$ DŽ$($t$蘶Ë%D$$A$0D$ t$|$$@4 t$Qu苴$0t4$B4$譹$ $8\ <0fnfpD$$D$48\ D$88\ D$<8\ D$DD$@D$LD$HD$TD$PD$\D$XD$dD$hD$`t$ D$ $70\$ |$D$$t$|$$$,$-}Ĭ^_[]ÉƉ$ƿ< t$Qu苼$0t<$5A<$]$ u*4Ɖ$F|$u!L$ƉL$|$tD$$蠹Ɖ,$|4$̻fUSWV$$$(,$t$w|$,$D$葈t ,$D$m~t-$4$u|$$ԤZ1,$D$ D$D$茈D$,$D$D$$u%|$Rar!u 1|$Revt1ۅÃ,$,D$D$D$$8DŽ$D$$YDžu1$ԤWD$$DŽ$D$D$$չ$Ë%D$$%>$ $t$D$ $D$D$$þ$(f4t$Qu苴$ t4$>4$$tO$ZE|$t$D$<$$t$<$D$ $D$É<$,$y؁Ĝ^_[]Éƿ<t$Qu苼$ t<$><$=$t@$誶6Ɖ<$n*&Ɖ$u Ɖt<$zƍ$($Sy4$蛸USWV\$t$xDŽ$\`b$\@|$D$$St$ \$$D$$\Ɖ\$D$,$)޹D$& 4\)$L$\$$kQl$$Q$ DŽ$4@DŽ$0@DŽ$<@DŽ$8@DŽ$D@DŽ$@@4@,$ƃ>1u!9r3$t%>0tfDl$$D$T$1+T$lt$0414C9|ӋD$\$$0@9u 9\T1@ۿL$l$D$ 111\$+t$ t$fȺtHʉ‰)Љ)‹$0t$0Ƌt$\$E19|L$ xz$8$0l$)ȋL$~m1Ʌt@ $0+$0$0t $40L D$0l$L$$E99^_[]fffffffWV|$ GGG GGG$G G$薥Ɖ7$膥G@džf ҉ׁ GAuׁD$D$4$3^_ffff.WV|$ $Ɖ7$ۤG@dž ҉ׁ GAuׁD$D$4$胨^_ffff.Vt$t$躦Ft$諦F t$蜦Ft$荦Ft$~^fUSWV,\$Hl$DL$@|$Li YAA#Aυt$0o _+$蟣Ɖ\$wtD$L\$4$D$tfD9uT$@BAHu191Ƀ|$vtT$L.fffDfffff.fnYfn!f`f`fafaffuf9T$fpNffpff~t)FKuD$@P19L$@\$1At $L$@yq AAЉ$AL$@D$$AA1D$D$ff.<uuf.<[tT$ tLC1҉D$(fDո3l$(tL$@I+(D$\$FFF ~u$跇FFƆH ^_[]fffff.SWVt$ ~t.ffffff._t$߉<$'ۉuFt$‰t t$耉4$Y^_[fffff.WVPD$pt!f~t$o4$跇u^_ff.L$t1;T$D$  f.USWV L$ & 1ۃ|$,T$(i t$$<t~EM 3D$03L$4 ul9Mt,Et $跈 $+L$ T$(i E}L$,tEIL$ Hi ]T$t$$胄|$%Ɖ<$˅L$,tIHL$(T$$؉$L$T$5D$4~F D$0FD$ Fxtup p p ^_[]ffff.USWVcw7V-dD$PjjV;_ƅ|$D$P\$@)9rϋl$PEWSPE=EuIEthut$EMQuP?1E)x|$\$Pt$ t9Cs{t@9vAȉKPsQ{ރ67PD$ t P̓<^_[]ƋD$ t P襃 Vم fDUSWV t$(\$,l$0|$$ W]jjWa+^n USWlajvW[av6WJb^_[]fUSWV l$(\$ |$$CD$Cff.)9rCVWP#C)=CuGthst$KQsPT1Cu ^_[]f.WVP|$t?Gwt@O@O9vAȉOPwQOO61P^_ff.USWV \$ H  tN*hNgS WV<QVPjjR0ǃh ǃd ǃp ǃl t t P4ǃt ǃx ǃ| ǃ ǃ ^_[]l$(t$$ PQ׉ D$ ƃ jUVPQƀX4 PST+ƅX4t$*uxhP. PVt"EjWt$UP ƃH ^_[]L E UPX T \ jWt$PQƃH .fDUSWV t$  PQd D$h T X jPQ6n\ ` l +d h )9ڃBډڃD1ۅtZFRPQIŅ~CtNFl RQPid h l jWt$PQ؃ ^_[]ÐUSWV t$ H l x 9 rE VGt% x 9 sˀH  D$$ʉ\$)\$(r&؉ˋL$x 9ŋD$$ωً\$(s]T$ tjRQ6Ɔ SP6xL$,  9ƆH 1Ut SRPyD$, Ɔ # tj 6/1 ^_[]fUSWVtv1\$l$ Vh' jSutDPh' jdUuUhԤ# hԤ|jhԤzD$DG;>rĜ^_[]f D$$1 ff.USWVt$0|$|$4$twhD$ ff.D$$T$$uu#,$uD$ Ɔd$p,$t$t|$4$u^_[]fSWVt$ L<$XuuT|$$vt,D$D$\( $ԤX"D$$Ԥ$tH<$;tt1?|$$$t @?$s^_[SWVt$ u4$|$(\$$@r4$ @ A? ^_[ffffUWVSgxG l$(,n )t%1Ut$,t$, 9u [^_]ÍvSx[Maximum allowed array size (%u) is exceeded8RAR_EXIT* *?/etc/rar/usr/lib/usr/local/lib/usr/local/etc.rar.exe?*<>|"?*yyyymmddhhmmssYMDHISWAEN+  + 0+ T+ + HOME?*<>|"?*%04u%02u%u%03u%05u, P 04File8,  Creating %-56s%u.%03utemp%.*ls(%u)%lsv ?**Uar! . a`bpm mmn7Archive. , CMTQO__rar_ Reading comment from %s Reading comment from stdin Deleting comment from %s Adding comment to %sbak Locking archivear!{||||||||ytmttttttttt8ɝfh%uhc%ux%uxc%u;%u1  16RarCheckPassword13CheckPassword81 p1 1 vector::_M_realloc_insertym?5u#6666666666666666\\\\\\\\\\\\\\\\ 8888Xx  <#Iw0*XZWǓF\B (>VGeq{][C,kK1}Sr $|Y֍/y=®an6s9^i7? QLc3x)HˇfHa5WiَU(ߌ BhA-T @6#EgܺvT2g jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqƌhك[RQgrn<:Og jg jgrn<:ORQhك[                                   v?C2~%t,ȀO..\??\/??/UOWl_3 Done All OK Total errors: %ld %s is not RAR archive__tmp_reference_source_ Skipping %-56s Testing %-56s ------ Printing %s Extracting %-56s%s%s  ? %s - use current password ?_Yes_No_All*.*0000 Creating %sarchive %s solid ... %-58s Testing archive %s Extracting from %s ... %-56s.part1 %s: %sArchiveDetailsRAR 1.4RAR 4RAR 5%s%ssolidvolume %dencrypted headersOriginal nameOriginal time%.10ls %u %12ls: %lsServiceEOFFlags ----------- --------- -------- ----- ---------- ----- -------- ---- %21ls %9ls %3d%% %-27ls %u ----------- --------- ---------- ----- ---- %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu %ls Attributes Size Packed Ratio Date Time Checksum Name Attributes Size Date Time Name%cB<-><---->%d%% %12s: %sSTMTypeNTFS alternate data streamTargetDirectoryFileUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referenceSizePacked sizeRatiomtimectimeatimeAttributes %12ls: %8.8XCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2WindowsUnixDOSOS/2Mac OSBeOSWinCEHost OS %12ls: RAR %ls(v%d) -m%d -md=%d%sCompression1.55.0 %12ls: %ls encrypted %12ls: %uFile versionUnix owner#%d: %c%10ls %9ls %9ls %4ls %ls %8.8X %02x%02x..%02x ???????? %c%c%c%c%c%c%c%c%c*<-?->Q Q \Q |Q Q Q Q 8\ 8\ 8\ LN N N @O hO      $(,048<@DHLPTX $(,048<@DHLPT24>2424242424242424242424242424242424242424242424242424>>2424>242424?24?24242424?>EE>EEEE2s;;F<<s;s;s;s;s;s;s;Hs;s;s;s;s;<=C6CCC#C6C6C6C6C6C6C6C6C6C6C6C6C*C6C1CKIXFII(111k1k1k1k1k1k1k1k1k1:1k1C1L1k1k1k1k1d1/@-@<@/H@HHHHHHHHHH@HHHAO/_?2424?24?242424?H?@2424@2424HSJTRSpQRJTJTpQJTRRSJTJTpQJTSSpQSRJTpQ7SJTJTJTJTJTJTJTJTJTJTrTJTJTJTTJTJTJTU|j k dl l 0m m pn ,o o p Xq q tr ls $t t  -<switch 1> -<switch N> <archive> <files...> <@listfiles...> <path_to_extract\> <Commands> a Add files to archive c Add archive comment ch Change archive parameters cw Write archive comment to file d Delete files from archive e Extract files without archived paths f Freshen files in archive i[par]=<str> Find string in archives k Lock archive l[t[a],b] List archive contents [technical[all], bare] m[f] Move to archive [files only] p Print file to stdout r Repair archive rc Reconstruct missing volumes rn Rename archived files rr[N] Add the data recovery record rv[N] Create recovery volumes s[name|-] Convert archive to or from SFX t Test archive files u Update files in archive v[t[a],b] Verbosely list archive contents [technical[all],bare] x Extract files with full path <Switches> - Stop switches scanning @[+] Disable [enable] file lists ac Clear Archive attribute after compression or extraction ad[1,2] Alternate destination path ag[format] Generate archive name using the current date ai Ignore file attributes am[s,r] Archive name and time [save, restore] ao Add files with Archive attribute set ap<path> Set path inside archive as Synchronize archive contents c- Disable comments show cfg- Disable read configuration cl Convert names to lower case cu Convert names to upper case df Delete files after archiving dh Open shared files dr Delete files to Recycle Bin ds Disable name sort for solid archive dw Wipe files after archiving e[+]<attr> Set file exclude and include attributes ed Do not add empty directories ep Exclude paths from names ep1 Exclude base directory from names ep2 Expand paths to full ep3 Expand paths to full including the drive letter ep4<path> Exclude the path prefix from names f Freshen files hp[password] Encrypt both file data and headers ht[b|c] Select hash type [BLAKE2,CRC32] for file checksum id[c,d,n,p,q] Display or disable messages ieml[addr] Send archive by email ierr Send all messages to stderr ilog[name] Log errors to file inul Disable all messages ioff[n] Turn PC off after completing an operation isnd[-] Control notification sounds iver Display the version number kb Keep broken extracted files log[f][=name] Write names to log file m<0..5> Set compression level (0-store...3-default...5-maximal) ma[4|5] Specify a version of archiving format mc<par> Set advanced compression parameters md<n>[k,m,g] Dictionary size in KB, MB or GB me[par] Set encryption parameters ms[ext;ext] Specify file types to store mt<threads> Set the number of threads n<file> Additionally filter included files n@ Read additional filter masks from stdin n@<list> Read additional filter masks from list file o[+|-] Set the overwrite mode oc Set NTFS Compressed attribute oh Save hard links as the link instead of the file oi[0-4][:min] Save identical files as references ol[a] Process symbolic links as the link [absolute paths] oni Allow potentially incompatible names op<path> Set the output path for extracted files or Rename files automatically os Save NTFS streams ow Save or restore file owner and group p[password] Set password qo[-|+] Add quick open information [none|force] r Recurse subdirectories r- Disable recursion r0 Recurse subdirectories for wildcard names only ri<P>[:<S>] Set priority (0-default,1-min..15-max) and sleep time in ms rr[N] Add data recovery record s[<N>,v[-],e] Create solid archive s- Disable solid archiving sc<chr>[obj] Specify the character set sfx[name] Create SFX archive si[name] Read data from standard input (stdin) sl<size> Process files with size less than specified sm<size> Process files with size more than specified t Test files after archiving ta[mcao]<d> Process files modified after <d> YYYYMMDDHHMMSS date tb[mcao]<d> Process files modified before <d> YYYYMMDDHHMMSS date tk Keep original archive time tl Set archive time to latest file tn[mcao]<t> Process files newer than <t> time to[mcao]<t> Process files older than <t> time ts[m,c,a,p] Save or restore time (modification, creation, access, preserve) u Update files v Create volumes with size autodetection or list all volumes v<size>[k,b] Create volumes with size=<size>*1000 [*1024, *1] vd Erase disk contents before creating volume ver[n] File version control vn Use the old style volume naming scheme vp Pause before each volume w<path> Assign work directory x<file> Exclude specified file x@ Read file names to exclude from stdin x@<list> Exclude files listed in specified list file y Assume Yes on all queries z[file] Read archive comment from file <@listfiles...> <path_to_extract/>default.sfxAFUMcfg-ilogsc.rarrcswitches=switches_%ls=APLOG.rarlogSNDERREML@NULOFFVERFZ ERROR: Unknown option: %s7z;ace;arj;bz2;cab;gz;jpeg;jpg;lha;lz;lzh;mp3;rar;taz;tbz;tbz2;tgz;txz;xz;z;zip;zipx;zst;tzst*?.*.%lsFUADPXETKAFUMD%pP-ht-oh-qo-vnRARKKKKKKKKKKKKKKKKfffg-iyiii5m5mEuOm]mkmmmmmmmmnn n.n$@|4AAA4BdB B4BHDClCCDL$M@dMTMpMdNNNdO O4QRTRRDtSStTT(Uldvx{x,T4$ThԤD0dt4$4`tĽ$$ p$L$ TT0d$$&* +H,l10D3ld58p4;Ht=pdLLMPDP TP4tPHDR\RTDUVV0DWTWxWdXXTYZZ0_`tc|cjtkkodpDqtqTrHslsxDy}hD~D$d$4$ <4D@  ԣ\ d8thĵԸ0`| t|)t)),D,T,D4-- -T l.T0,0t00T101142h22P0D2d2!4"4t(8/@=3p=d=@DPCFpCtLCTFUFdV GcInKnKDp8LtqpLsM$wMxNTyDN|OPt,Q\QQ^_$,_ĿP_dt__d_`H`4`$dt(eef4fTtffdj4jTjm,mDq4qqXrdrstdttuDu4 vD w49w;dxt;x;x=dyT>y> z$?dzBzTDzG{G|THD|$K$}TKP}K|}R}tS}U~VX~DX~Y~[iDl LdPԞԳԻHx$̎ 4`$,4DДdD|4Dtd(d4 d84\ܛt<`DzR| c 0|Z`F J tx?;*2$"Tb0hTdAC_AA HUBA HP eAA A[A H]EAA H|AA HYAFB HeCp HfAA AC zPLR| $$fYAA AC ph5(`xiTAA AAC  jKAA AC  mAA AC ($jAA AAC <$jNAA AAC X,A0H J$A(A,D0H @d(kAA AAC A,A0H J$D(A,D0H $lAA AAC 8mJAA AVAAA HIAAA H, xIAA AeEAA HP<@|RAA AAF@@I@A@A@H@C@A@A@A@H@4L}\AA AOA HrAAA H@t}{AA AXA H`BA HQAEA HP ~AA APA HlBA HMAEA HCAEA H`<~hAC|~C~C|AA AAF@X@I@A@A@H@C@B@H@C@A@H@i@E@A@A@H@C@A@A@G@K@P$(pAA A_E HGAAA HEAGA HBAEA H|xDAA AAC j$A(G,A0H Q,E0H G$A(A,A0H B$A(E,A0H P,A0H g$A(A,A0H J,A0H $ĀAA AAC  |bAA AC lDxAA AAF{IAHLAAAHCAHdAAAH$AA AAC `BAA C ,XAA AAF,AA AAF@J@I@G@A@H@H@I@B@H@[@A@H@J@E@G@A@H@H@J@A@H@_@G@H@C@E@A@A@H@C@J@A@H@C@G@A@G@K@AA AAFaLAAHJAH@GHPFHQALWAHDAADHCDBDLvEHCEAHKAHbBAH[EAEHaAH}EADHlAHyKEAHJDEAHJDEAHJDEAHJDEAHJDEAHJAEAHKAEAHOAEAHJGEAHHAHCAEHlALCAELlGHbGLHGJ[AHJAAAHCHHsEH[HAAHNAHrLAAHCAH^EAAHCEAAHELAEHCEDAK8 (fAA A\AAA HQAAA HL \sAA AGA HMAAA HfA HJAAA H@ AA AAC X,A0H J,E0H m$A(A,D0H C$A(A,A0H J(A,A0G k(D,A0E N$A(A,A0H m$A(D,A0H S$A(A,D0H U,D0H ( 4VVCCE HkEEE H x , @;AC$H OACsEAA H|p $AA AAFEIAGHCAAH_BAHHAHgEGAH< \IACMBAA FLAE HCBE H00l;ACMBAA FKAE HddxAA AAFXIAAHTEAAH^EAAHAA AAFXIAAHTEAAH^EAAHNAEHCBEHtTAA AAFXIAAHTEAAH^EAAHPAEH xACDNAA ANAA HGAA HGEAA H0AA AAC j,B0H N$A(A,A0H s$B(D,E0H V,A0F K$A(A,A0K C$A(A,C0H Q$D(B,E0H $AA AAC0kAFCIAGHCBAH(,,lAA AFP|pVAFCIAGHCEABHNAAH<AAFNIAAHCEAH@JAFCIAGHCEABH@TFAA FJIAGHCAAHĞ2AA AAFQAHUEHCAHBEAAH@ADEBAHCAHTDADHCEHGHCBAH 8@AA AAF^.CAFa.CGHO.CEHP.BBBAF.CEBHF.CEH.CHHB.CHHK.CABHL.CABHH.CAAAEF.DDDDHd.CEHB. BBBBDDDDH.O.CADHHN.CADHHS.BDDAIM.CEHJ.CHHS.CEHHr.CHH.CHHD.CAHa.CHHD.CHHD.CAH.CAEXaAA AF J L A G H C I A A H C A A H 80<AFCIAGHCAH84<AFCIAGHCAH,084AA AAFAA AAF!E!E!E!A!H!C!F!E!A!H!Y!A!B!A!H!C!E!E!A!H!C!E!A!A!H!C!B!A!H!U!E!A!D!H!C!L!A!A!H!C!A!A!H!`\AA AFQ^QIQAQAQHQCQAQHQGQIQAQAQHQCQAQHQ(,AA AF, bAA AAF`AA AAFcLAAHKAEAHWIAAHBIAAHCEHCAAAHEAHKAAAHEAAAHh"AA AAC R,A0H a$A(A,D0D4A8A<AA AO ?&CLEE H O|?AA AC O?9ACxO,AAA AAFPAHCIGAHCAH]EEAHAAH`\P0IAA AAF X A A H z A A H } A A H { A A H g B B A H k A H O A A A H f H H O D A A H T B A A H e E A H Z E A H  J A H X B B A H r E H H P L E A A A H C B A H C B A K QKYAA AAFcEGAHNOBBBAAAHCSHEAABEHSHAAABGJSHAAABEHBHHCFAHCBEHCBAKR8NAA AAFZEHCAAAHCAAHABAHCEHCFAAHJEAAHCEAHABAHCHHCFAAH|IAAHCAAK0SOAA AAFnAAH}AAH}AAH}AAHwIAGHCAHYAALBAAAHCEAHpHAHBBAHdBBAHFAHTHEAAAHCFAHXUXSAA AC@]DQHBLBPBTAXB\A`H@DMHBLBPBTAXB\A`H@(LT|TAA AAC xTctThc U Y2C\DAA H@UAA AkB HCAAA HQAAB HYAAA HNABA HLC HGC HGB HGC HTAAA HIAA HPAAA HpAA AAF@|.F@F@F@A@H@P.C@A@A@A@F@Y.C@A@H@K.C@A@H@`.C@B@A@A@H@L.C@E@H@H.C@A@A@H@.E@E@A@A@H@F.C@A@H@j.B@A@A@B@H@E.C@A@E@H@.C@A@H@D.C@A@H@.C@A@H@E.C@E@H@.C@B@E@H@M.C@B@A@H@.C@A@H@D.C@A@E@H@.C@A@H@.C@B@A@H@D.C@B@E@H@.C@A@H@D.C@B@E@H@M.B@A@A@B@H@B.C@A@F@x.C@A@H@.B@B@A@A@H@F. C@A@H@A@A@A@H@P.C@A@A@H@b.C@B@E@H@.C@G@H@.C@E@H@.C@A@H@\.B@B@A@A@H@W.C@A@A@A@H@e.C@A@H@.C@A@E@,$AA AAFB,PAA AAF@@8^AA A]DDD HIE HCAE H(|AA AAF$AA AAC@ILAPF@lHBLAPH@EHALAPH@wLEPH@CLAPH@OLEPH@DHALEPH@\DAHALAPF@JLAPH@XPL@nDFHFLDPH@FDFHFLIPH@XDBHALDPH@TDAHFLGPH@fDAHFLAPH@VDAHDLEPH@GDDHDLEPH@CHBLEPH@ELAPH@JLAPF@ZDAHALAPF@,AA AAF|AC`, 4COAAE HCBE HP(0AA AACpD.CxB|AHpg.C|AFpG.CxD|DHpJ.CxA|AHpY.CtAxA|DHpd.C|EHp.C|AHp.C|EHpG.CxA|EHp.CUpG.BtAxA|AFpI.CtFxF|AHpI.CtFxF|AHpI.CtFxF|EHp.CtExA|EHp.CxB|AHp.C|AFpz. C|BBBBAHp.CxA|AHp.BtBxA|AHpI. CxB|BEHBAHpK.CtAxF|HHpi.CxA|EHpq.AtAxA|GFp.CxB|AHpN.[.CtAxD|DHpP.CtDxA|EHp.CxB|EHpL.C|AHpR.C|EHp.G.E.C|AE|Cp.C|AE|AA AAF]BAHMCHEEBAHKABAHCEAAHh$AA F@J@I@A@C@H@L@A@A@H@C@E@A@C@H@h@A@E@A@H@l@AA AAF G.C G A H .C J A H G.C A A H .C A H D.C A E H .C A H .C B A H D.C B E H .C A H D.C B E H G.C A B E H a.C H H .B B A H H .C E H .C A A H I.C A F M.C H A H X.C E H B.C A A H U.C E H B.C A A H K.C F A E c.C A A E R.C B H F.C E E A E C x.C E H K.C A A E .H E A A H .C E H j. C H C A E H H H.C A H D.C B E H . C B B B B B H C H D.C A B E H J.A B B A H C.C E H W.H A A A L J.B D D A H . C B H G G A A H . C B B H C H A A H .C A H M. C B B B B H H .C A H H X.C A E F.C A H H G.C A H .C E H .C A A H T.C E H .C A H E.C H H .C E H .C B E H .C H H .C H H .C A K I.C A H D.C A H r.C H H .C H H .C A H .C A E ((hAA AAC \`LnAA AF@J@I@A@C@H@Q@E@A@A@H@I@E@A@A@H@X\$AA AAFd.CEAHD.CEAHD.CEAHD.CAEAH.CAAHa.BAAAHv.I.CEH.CAHE.CJAH.EGAAHp.CHH.CAAHf.CHHE.CHAH.CIAHc.CAAHF.CAAHJ.CAAHJ.CAAHF.CAAHF.CAAH[.CAAH.CBHHh. CEAHĻHȻG̻GлHH.CGFHg.CAAHF.CAAHF.CAAH,.CEAAHt.CHH.CAGHW.CAHs.CAAHF.CAAHF.CAAHF.CAAHF.CAAHE.CAF[.CEHO.CAAHM.CEHO.CAAHQ.CAH.CAH.CEHO.CEAHN.CFAEL.CFCHf.CAAEQ.CBHF.CEEAEC.CHHR.CAAL.HAAAH.CAMP.CAFN.CAH.CAHK.CDHO.CBEHD.CEHQ.CEH|.CAH.BAAAH.CEAHa.EEHDHK.CDGEHV.CDAHK.CDGEHV.CDAH.CHABH.CADHL.CEHa.CAAHF.EHAAH.CBHHp.CHHr.CHDHG.CDHHH.CAHDH.CHH.CAAHX.CAAHF.EHAAHe.CADHHU.CDBEH.EHEBHK.CHHD.CAH.BAAAH. CBJAĻAȻA̻AлH[.CACAEk.CHHF.CHAHJ.CBAHHZ.CHHHY.CAEn.CEHHH\. CABBĻAȻD̻BлH.CAHHa.CBHH.CHH.CFAGHK.CHHDH.BBAAH.CAEa.CAE. CFBDĻJȻH̻DлHK.CBDH.CDH.CBDH.CDHp.AAAAEf.CAE.i.CEHO.CAAEHh.CHHl. CBLGĻGȻH̻AлH. CGBLCĻHȻH̻AлHM.CEH.CAAH.].CAEh. CBJAĻAȻH̻AлHT.CAE.BGGHH.CHH.CHHHK.CAHGH.CHHk. CBBĻBȻB̻HлH.CHHH.J.BAAHH.CHHe. CBBĻAȻA̻HлHN.CHHD.AAHHHR.BGGHH\.AAHHH[.CEHD.CADAH.CHHY.CHHHF.CEHD.CAHT.CBEHD.CHHI.CBHHK.CABEH.CHH_.CEAAHO.CAGH`.CAAGHY.CAAH\.CEH.CAH.CHH.CHH.CAKV.CAHG.CAHK.CAH|.CHHL.CAHJ.CHH.CHH.CAH.CAELAA AACJECBHBJH H8AA C  AA AAF^āLȁÁAЁHZȁB́AЁHIāAȁÁAЁJsȁÁAЁHsāJȁĆJЁHCȁĆAЁH7́AЁHĆAЁHṔAЁHGāBȁÁAЁHAȁH́AЁHẂAЁHŔAЁHJ́GЁHVāBȁÁFЁFԁB؁D܁JHf́GЁH\ȁÁAЁHIȁÁAЁHLȁÁAЁHJȁÁAЁHQȁÁAЁHMȁÁAЁHPȁÁAЁHHȁÁAЁHdȁÁAЁHIȁÁAЁHIȁÁAЁH|ȁÁHЁHCȁD́AЁHbȁÉEЁH $AA AC HdACldAA AAC o$E(A,A0H C,B0B4B8BAA C y?AA C $y@AA AAC@(yCAA AAC$z,IAA AAC  yJ AA C XLz KAA AAC |,A0H W,A0H ^(A,A0H p,E0B4A8A> M D*   B R / q  ;  " E gb"  v  { ][ii K, o4B>ƁjX hfZ f.?lm"jlld|hb4l+c][ B_iD@ >D!D)'[y3큀WWg"A)j$,$0$2GcxD)'''U|3ÀATo8;][G^MKIHM,BN""A)j# NNPP/) S)'!^ÀA<<Z +'br" L^y'"q][  ("xN3xF&|yz|ꀀh- W ~yhwN  PX.;;y9yii#o#0[/  )   p \   /)&~K14 + K %ELSDA+,/ z|th7K, * $?  | .a d 1xb,|*v5f\ `Z~rJf0T^^B X7^R#VPEE M(u  fA M8K    @)'yhw큀 SO^uSI^SR^FSYR^Kh6KIhKhBKUh4 I_ \rꀀh-=; 7M1UCr#}C!yhw)',,]4>ÀAzz?P #'_)'FFT)'d7#.][7 , OoNN%T|0EdbC>~z/~ 8 x[vqBꀀh,ShUW5UVQ8Syʃg g y )   + 4_:U\lw 9L5%(<n8*< ,oF2Ofk~!!Py~T08lI4@@n1yhw//9pw+g M:}M{10yafQ(e3ze 0 ! ~e4 <! A gV  >  0 p\ { w sy 5} S>y &} $u Af)'*ÀA937 E411HÀA'C[S4)'** @6ꀀh++ 1= +O%]kt7)'q2P)'YY y3` 'W&}RiT Y W u ]:U+H;()'AA _M'&k! k{uk rk 0Pkk6}pրNd$hD GPOYW&)'AA _M' )'LL$~p#)')'SS s;)'4,2][*Z\jR6uLL4#$@&' #8%!2)'  !q-^KKs2@*rQÀA! WÀAP^h];mN*(gp$$A$A a  w '%Lu!PNbG;4U]{00K$TG$hC$$yOA$3$N?$Y$jS?$r #?$ $?$%$/?$t $~$#$W #| $#$$ 5$5 g I5$! !$ [$ jW$ Am$MO$c$a$8u_$m$O]$Dm$sg$MY$ U$Sm$i$wDmk$4S$qQ$J '5$!#B!5$"##0400(vZtb-yhwꀀh@u q" {# yA}$ꀀh 8W$Po PÀA008j;usPg  + K큀P?` n-$@*GG [y DEx!ct b@\dӁXX q   C S  +  X% W+ FÀA--H(Ɓ9X Z T R'XrNPg\PX% L1lӁNN % 9 G ,  J  @   0  D )'AyꀀhMM: ><C0 B@ÀA"".pwuoo 8H,]H7F*:)'\\22n2222O2M2@Z222n 22GE e2b 2u [ ,2 c_ ,2x 2x{2wZ2F2 X22y>2UV2 2 V28T2TvK2tT229"2[2{m2 2 !"/$2I$$2$'2'u(2(Y*2+,.,2H,E.2.21T2A2ÀA+ .)'mm 7ygrv    2m$T bq}FV)' EPP ]m k sxx  B" ` B  ~ ~ÀAF^x=)'D @)'XXh3 /Zs  FYN<<Ld| 4++ K(s ^` N;`E=6'H 8LJd4 2!$ 03 "X "* U   .; '&j L, (  x}}  "  Nv32 0^>4EB2JE#  x}    0 $   @~r!>f%Fa  nkGjc\tfhLS\#c-*U m%p(#3M"+.:SꀀhY9*Jc,WyL0Y8Ln4mM 4Ӂ  p %(I S $Y H+1Q M $O  XK -U  5G 6 du//f' CW(I)' >񃀀 w0(Xf# C|*^zD  ]7 E M o3 } wy&Jp @sWupꀀhww ^;  Zꀀh||$!D6 vS`889qY 6   3G- ;S~cӁ++ C m 8 L? K0{ )](@%eӁ l z)~@|ahu'$njnjpfZ& +)'%)'&& 2N ==JB)'YY |e,yhwiA'<ZV4,NN /7GR_ TPs}  *   ,o   (<Pooo&6FVfvƙ֙&6FVfvƚ֚&6FVfvƛ֛&6FVfvƜ֜&6FVfvƝ֝&6FVfvƞ֞&6FVfvƟ֟&6FVfvƠ֠&6(:P˙ %)SQ5Y+`m@f4I6R>(i ƉҀb\/HȪr[ j5XH!GAr dt$@8D4ܡ 1f"`M@ f`0@&&xPZ 73G9fp%0n#4 P;ML(v 7YĀBHCGC4`GJ Y @&4$v0j  APP?(F@h6ɡ8APf+ bfj&@gK&dbqAɦMK L&*ċb2d$fqC31f30 34@ Ff(I3Efa Ș 34`Lh bf3F(2 LFhAȅ^|&ޜxhq۲I8n*,A+I/A'H/ vmA[YD\lLN?wF lZ \F$D%E &%X80 NU3`Z#MD2ZDĦ$8 F$2TRűpGCC: (Ubuntu 7.4.0-1ubuntu1~18.04.1) 7.4.0clang version 6.0.0-1ubuntu2 (tags/RELEASE_600/final).shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment TThh !o\+  3 ;o"Ho W <<P` B(i#d`o@@!xPP!ˆ~* 0* 0( ̨d0> 0`E \G  ,, 00  s    " $  0 a rar/default.sfx0000755000175000017500000064364414462150076011345 0ustar zzELF4C4 (444  TTT00P>PPhN>hhh Ptd$$3$3TTQtdRtdP>PP/lib/ld-linux.so.2GNUgA qgjo(ȁ ҝcŬKx fUa&9ByIk1YK'[ai*Z zRDz#sDPp=_yxqF +7bl 5EZ73 f|`,!,!mQ! !=b !zlibstdc++.so.6__gmon_start____cxa_call_unexpected__cxa_end_catch__cxa_throw_ZTVSt9bad_alloc_ZTISt9bad_alloc_Znaj_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEE10_M_replaceEjjPKwj_ZSt9terminatev__cxa_begin_catch_ZTVN10__cxxabiv116__enum_type_infoE_ZSt20__throw_length_errorPKc_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEED2Ev_ZSt17__throw_bad_allocv__gxx_personality_v0_ZTVN10__cxxabiv120__si_class_type_infoE_Znwj_ZNSt9bad_allocD1Ev_ZTVN10__cxxabiv117__class_type_infoE__cxa_allocate_exception_ZdlPv_ZdaPvlibm.so.6libgcc_s.so.1_Unwind_Resume__udivdi3__umoddi3__divdi3libc.so.6_IO_stdin_usedputwcharfflushexitsetlocalembrtowctowlowerwcsncpystrncmpwcrtombwcspbrkftruncate64mbsrtowcsclosedirsignalstrncpymkdirreallocfsyncclocktowupperstdinmemchrgetpidchmodflockfgetws__ctype_get_mb_cur_maxisattylchownsymlinkgetpwnamstrlenwcschrmemsetlocaleconvstrstrutimensatrmdir__errno_locationtouppervfwprintf__fxstat64getgrnamstdoutmemcpyfclosewcscmpmallocgetpassumaskremove__lxstat64opendir__xstat64stderrwcscpyfilenogetcwdfreadrenamelocaltimelseek64mktimereaddir64wcsdupvswprintfmemmovefopen64wcsrtombsaccessstrcmpstrerror__libc_start_mainwritewcslenwcsncmpwcsstrfreewcsrchrGCC_3.0GLIBC_2.0CXXABI_1.3GLIBCXX_3.4.21GLIBCXX_3.4GLIBC_2.2GLIBC_2.6GLIBC_2.1          )0P&y ii @ӯkq#t)2cii >ii Hii Rii b`hkpimgln  $(, 0 4 8 < @DHLPTX\`dhlptx|o !"#$%&'()*+,-./0123456789:;<=>? @ABCD E$F(G,H0I4J8K<L@MDNHOLPPQTRXS\T`UdqhVlWpXtYxZ|[\]^_`acdefS<t[5%% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%h%h%h %h(%h0%f $Q! ffffff= Rtfo@fo fofo%ff.fofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvffffVfffffff1^PTR#4P`PQV P$fffffffffff$ffffff=t$tUhЃÉ'Í&'-t tUPh҃Ít&Í=uUlÍvÍ&'U]fffffVD$t$90 s+, ( PQf, Fh jP;F$Ɔ Ɔ dž fdž@dž< dž8 džD dž@ džL džH Ɔ dž dž dž dž dž dž ^SWVt$\$( ( t Pdž, dž0 hCSVGG Gdž, dž0 , tPW dž, , tP( 7^_[lD$pWL$L)D$@)D$P)D$0)D$ )D$)$L$DD$`@@ @@D$<@<D$4@4D$,@,D$$@$D$L$H@@HHD@`@\lfSWV|$ GOD$$9ȉGvhW t.9v*T$D$$QR$QGO\ 9G؋\$$ƅu $Q7_^_[fffUSWV $$ D$$kD$$QE|$ D$|$$G$c;Ɖ4$%!$D$D$T $ |JmtCED$4$)t/E$LtT$@oAo fpfpJ u9t$)D ffff.IuD |$  D$P11R)؉D$fff.E;$lsQt,RT$9u$h\$ D‰苬$hA|Ջ|Fu1ꋄ$hL^_[]@WVP QD$1AF=Q hVPlLJ^_SWVT$t$D$ffffff.8 t tu1tJ11@t "u$@"t tF tAt39s/tg|$\$ V~ @fy/t H}j.QdttWhV$^_[^_[DVt$t%4$~ @@y/tH}1Ή4$D$.^@Vt$tU4$~ @@y/t H}Ή4$D$.tL$$L$&1^ D$thP1  D$$1 f D$$ fDVt$4$t|/tA;L$s/D^USWV $, $$ $ \$hVS 6 Sut"|/tAwD /DhUSWS$4 y ^_[]fffff.SWVt$||$N W~ P@y/t J}\$)9r(~4@f.~/t H})VWS^_[ÐVt$4$p~(L9/tHP} qM^fUSWV t$ 4$~ @Dy/tH}>u v΃>to4$|$v9vtfD݋E$S]9vu9v.t$1u9w ^_[]É4$D$.j9C߅D߉fff.SWV|$ \$$!<$2~ @y/t H} $D$.ƅ~t,4$D$t4$D$kى4$D$))L$>.~D$(F$*F $4$WLA:LD9@H.4A0H@:t\$D$$_\$<$D$<$~ @fy/t H} $D$.ƅt >.^_[É<$[Ƌ@:ufff.9F0r@$t2@:t뮍F)D$$)\$w닉<$N9t9P@u1_aTfffff.Vt$j:Vt1^Ët‰D rt.uQ/uf.QuօthVf.USWV t$ .tu\$$ Efff.UW& ut __t" t.t :t D~/u_nu ^_[]fSVT$D$Jt.t$ 1ffff.\/tt߈<A9r1^[fff.SVT$D$Jt.t$ 1ffff./\tt߈<A9r1^[fff.SWVT$D$Jt/t$1fff.<\/ttA9r1^_[fDSWVT$D$Jt/t$1fff.\* UstQfff.EjUP8*t&u <*u U"u11$tu 1l^_[]ÀЉ<&fnE0fpD$$D$4&D$8&D$<&D$DD$@D$LD$HD$TD$PD$\D$XD$dD$hD$`D$ D$,P$*|*҈<*t j}`E UP8*Ɖ)D$ U8*tu!t ̎41EjUP UbuD$D$D$|$ D$ˉE@jjSUЃuE@jWUЃ Vjt K41foD$8*EjWVUPt t80hUP:dDžt V[ W fff.SVTt$`D$dD$4$4$D$&L$fnF0 $fpD$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P9D$HD$4$P 1ۉ؃T^[fff.L$1tOrJL$9RuAyau;yru5y!u/yu)yu#It u ø1fD D$jPQÐT$D$tكufWVt$ $D${$D$ e$D$O$D$ 9$D$ #<$ $D$$D$ <$D$@$D$ `$D$ <$/x$D$$D$ m$D$W$D$ A$D$ +<$$D$$D$ 4$D$8$D$ X$D$ <$7$D$$D$u$D$_$D$I<$~x$D$($D$$D$$D$<$n~<$m11 u33 &0fnfp$DŽ$&DŽ$&DŽ$&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$8DŽ$$$$D$$QW1B8*tuu>,$D$i;H*t#,$D$i D*8*D$,$iL*D$<$Í@*L$<D*Cf\$<`*4$荧CF~KNf,$]jft*,$njx*h*ʀu ft*‰Ȁ$|**(*c$&fnE0fp$DŽ$&DŽ$&DŽ$&DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$DŽ$(DŽ$ $$$\1ƅD$$Q~),$11 u33 &0fnfp$DŽ$&DŽ$&DŽ$&DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$DŽ$(8DŽ$ $$$@D$$Q}1 $<$WD$8<$zUD*<$lUH*P*L*@*D*;|$88*&u0fnfp$DŽ$&DŽ$&DŽ$&DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$DŽ$(DŽ$ $$$ƅD$$Q|ƅD$$Qv|&fnfp$DŽ$&DŽ$&DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$DŽ$($DŽ$ $$$1$yH*D$0t($$-S;L*ЃH*$L$4D$<t$$RD$<:86420.,*lj4$q|&"  $D$@`t$Dt4$4$)|$t$&}<$~ff.VXt$`&L$fn $fpD$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HF0D$ƆD$$QVoX^ÐUSWV |$ <$-ƅtNl$$fffff.t 8*t)u$98*t<$<$Cu1 ^_[]ffff.USWV |$ <$ƅtrdnfff.8*tPtt-f;$8*uD$$,$D$}t<$d<$$ $7:Ƹ|$\C$ t$|$$;7$ t0<$9\$`Ƹ<$Ct$\$:3$ @t<$9C@t<$9CƆ@$ uF1)ʋ|$D9WsЉ+G<$D$dvWT$4$D$K:4$.9$ $ 4$*8< $L$ D$4D$É$4mfo$L$tG9r^_[]@SWVL$D$t-T$\r|r \t9΍vr^_[USWVt$l$|$OD OVwEEωօuf.=w)O|!$? ]Ef.ǁu!:u 8$=w0I|3 ]$? ?ˀ]EO=DI8] ?ˀ]$? ?ˀ]EE^_[]fWVL$ 11t|ffff. @XCw#u#q!ցux B@qu@^_fUSWVT$D$ t$$ $Nffff.JxFʅSk<$uIDu. ˁ? υuT ˁZ݁??  ˉ߅'فutju`D$Bub???  NjD$!N8| $$$$^_[]ËD$$fff.SVPt$4$Xu@IFtuy@tg t4t*t tu5fff.IFBffff.tu JIF}1^[ffffff.SVL$tsT$ 1y7@t_ t(ttt u-IBr FtuNIB}u1^[fffff.USWV \$ |$$$XƋ$W9u-f|+t,+$WƋ/$W9t19D 1 ^_[]USWV \$(1tjt$ l$$$WNjE$W9u8|t29t.$ZWNjD$$$IWE9t19D 1 ^_[]ffff.USWV t$ >tI\$$;tB1D.$uXNj+$hX9u|+mu~vu1 ^_[]ff.+Xff.Vff.USWVD$0H-E19WЃ w01 1Z9ӃЃWЃ r܉مHȃ-Eȉ^_[]fDUSWVD$x-E/EЃ w=1 1ffff.Z/ӃЃUЃ r܃-ƺŅڄDDӉ^_[]fffffffff.Wff. =RthhQRFà fffffUSWV$ $$VS't0C8t%t%C;u K1;Otu 1tC<VPt3Ctt(t(CL;u KP1;OtutCxVP蜐t.ttt ;u 1;OttTVPWtt;u 1;Otu_ uk}SVQl^_[]fDUSWVl$y$$$UPцt094u&$ooftf=~xUP芆t09u&$ooftf=;UPCt09<u&$o oftf=UPt09u&$ooftf=l$phU$| UH$\$ L$LRQSL$8Q$jWPU< hU$Hi..4$WP G .$H.. .D$D.,D$<.$D$,L$4..D$T.@D$d.PD$LL$\.H.8D$ L$.X.`D$.hD$$.pjjj PD1 iD$,>,D$D>$D$<>>L$4D$,jjj P>PD$d>HD$\>8>@L$TD$L>X>`D$ L$>hD$>pD$$$t+D$$CD$CD$ L$K$t<1@T LA0 uD$Tj P~}t($  L$8WhQPVR[ D$4j P@}l^_[]fSWV0|$@t$D GD$ D$\$ jjjjPjS] GfnL$fnT$f`fafnD$f`faf`faffnL$f`faffnT$ f`faffnL$$f`faffnT$(f`faffnL$,f`fafffof fpffpffpfpfbfpNffpff~OuQG\$ jjjjSj PW D$(GD$ G~D$~L$fO fG0^_[ÐUSWV |$ 1<$IyG1$D${G$D$m{G($D$X{G8$D$C{_<$xGL$D${GT$D${Gd$D$zGt$D$z_x$x$D$z$D$z$D$z$D$uz$x$D$Gz$D$1z$D$z$D$z1$w1$D$y$D$ y4$D$y8$D$ yX$D$ yx$"w$D$Wy$D$ Ay$D$+y$D$ y$D$ x$v $D$x$D$ x<$D$x@$D$ x`$D$ yx$v$D$Kx$D$ 5x$D$x$D$ x$D$ w $SLJLJLJD$D$<$C ^_[]Íƍ $+$x$${ƅuOsƅuƉ$v)߃ff.$Hă1b $0 $L $L $L $L $L VUPS0hD$P~uhVmu ^_[]ffff.USWV$hh=ƅt)VjU$$<ǃ VA9D$,D$( t$4V VrƉ@‰=R1ۃL$ T$|$JD$fo=0fnfnfofo $fbft$fn<fpfofofffL$0fo @fofofffofofpd$Df$ff\$fD$PfoPfT$pfrf$foft$@f$ffl$`fo\$fofofrfrffffrfof$fffbfjfo$fofoffpNfpNffofffofffofjfbfofoffpNWfofWffpNffoffofjfofbfffpN׈fofpNffo$fofffoffofb-pfj5pfoWd$@߈W\$ffpNffoffof\$PffpNffofo$ffol$0fo5ψ($WL$pfffWfL$`fffgfoT$pffot$@fgfo `fgfo\$!fofffffffofoD$Pfl$0fol$`ffX9Ӊ֋L$ T$tQ,\$É΃8֋T$ ؋\$L$ D։$1@T$C9uD$R^_[]ÐWV|$ G$D$pG$D$pG($D$pG8$D$p^_pƉ<$p4$oFffffffWV|$ G$D$DpG $D$ 1pG@$D$pGD$D$ pGd$D$ o^_~oƉ<$to4$EffffUSWV |$$t$ 9GʼnL$)͋N)9v5@ U|6ǃUt$ WI<Yvt$)։9s*t_Vt$ R <t$ G~+Gt$ tTUt$ R;A1t P8>F#t$ L$|$1ҍ )tPQW;^ ^_[]E6ffD$xtfo@fo fofo%fffofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvffffffff.SVL$D$ t(T$fffff.B03RIu^[fffD$@@ @@@@@@D$@@@@ffffff.L$D$AA AAAAA@USWV T$ \$$ztjjB)9)ȉ߃ǃWR>FWRPQƋD$ (WUpD__;t5SRq>OGSPQRw ؉މB1 ^_[]fff.SWVt$t+|$\$VS>CVWP@3s^_[fDL$A;As PQ 1DL$QB;As Q1ÐVL$1Qr;qs Q^ÐUSWVL$1ҋqAn9s9^<7Y119Ÿs9|$$|00\0 (1q |$ ڋ$ ^_[]USWVD$($HX9ˉL$D$(C111D$fDT$(|$4$1ZT$||$  EE|$4$|$ IIy?w;\$[$r$ $1ҋ$^_[]ffffff.WVt$ L$1V9v!61<y |@9r1@^_fUSWV L$ l$(\$$yA)9BtVPS 1L$09s)UjS 5q ^_[]fffff.WVP|$t$D$OTq;WsVPQhwVjP4^_DVL$1yr-D$qEPRj^fffff. T$JrQPjЃ ffffff.USWV D$,L$$);l$(sY111|$|$$t$n/|$ 4714$ EEt$|$<$IIy;l$(rD$,11 ^_[]fffffD$@@@ USWV(|$LD$H1ҾD$tD$|$T?97l$\$|$PD$ D$B;T$Ds;T$Ts D$@mыl$Ll$<ft MD$H 0FME<,<D<l9F$D$H0+|$DƉ+D$T9D$ G)v9ʼnD$F݃l$l$PDl$@D$D$ 9GD$9F)|;|$v|$Pl9D$ |$,D$)|$:1fnT8fn8f`f`fafafrfrT\9|$uƋD$;D$4$9smD$H|$P0F D$RfF9sJD$H7|7 NjD$P<%f9sD$H|$P0FD$D$|$LB;T$TM]s9D$TNɋL$PE(^_[]fD$ff. hhrt$Gr fffffUSWV @$(@$$@$ @<$,MÃr$$$@\$<$D$z,t~D$ <$D$D$5N$$@$ D$\$$NƃtuPD$ \$$%@$$@ #/\\ ED$ $5Lubt <$$Lt_|$ D$ $y+D$D$ \$$u+u\D$ \$$.t1u<$$@exD$ \$$M?uD$ \$$-u$$@<$Hlj$GuxD$<$?‰4$$D$<$v- @^_[]fDUSWV ֊T$ ffffff.O?t-*t1 9tԃ.t׃\t҃.tuO_.uv/*u"4$D$.+uG4$D$.+txt-Ή$D$+unD$.,$+tST$ t/ffffff.ى<$u1~vu1 ^_[]ðɰty#|$ tl$<$, l$<$h=WVP|$t$Gf^jhʚ;PQx)$ D$ P+lHHANH NHN HNNHN@F jhʚ;w7'F^_Ð D$Hf^jhʚ;QR(WV4|$Dt$@GD$GD$ G D$GD$GHD$D$D$D$($'ʚ;GjL {V4^_ffff.ʚ;L$d$jL {Qf D$jjdp0+(Vdkt$dL$d$ ։q^@L$Qf^ff.jLL$ D$T$ {HSWVD$ Hf^jhʚ;QR'D$ D$P)HPxp @  ` ȃ^_[USWVP?L$MT$|$\$l$ D$$D$D$0$8&ʚ;jL {V<^_[]fUSWV L$ I f^jhʚ;QP}&D$ D$P(plH xXhF|$,tcD$jhʚ;D$(p0L$$Pt$SWt$VUht$Pt$PF%04t$,ht$09SWQVUhDt$@t$@% ^_[]DVt$D$$#ʚ;d$jL {V^fffff.D$T$L$ Jfffff.VL$t15Q°kd9ui9^fffffUSWV t$ D$$g,$g$f$0 lj<$1~H$0 lj<$~LF F$F F,F(F0fFXFZFFfdžF5F1F<F8F`F\FhFdFpFlFxFtFPF@FDFTdžF|dždždždž ^_[]Ɖ<$" Ɖ$e,$eD$$e4$@%ffff.D$@ @$@ @,@(@0f@X@Z@@fǀ@5@1@<@8@`@\@h@d@p@l@x@t@P@@@D@Tǀ@|ǀǀǀǀf.WVPt$~Ht<$v<$R!~Lt<$v<$;!$]d$OdƔ4$Ad^_ff.USWVD$8l$0\$4ǃD|1D$D$fE4}D$ uut$@uEulEpt$M(U,)‰M(U, EY tD$uTjUt$)[fDU(M,9ȃL…f}Yt*Dt9}L$ƍ )΅NƋL$  QPEE4VSPQ}3L$ E@*EȀ VSt$re1D$E4}0+} L$ (*T$]$}lL$]p}|Rt$SWD$ JT$L$Hu.;EPt)t$t$SWTKPKuxut` }Pt!t t$ t$IL$Hu.;GPt)t$0t$0VUTKPKwxwt_ wP ^_[]SWV\$|$t$~^~ t9^r.SWv^)^~1uSWv8N^tVx~2uƬSWVdc^_[fffffff.T$L$ D$tP4tH8@Pfffff.VT$L$ D$r1J^USWV L$$D$@l$<\$8|$4T$0t$ ɋL$(t" PUSWRt$LQjvH>0 PUSWRt$LQjvL0 ^_[]ff.T$D$ L$B JBfUSWV \$$1{t$@S**L$ u)** u19}:Ɖ׃) ^_[]Ëf ht$hzW0SWV$$ hQS ƃ jtc\$hSW6$(D$ PShhhh*VhQ ^_[ffffff.USWV = tY$  5H$$|$l$hUV6WUS S ^_[]f $$$k$$V$n ÐD$ fDffffff.USWV  ti$  5?= $$\$DNj8l$hUV4SUW W ^_[]DUSWV,=u $Qa$@&l$D$(|$ fnfpfD$u;a$t$ 4$D$N<$D$Nt($<$D$L$#fff.$D$$($( 4$=rufoD$DŽ$$<$fD$ fD$0EEE EEEEED$hcD$dD$@EZuXuO$DL$h|$ |$4$<$D$M$Ht$$K4$D$vM1,^_[]DSWV=׉u($@$FD$$QR=t|$4$mD$\$D$D$$'|$t$$׶$D$LD4$7)^_[ffff.WV|$$t$ $=u($@$yD$$Q|$4$D$ uD$$QR4$(^_fUSWV\$p$^11݃D$(D|$4$y*t$$4$D$_tD$$|$(D$1T$ th1ɍ$f.D(L$$ݽËD$$Ͻ9ñtD$ʀ9sGƠt f.|$ ċt$ €քuD$$D$Z 1ҋD$(T,]D$_$#Dž|&$\$G1L$ DD$ $|\,l$ۉ~'fffff.E$D$MNu$  DD$L$l$\$GŠ9xD$11ۉD$$D$TD$2$$D$T$H|$u*1$T,;tF9r1F\^_[]f.USWV$4$01fffff.<uJ|[uCs9r:f.F9s+"$&u<;tffff.C9r1ۉD$|$B$l$$4L$D$L$9r$|&^_[]ffffffVt$h!jV(0F dž0dž4dž(dž|dždž8^ffffff.Vt$h!jV(0F dž0dž4dž(dž|dždž8^fffffffD$@@@ @ ffffff.D$@@@ @ ffffff.Vh&t$pfnD$fp$fD$fD$ fD$TD$PfD$@fD$0D$XRF$X$D$$tF$d$D$D$ Vh&t$pfnD$fp$fD$fD$ fD$TD$PfD$@fD$0D$X:RFh^fff.WVt$$|$ $Wu u^_Åt!t$D$$tt$<$r$f 0$D$D$ fVt$ D$$D$D$4$@ $$W$xD$$tF$ $D$D$E f t$jt$ WVd$p~ $t&|$`fn<$fpD$dD$t&D$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$D$`P& $|$$D$蘭&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$TO>wFd^_ffff.Vh4 $t$h$D$t$袬&fnD$fp$D$D$,&D$0&D$4&D$<D$8D$DD$@D$LD$HD$TD$PD$`D$\D$Xt$^Nh^fDL$D$t!u!8w-@Ãtu8u@Ã8 t@Vt$ D$$D$D$4$0 $S$D$$tx F$S $D$D$ f t$jt$ L$D$  Aff.Vt$ D$$L$(L$D$4$`$R$(D$$tF$$D$D$ fWVd$x$t$p&|$`fn‰<$fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dK$[ |$$D$o&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$+KFd^_fUSWV\$p~ $x$t$P l$\$D$l$`&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$Pl$JÉ<$D$PuF 1ۉ؁\^_[]@WVd$p~ $t&|$`fn<$fpD$dD$t&D$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$D$`I&$|$$D$蘦&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$TH$N$\D$$t>wF$$D$D$$ VX $d $h $XL$t$PhV&fnfpD$\D$l&D$p&D$t&D$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$X t$dV G PrhVP舤&fnfpD$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$PD$LD$Ht$ D$P@FX ^DWVd$x$t$p&|$`fn‰<$fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$L$`DŽ$D$dbEm$|$$D$ߢ&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$DFd^_@ t$jt$ WVd$x$t$p&|$`fn‰<$fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dC$|$$D$&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$B Fd^_fWVd$x$t$p&|$`fn‰<$fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dA$K|$$D$_&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$A Fd^_fVXD$dt$`&fnL$fp $D$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HD$`@> tFX^ffff.VXL$d&D$ht$`fnfpD$D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PL$L$D$HD$ $?> tFX^ffff.\L$d&D$hfnfpD$D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X!L$L$D$PD$ $>=Qw QQ\WVt$$|$ u u^_Åt!t$D$$t:t$<$$0$D$D$x D RQ$@C$@s $[VD$L$AКEVjVj^ t( Ptt$t$P11 @ x fVt$c0^ffffffD$D D$t$ Vt$>u$^WVPt$|$FGFGFN O GF t?PWJ#NN$w< DG~ F ^_ffffff.USWVXL$pAm|$l$G=KW7T$1҃1$n_t9 $t9rffff.U\$xсy) x U9rOA=Qw1ҍF9GD$ L$ t$)T$1ҍ \$0$DD$1ff.9raL$\$\ 4L$\$)Ή)L)ߋ\$L)މL9t$9\$O9͋L$ OƋt$*<$C9r1T$D$0RDT$1D9rgL$t <2L$t$)ω)щLt$+t$L+|$L9|$|$|$9t$O9ϋL$ O֋t$*C9r$T$D1҉D$@9r[D$L((4 L$D$)Ɖ)щL+|$L+t$Lt$9t$9O9ȋL$ O֋t$*$C(9rt$ A9T$0L T1T119rnG=1XO1҉ȁD$4AGD$3, $ߋ<3<3 3< ͉|$<$3<%3 3$3< T$3 3 5t$Bt$$fff.3n3T$3~L$t$3N\$$,L$T$3,%3 3,  $͋ 3 3 \$(\$3  Ƌ$33 ڋ\$L$3 T$($,$4343 t$3 T$J fL$,$T$@<$f3]43}(3M,3E0\$<$ fn \$\$ ։t$fd$f`faT$$$|$ t$fnfl$fnfD$ fnf`ft$fafr|$f`fafffD$@frffoXftfًt$T$L$ foIfoP,^_[]ffffWVPD$|$1Gt% h.ƃhjVw ^_ffff. D$xu@ t$ ËD$HL$ʃHD$P  +H@WVPt$|$F t~u$p~ F^_fUSWV(D$HL$DT$yZ|$t$|$1!1ЋT$ D$3r<3r(3rƉr3J,yZ1!3J1$J ȉyZp$P l$ \$|$1ߋ41,$\$34P\$T$l$34ƒT$34Ɖ4.np P,$41ݍX3l$ 34l$34HL$34Ɖ4.nh pT$P,T$3,p 3,T$3,ʼn,$$13T$T$ l$n,t$|$T$ $3,pt$3,3,ʼn,\$11T$l$ 11ߍnt$<$T$T3t$3D$3‰D$׉:n$^($l$ |$` !<$! ֍P 3,T$p3,t$ƃt$3,ōܼ,h T$T$,։T$! |$#t$ p3,pt$$3,pt$3,ʼn,,$ܼ|$ ,$!h #T$, ֍Pt$ 3,PT$3,T$3,ʼn,2ܼމT$ ! #$ ֍P t$,T$3,PT$3,T$$3,ʼn,l$ 2ܼT$! !|$ ֍P 4$33D$3‰D$։0ܼD$8>\$<Ds$S l$ ؃4D$343T$1,$ՍSl$3434Ɖ4.bʍk sD$<$,D$1ǍC3,3|$ t$D$3,C|$D$3,ʼn,=bʍk {,3,33,ʼn,$$13T$T$ kbʉT$ S ttuF$rF^_SWVt$\$|$uSWv轂FuSWv^_[fff.USWVL $` $d  ttt%fHJuHщJFX1f ,ڃ<9ߍ ,, ,,t5h+P +,+,@w)89ߍ9@999$0 $4 $8 $< t1h0 P}@ $@ D $D $H H hSPD$d PWL ^_[]ffffff.L$19uAffffff.WV$t$8|$Wt$<t VWp$t(L$41tut uuD$;A$^_1uuoD$oIftf=uoD$oI1ftfɁtfffffffSWVp$$<$%$K4$D$D$\$p<$D$\$T$p4$D$|$T|$$訸&fnD$fp$D$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XD$Pt$I$Q D$ $Q٩.&fnfpD$tDŽ$&DŽ$&DŽ$&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$pt$pfD$`4$`foD$`4$fD$pf$fDŽ$DŽ$f$f$DŽ$ D$ $Q訨1ۉ؁p^_[f.USWV $ $( $$ dhuO9BWVPV3Bكl$SPU0D WVUW ^_[]ffffff.USWVl$$$lD$L$$QdhD$l$<$轲m<$HDt$l)͉D$4$l$D,l<$h4$0Džo$4$D$hGl$D$$l$ &0fnD$fp$D$ D$0&D$4&D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`\\$D$Xt$D$ $QjD$h4$D$Z-<$&fnfpD$ D$0&D$4&D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`Z|4$/&fnfpD$ D$0&D$4&D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`[0L$\$D$XD$ $D$$Q(l^_[]ffff.USWV\$t$p\$\D$\$<$Nkt3k,$it@mlu@klt*l,$mt @m kBmm$L$D$E&0fnD$fp$D$D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X\t$D$P|$ D$ !,$&fnfpD$D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XZ|,$&fnfpD$D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X[0L$t$D$PD$ $D$$Q耢\^_[]DVD$t^Àtt$u卆dnhP`uʃt$ V,^ D$t'D$uktt$ Pà DUSWVL@$`@4$'1=$d@|$t$D$<$K,$ƅtt$l$<$1ۅDދD$$h@t11D;us%M;u$E9G؋DFuօۉt"lfff.E$u<$f|9$(@t$ffffff.$td$ CC CCC4$D$D$^$%@tt 4$btO9w$h@Ë$`@slj<$説D$|$ t$$D$.؁L@^_[]1ff.USWVL@$d@$t1$l@1ۉ,${$h@D$fKE.ttHf.}.}u׋E$<$D$6$E<$x$5$p@$@ D$D$ $ȱ1퍼$ 1ffff.1$:$@ D$D$4$GG GGGD$4$D$D$O1Ʉt$ $ ˄r$$@@F$|$$dždžN cu FF}Ɔ ƆƆF$wdžAAF !ItTu\Iƀu\ƀHv$4 ot$$蘁D$$Qt<$<1|^_[]À1L$$fff.<$D$|$4$u  ƍ$@@<$4$蛝Vt$D$N$D$ $u~dždžN cuN F}Ɔ ƆƆF $udžAA^DUSWV유$$$C !8*1 C@ @ t:33 u*   M0QP ƃ |$LKyDžLKDžHKTK{ yDžTKDžPKdu; br ] *D$t$$hRjjVQP ƅD$tD$uƃ U/ +$`hQPѶK|$.RD$Fj$`PL$ I9 L$j$`P{}\ C$WjPU* jhQ- t PUs  U n $WjSU)tEjUP뾃jhQ藋 U6.u%L$  L$D$KC}C~E+HKLKjQRUPL$1ۋ|$K$`t%t1ɀ uUuL$1D$t{~ D$  1L$1ƃ|$I L$ QRPVe ۋ$u$ D$ |$$D$ |$ L$D${1ۅ0f.v$`PtC9rދL$|$L$$xP@ EƒhPW0hW϶hhW虪hW W|$L$, tK4D$D$ϋ[u \D$Xt EDŽ$t@DŽ$p@DŽ$|@DŽ$x@DŽ$@DŽ$@ $d jQPFt2$p@$t@;0K4Kr'$l@t;KCr [tD$+2ƒtр+u0PVhQ謖&fnfp$d DŽ$t &DŽ$x &DŽ$| &DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ $DŽ$ $` $l PajhQ UKK$L$(VD$``D$dKu}K h0 |ǃ WLK|$dKHL$tD$lI$D$|t$h$`K$KKKL$0&T$,U0D$$fnT$ fpfD$@ |$d$D$`EWVUSz`D$8c+cDŽ$@DŽ$@DŽ$@tU@" P^Ƌcc $@$@$@)t9UPV(DŽ$@DŽ$@11퉜$@1$$@c$@D$$KD L$dQt$@Kt$DP$@PKjt$Ts0|$$`1ۀKK;D$XuK1;L$\t$ foD$@$ $h DŽ$x &DŽ$| &@@ @@@@@@$@ D$ DŽ$ $` DŽ$ $d $l PD$j hQj11foD$@$ $h DŽ$x &DŽ$| &@@ @@@@@@$@ D$ DŽ$ $` DŽ$ $d $l Pcȃ Pi $@P5 jjjjjjjjQnq0|$PuP|$ƃ@1D$``t$dt V V ۋ$%|$PtHD$$t@u5u,@t# @ARPQD$ $l P\KL$0|$PD$$ D$` WL$` <u70K L$ljPTKPKQhWjD$400L$`tD$|$D$tL$ 1ɉȁĜ^_[]à U~#t0D$tL$ vD$D$t$d PUSD$D$u jjj$`PL$tƃ ȄɉL$ D$$D$P|$$ $l P &}0fn$fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$;|$`DŽ$ \$d D$lPsSWhQ!$D$ID$K |$ t^ h7^$`QPp UD$ $l P蒶L$TDD$EteXt`T h<]$`QPAp[D$`t$`PUS#i h^]$ QPoD$Ht$Ku/K$KtD$$ǁǁǁǁ!`KT$HR$`KI !T$H2P~HK$fpD@D$d PUt$4kL$$$\$ t$,1ɈHUXV1PKTK1\$ L$ ABL$$ƒHKLKL$$\$  9T$ }~1}tqL$ |7 U$1LK9HK\$ ъL$$}5PKTKPQ$l P贿PKTK\$ L$$D$|$8|$t$4t$,‹PÊ$} K ӉIK\$ t$dhVPگhVV8 $Р$@t$D$D$ $l $@\$ M4Cb$ h$@RPq KD$ +JKPK$$PKTK0L,Lƀ@LKQ+P[D$ AO|$\$ $ L$lQWUt$@P tWUD$0߉ىD$` @ǃAɱD$(A|$\$ &fnE0fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$GD$`$`DŽ$D$d D$lP|$D$(|$t$, h,jD$$PKTKE0ˍ 0|$ $@D$$ T$L$t$ $|$D$O0|$\$ t$,D$(tذD$(uD$(1ɉˆT$ $ È ˃ U1ɀKu&KKDPt$Ht$HKt%+t+TKPK|4t1$D$ ubu]tt1ۃIkPbD$KuJHL$@D9 hqVt hh1Kt&Kt t$&fnE0fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`$`DŽ$D$d D$lPCjhQuK€|$ Ā|$$t/$ $l P赭L$D$ t$XtEu t$8 ЋT$D$0u |$ tut t D$4t2u$L$433 t $l PSD$0K8K@KE΅DڅEPSQ$l PW $l P$ PUq D$DDWV$l PD$$ +V2&fnE0fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`DŽ$t$d D$lP hQr$ƃ TKPKt$4"D$ H&fnE0fpD$hD$x&D$|&DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`$`DŽ$D$d D$lPqPWh]d`{^(&$" ƃ W~@<ƃ $l PEƃ $@PqD$``|$dt W% W} V] f.USWV l$ t$0|$,L$(E tt$L$<$-@t$<$D$E @t3@$$u$u t$<$脞M !Xu'`u$:tL$(L$(1ۃEuL$(1ۋE `u $8t$D$t$L$<$$$%Ƅt>_u G$=ƿw t G:?_u_u /G/ ^_[]SVTt$d+2tȀ+ À0t$lVhQ~&fnfpD$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P$D$Ht$ D$P訽؃T^[f.SWVPt$`\$l|$hF c D$dK hDcNWP_F t h6N PdtuRhhQjF cSPWjMu$1"cSPWj3tF ƀ&P^_[ø&fnfpf$fD$fD$DD$@fD$0fD$ D$H D$ PK1Ɔ ff.USWV $ C tZK*$( h<MVP_ hLPh_ 1ɀ$$ +QV V輶ts V̸ Pt'C +V0K L$jPTKPKQhVjs 50C KPjV茴C 1ɀ+QV@ VtO0d&fnG0fpD$D$ D$&D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PtD$HD$ l$U hVUijV諞 Vt V/ PC_C u%@t@AQPVmC KPjVC 1ɀ+QV育L$&fnfpD$D$ &D$$&D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PL$D$Ht$ D$P貸 hQrij hQ@j uVC Ku> hhIVP\ hiIPh[ƃ VWs C 0KDʍ8KDӁ@KDWRQV ^_[]ÐUSWV $0 F !Xt E_R$4 0K L$jT$RTKPKQhW$` P膷0|$]0WShQr Wbtn Wr P膳tR&fnfpfD$fD$ fD$TD$PfD$@fD$0D$Xb D$P谶 WP&\$fnfpD$D$$&D$(&D$,&D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XtD$P\$ \$ShWS^jW蠚F u%@t@AQPWF KPjW9 jt$TKPKD$#PhW$` v 蕵0uWt$hQp1ۉ؁ ^_[]f.USWV $ t$lVrjUVShjuƅu hQa11f."hVD$lP蟤Džjjjj$ $ US WV$ A뜋$ $ XtE(11t5$ uu D5G9rҋ$ $ ShQb$ &fnfpD$ D$&fD$PD$$D$ D$,D$(D$4D$0D$<D$8D$DD$H4$\$D$@|$ |$ WVfoD$PD$D$&D$&D$&D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@4$ W˲1ۃ D$lPy؁Ĝ ^_[]ót݃ VJqωËD5L5 ‰σT5|5 $  $ WS英tc$ @jWQЃt$ @jjjQЃ$ Nj t0pD0jW$ /jSD$lPDžt V7p D$lP7 Wq USWV D$$Erƅu $Q]\$(l$$ )ËD$ t$D$$MDž~&9M~ҋD$ |$t$$P볅t4$o ^_[]Džt4$ho<$qffffff D$t$;o fffUSWV,@$@@$D@8*(*t$ PjQjULD$ t$ 8&fnD$fpD$,D$<&D$@&D$D&D$LD$HD$TD$PD$\D$XD$dD$`D$lD$p9D$hD$( D$4PjhQZ|$$t$(U1D|$t$D@ǀǀuJht$ D$4V~jhV.Et$VUPl$u $4 PP.t!h$4 VEt$VUP|$\$ UE$H@8*u2 UE+HKLKjQRUPtMD$Ku@ hb< +QPND$Hu h,N|$M|$ $D@1|$\$t$&fn$( fpD$,D$<&D$@&D$D&D$LD$HD$TD$PD$\D$XD$dD$`D$lD$pED$hD$( D$4P=EVt$ UPEjSWUP1a~P $D@fpDF FYUVHKFpFlƔD$ !h V؁,@^_[]ÃhD$0PW|ffffffUSWV$1!Tu !AË!D$,$hPUS&t$Tc\$@$D$<D$(T$D11 1ۈD$1D$0T$4ft t$P?UV蒮$PVu8 Vh$PU蕙&uD$ jV޳K|$BD$ V h:9$QPhK h$9PhK$|dDʺDDʃQh&hhK$t& h8Phh8K$t& h~8PhhK$tg$u7 hJ h48$ȴAQPJ& h 8PhhJ$t& h.7PhhgJ$t& h7Phh7J$t& h}7PhhJ$X,t( h\M7$X,PhI$l, $p,tH1|$TPj2D$PP$x,P= h6L$LQPh}I h|&mID$HD$D$D$D$D$$\$8fD V $+t9E@jjjjj$,PUE 1|$,VL$1ۃBD$ 1TK $,WS\$LPt$8D$#PZ $8Mu"D$L$$M$MD$$D$L$D$$LD$D$$LD$D$ eDD$ tYD$BtPTuK|$@tD1|$,VK $oWjjPD$#P D$ @ V跶|$th h4hPhG|$Ht& h,4L$LQPhXG h|&HG,D$BT|$j$Pt$t$xj$dPt$ t$(w|$,Vur hDFt$t$t$ t$(t$,L$TQP$tP$(PhdF L h3 PwF^ heFt$$D$LP$PhGF h|&7FD$D$4D$\$D$0D$$|$D$(hD$< lt~$9Mu$+uj$ot_!jjVtHjjjVД|$Bt-4cw$ h42$QPE V;h$PU’&T$4D$0 D$(D$<111T$4D$0\$8Ätc UȔ|$<D$BT$jPWSuD$HjP|$@WVu|$,Vu5USWVt$0h&PD$\P$Ph ~D t$(h&$Pht^D^_[] ǃ V W` USWV|*$*$*$*։π}$*u~uz$*t7 h.1PhCuG hDC5 h0PhCu hrCE3 |$~(tWhxJCČ* D$\ ʁD$ X Á u$jhPq$jRQPs$jPT P s~|$u. .IDȍD$LQhjP\ F$ .IADSDL$CD˨ DL$HDӨDD˨RDÃ\$TPQW|$,RUt$,t$4hjS[0 D$PjhPpl--E@dESL$LrD1ۉL$J-E@ɍ\sDݨ w\$rDڨ\$ wDډ\$1D\sDߨ߻rDڨDt ЃtRUSWt$,t$4t$(Qt$4hjD$|PZ0|$ tt3D$(j hPcoht/D$(j hPFoKD$(j hP0o5\ X T P 辅L$$Phj QYZ$*8 $<Pj2QUC4tI ho-WPh?~ |$D *T$LDȍ$PRQh?$*,D$(P$ Ph|?$DPhd?h l h06?|$dnhP6\ Q],Ë Hw 4L;,à h$),SPh> $<|$ uLKP$hh Pip$DPhU> h+ QPh(> d h$f+à h8T+PSh=$ hWP' h+WPh=$< W l m RQPhPg= hU=WhD= P T =L$WQRP1IƄ|$ $hWP h-*WPh< ux hT*$QPh< hh)$QPh`< h)L$(QPh:<E Et" h)SPh<@ D t6@ jj2SP0 h>)SPh;H L t6H jj2SP/ h(SPh; h(L$PQPhb;h u? \u Dl Ph$;h uTl $ jAWjj PCh u DWPh:D$ &t4D$u? ,&DуEڃ;u?FD$ w ;t" h'SPh>: hX'N ~ 1҉D$ 'Eсw Gd$SUWRt$t$$h9d$ |$u tu h,'Ph9 t! h&Phx9 t! h&PhN9 t6jW}Džt" h4&WPh9@hhh8At%A P"mPh8@tCh8 h8Bt%B VlPhd8@tChC8 h|&38|*^_[]ffD$ƀ ǀ @ D$ t$wS Vt$ht$VvfƆ ^USWV|@$@$@ƀ, ;} ts$| \$D$4$f4$)ˍ IT) |9t#K9T)Ӎ+P @19~A)ʉ\T)ȉT)Ɔ4$c0^_[ËD$ǀJǀHǀPǀLUSWV |$ phjPJJD$HKhjPJJ~|$@;wt:^~w|$$>^~t$|$()HuD$ xt l$@ED$1ɍ@DBfffff.A8@t)l$@EP)f9fEueul$DߊVNf.(|$G=JHKHK\$|$@TGWO|$D@)fL$A9u]JJ]8HKt+L$ @HKPSVL?L$؉YJJ)@J7J9u)DKIDK7J)э4RJʋHKHK]T,^_[]USWV t$ JtIdžJtKdžJ $Q/Ɔp džd4$?{fdžpƆzdžvdžrD$D$$AfdžpƆrfO1ۍipDDBu㍆ džt džp dž| džx dž dž dž dž dž dž dž dž dž dž dž dž D$D$$@ƆC ^_[]fDUSWVt$4l$04$Z 4$ZD$@t|$84$ZJDžxJDžtJDž|J4$kZƉxJJ$RZ xJJ$7Z xJJ$Z xJMJD[sGuHttDžJ11J D$@D$9t}t+DžJ>D$ 1fDžpƅrN1ۍypDDBu㍅ Džt Džp Dž| Džx Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž Dž D$D$$=ƅCH^_[]fff.USWV,|$@HK9K91Tht$ p r D$iq AYmT$D$(p \$\$\$/o4BxJ1҃ |Js +tJ\$|J|JT$r TtJt$$T$9T$T4ЋT$L$AE LJJJ؍fT$ JƇq BhJY99|$ $VT|JJD$$TD$tJD$JtE Jt$(JJ)ŋD$D$f( LJJ@?\LJXp 7pƇq LJT(3L$D$ T$ T$)΅҉ tr*` B9KPH#DxJJ$T xJtJ|J|JtJ1rw %룋KH`@99K0A9Xt݉`H|$$5WD$ L$0L$ )ʋT$$ Z<$Yp u%pƇp D$D$$9tJ|JA@xJJ$S xJtJ|J|JtJ1rw%A`H,^_[]fff.USWVfffff.w(D$$Kƃu$K)ȉT$RPjt$2W|$$Kt$ W2$KRPj|$Wv28LFN,PW&V0v4T$t P:!CL$;f.Nj,9M9U}Rt$j\$S18LEM,PS&E0U4D$t) P~  f.GL$;B ߉߉Rt$ udƅ6L8LˁD$L$t$)41)щƒT$t$ VFnX(Lt}T$D$ x`L$+$fff.Hl$ $l$!PRWVD$ x`G!l$x`$Mut$UVC,E,$уNV+\)|$;\CF*ǁr r1\CFLFPFDNHNLFH~D^X(LtzT$_D$ x`L$)H\$ $t$!PR WU D$ \$x`G!Kx`$uWSV&+L^_[]B F)ȃRP6JNh~T$ ^lNl~pVVxt T:9Nщ\$t]^~pWSV tED$0PWSVt+Ft"FxNp\$$|$,D$(L$ kƆ@LL^_[]WVPt$NhF)xCVx)Vp=@|#~NȃWPQZF~hu 1+1MF)ȃRP6.Nh~NhNl~pVVxt T:9NщVl^_USWV\$8l$4|$0C }GhH9MO)xWx)Wp@|%~Gt$$L$wGwh=u 1*W)Ɖt$‰ $T$MOh~OhOlwpWWxt T29NщWlE,$؃D$t',$'Ɖ,$D$Z'1 t$ٍG1ۉt$A Fq,$C'D$,$D$'G1fff.,$'UƃЃEOEUuҋL$\$|$8/1ˉ111ӀZt11L$0GDʋJl9NL$Bl$GO^_[]ff.USWV$x$$xGh$H9 O)Wx)Wp@|%~Gt$$L$bGwh=u 1*W)Ɖt$‰ $T$8Oh~OhOlwpWWxt T29NщWl:$1f.<$x%É<$D$ށ>%uv<$N%Ɖ<$D$ %tVUD,D$)$9FىL$M։ht$Frfff. \,EK$L$D$ L$;D$U$1G$w1,$y$ƃuD ,$D$Bffffff.,$H$ƃun ,$D$l ,$D$ #$D-)D.CfɍIuZ ,$D$ #$;RD.D$ى$9CىL$?)C@uEhH9M)Ux)Up@|%~Et$$L$bEuh=u 1)M)ET$ $D$9Mh~MhMlupUUxt T29NщUl;@G $WL$4<)%;;s9)8<F8@ʉуL$MUfDt$Ow1ffffff.$;;rOvGꋼ$у$Wʹ+;);;;CB8H$D.CƅFu;Eh~1$D$ 2ƍD$.t$D$$`D$ @L$D$$D$ L$D$$,D$ ,t$D$z^_[]ffff.USWV,t$@Fd~8N`n4(KD$1ۉ|$$l$ )F!щD$L$L$ D$VL$8$L$H|$9)耾(L|$$tu$<$ F <$D$1ۉ؃ ^_[]fUSWVt$0~8 r4$$~8 rF8V`FdL$4n4)u Y1Y!9ӈA !YI,$D$L$D$N8F4D$L$LD^_[]fff.USWV |$$<$o11Fo<$oƒNou҉Ѓ ^_[]D$@8@USWV t$,t(|$(\$$l$ DWU&GCNu ^_[]ÐUSWV D$,t$(|$$L$ ΀ru18L<u5tT T t)t$(TtT9r8LD$11 D$3Cjt9t$tt$(ÉIffffff.l$x΁t$(y)t$(xՍE9r ^_[]X q$9A,s+A(PVjA(tϋt$(11@9l$s1fD4B)t$( (9rl$E9ufffff.D$L$99r9d9V9H9:9,9999999999999wz9wp9wf9w\9wR9wH9w>9w49w*9w 9w9w 19v D$ )9CЉfff.SWVt$}XWR۝FD$ p r Jp pD$0)ЉXLJT1p @7pu鋇JJfffUSWV $ $$Xȉl$)uA $~$ oR1)9Í Y1$ v9r Í 19\LL) $f\$ J\$T$ 1ɋvp Dn8/pt$ 9n2HuӋt$1ΉJxJ|J+tJ1҉|Jl$9<9}t$ V9}u1JJ$ $D$ )ffffff.$ 9p EpuJfXl$fff.$ 9uV 9~މJJ$$ FKw)Ku$f#$ˋ,$È]$  $YTfE8}r WUp lh1 ^_[]fffffffUSWV<|$PTHh1΃HQJuA< Aȃ`urB8tKfff.8X@uP:Pr/PfT$T$PfPPT$PT$fP@Prw Pf`trKl$QKK;KL$L$\$tl9L$rPjWD$`tfHD$ H}PjWTAPHeMTL$HHD$ HD$)HHL$ 19P)KL$L$P9@J)L$t$81\$0)ڃT$4D$,ML$u3JHKtZHKff.q΋U7J7J8É\$(FAJ@KR@K;DKv%Jk‰@KQt$蕑fMfHMEHrx ff.ɈHɋ\D$,T$$HKtHKuZJ@K I @K;DKv+T$PJkщ@KPt$ܐDž.vPt$,VWD$PT$(HKHKL$}T$0}1 69э 499 ͍HfEJT$4L$844v9s#1919fÍ|2fD<41ۍ<994R19Tҋ\$t$L$fUE[CtP P|$PLPf]D$ m;(cD$HP|$PE W轐Ƈp <^_[]fffffUSWVl$t$$L$ U`)99$K, k`il$D*T$)f\Z\Z\Z\Z\Z\Z\ZwL$<$)uDt{f$K!@7U`B!IU`uHt@t7XZr,XZt$XZrXZtXZr@B^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$$Q"$QGO\ 9G؋ L$$ƅu $Q{7_^_[fffffffUSWV$0$4THɋxtl$D$l$ ~trN$8u-uAӋTA8t 8P@uΉڋH9u$95ENu΍D$9ʼnD$uF\19KF\$8t 8X@u^@C)ˍL9v[ۍD1H9ظGJD$L$|$ffff.DK];@Kt?DKL$fHL$HxpCtLL$9u?fDHKtHKuσjt$ 踋|$(u1^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$$Q$Q6GO\ 9G؋ L$$]ƅu $Q7_^_[fffffffSWV|$ GOD$$9ȉGvmW t.9v*T$D$$Q$QGO\ 9G؋L$$ƅu $Q]7_^_[ÐSWVt$D$|$hb jjWSQI u/L$ t'btb jjWSV 41^_[ffffff.USWV @$ @jj$4@ƃ S^$ hUSEf. UWǃ 7($$@tt1)ffffff.thh$UyjjUlj?*u> wt*D$.D$/hVD$PD$$4@PWnuhUSX1 @^_[]fff.USWV D$4l$$\$ t |$8t (hb jjUVP] bt%1ɍb jjUPQ+ t\ b S S9Džt8ff.t$0UWruF SDžu1 ^_[]Ë\$(tUW*D$4tԃt$$ֶ$*$¶$$讶$|&袶t$$Q^ffff.USWV|$0<$ bD$$khbD$$YbD$$G c4$9|c$+c,$LJcLJcLJc<$LJ!LJ BfLJ!LJ!Ƈ!D$$D$$D$$4$$,$=cc^_[]ÉD$ 6D$ >D$ FD$ RD$ ^D$ ct$,$t$t$D$t$D$t$D$t$D$ $offf.Vt$4$ bdž!dž Bfdž!dž!Ɔ!$hb$b$ c$|c$c$cc^ffff.Vt$ bu!u bD$$$`!$RvHw@stƆVtLt s!BuƆ!^DWV$A$0A!wes>|$t$<$)*<$,<$I+!u $|&$$A^_ùs4$e!uΉ4$D$!u볉Ɖ<$*4$qfffff. cD$t$P' cD$t$t$P#ffffff.|$-fffSWV|$GG h(ƍ7_hjVH_G fƄ@u^_[ÐUSWV,|$@l$DG O)t @@Iu}7G  U7@)9BQUVE1Ƀfnfo fo-0fo=@ىfpfD$fofot$@f$fofofofo $fffffgfofffffo$fgoMfgfo`f%fffffew9t))Kf0FOu,^_[]à L$A Q)tfff.@Jut$+ L$A I)tffffff.@IuD$tL$tAHuSWV |$@D$8t$<9CPt$$ a>$ S>$(蕐VL$ T$?>$%$|& $]Y>$8>$x$&$$$|&踢>$>$>$`>$VNT$ 6$`ÏD$4$>$Y>$K$t$胏D$$$gc$|&6$4_6$Q6$4C>$6$8'6$>$6$>$$̎N|$D$D$<$L$ ]N|$D$L$ $$d$x6$g%6$(k>$F6$H>$t#ND$<$L$$|&褠'$>$< D$<$L$Ξ$ 轍V ;NVD$|!$T$L$ D$苞$!{>$">$">$@# >$#KNL$D$<$[$l$"$%$% $&N $t'$(N $L$t$|&h$l)跌VT$ 6$)$J$*A$+}VT$1$,$l,]N $< $ CL$$՞[$,'$连$,賞9$-L$D$$6$XD$4$؜^_$t.ËD$$P.S$d+襋cVt$Vt$t$跞t ~ 1^1ffff. =X u(a+=[|$qa Vt$$. t$$蠜$|"?*`` 0 4FilehX Creating %-56s%u.%03u%.*ls(%u)%lsCMTP` 0 7Archive@`BwwwwwpmhahhhhZhhhhhZqV%'&='G&'(RRh%uhc%ux%uxc%u;%u04@416RarCheckPassword13CheckPasswordhpvector::_M_realloc_insert6666666666666666\\\\\\\\\\\\\\\\  8888/dev/urandomr %u-%02u-%02u %02u:%02u:%02u,%09u%u-%02u-%02u %02u:%02u????-??-?? ??:?? %s: Enter password (will not be echoed) Enter password (will not be echoed) for %s: Reenter password: ERROR: Passwords do not match , [%c]%ls Keyboard input is not allowed when reading data from stdin User break %s Program abortedԜԜȟw1EYm}5hW9~<x?i7}],煼c|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-T @6#EgܺvT2g jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqƌhك[RQgrn<:Og jg jgrn<:ORQhك[                                   v?C2~%t,ȀOUOW..\??\/??/ Done All OK Total errors: %ld %s is not RAR archive__tmp_reference_source_ Skipping %-56s Testing %-56s Extracting %-56s%s%s  ? %s - use current password ?_Yes_No_All Testing archive %s Extracting from %s ... %-56s %s: %sArchiveDetailsRAR 1.4RAR 4RAR 5%s%ssolidSFXvolume %dvolumeencrypted headersOriginal nameOriginal time %12ls: %lsServiceEOFFlags ----------- --------- -------- ----- ---------- ----- -------- ---- %21ls %9ls %3d%% %-27ls %u ----------- --------- ---------- ----- ---- %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu %ls Attributes Size Packed Ratio Date Time Checksum Name Attributes Size Date Time Name%cB<-><---->%d%% %12s: %sSTMTypeNTFS alternate data streamTargetDirectoryFileUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referenceSizePacked sizeRatiomtimectimeatimeAttributes %12ls: %8.8XCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2WindowsUnixDOSOS/2Mac OSBeOSWinCEHost OS %12ls: RAR %ls(v%d) -m%d -md=%d%sCompression1.55.0 %12ls: %ls encrypted %12ls: %uFile versionUnix owner#%d: %c%10ls %9ls %9ls %4ls %ls %8.8X %02x%02x..%02x ???????? %c%c%c%c%c%c%c%c%c*<-?->@P ,d&&&H     $(,048<@DHLPTX $(,048<@DHLPT -x Extract from archive (default) -t Test archive files -v Verbosely list contents of archiveKKKKKKKKKKKKKKKK 'FFXq &XXX4B_y .<JXXXXXXXXXXXXXXXXX`XXXXXXXXX1BXXXXXXXXXXXXXXXg}XXX0AmXXXXXXXXXXXXXXX`XXXX>XXXXXXXXXXXXXXXXa Overwrite %s ? Would you like to replace the existing file %s %6s bytes, modified on %s with a new one %6s bytes, modified on %s _Yes_No_All_nEver_Rename_Quit_Yes_No_All_nEver_Quit Enter new name: %3d%% %-20s - checksum error Checksum error in the encrypted file %s. Corrupt file or wrong password. %-20s : packed data checksum error in volume %s Incorrect password for %s The specified password is incorrect.Not enough memory Cannot open %s Cannot create %sCannot close the file %sSeek error in the file %sRead error in the file %sWrite error in the file %s WARNING: Cannot change attributes of %s Cannot copy %s to %s. You need to unpack the entire archive to create file reference entries. Cannot create directory %s Cannot create symbolic link %s Cannot create hard link %s You need to unpack the link target first You may need to run RAR as administratorCorrupt archive - use 'Repair' command Corrupt header is found Main archive header is corrupt %s - the file header is corrupt ERROR: Corrupt data header found, ignored WARNING: Unknown data header format, ignored ERROR: Corrupt %s data block Recovery record is corrupt. Unknown method in %s Unknown encryption method in %s ERROR: %s and %s belong to different sets Nothing to reconstruct Reconstructing... Reconstruction impossible Unexpected end of archive ERROR: Bad archive %s The archive comment is corrupt ERROR: Invalid file name %s No files to extract Cannot find volume %s %s switch is not supported for RAR %d.x archive format. %ls%ls%ls ERROR: Path too long ERROR: %s group and owner data are corrupt WARNING: Cannot get owner %s ID WARNING: Cannot get group %s ID WARNING: Cannot set %s owner and group WARNING: Cannot read symbolic link %s WARNING: Symbolic link %s already exists %s is archived incompletely because of read error. %u files are archived incompletely because of read errors. Directory with such name already exists Password exceeds the maximum allowed length of %u characters and will be truncated. Adjusting %s value to %s. WARNING: Attempting to correct the invalid file or directory name Creating %s Renaming %s to %s Calculating checksums of all volumes. %d recovery volumes found %d volumes missing WARNING: FAT32 file system does not support 4 GB or larger files Skipping the encrypted archive %s%s Testing the recovery record Insert disk with %s_Continue_Quit Choose 'Ignore' to continue with the already read file part only, 'Ignore all' to do it for all read errors, 'Retry' to repeat read and 'Quit' to abort._Ignore_iGnore all_Retry_Quit ERROR: Not enough disk space for %s._Retry_Abort;P |`f g ,gP*hlijk@ llT l o \p ,q |qP Lr| ,s, |t } ( | \ , ̄ ( L< ܆ | \x L (DAFCIAGHCBAH( d̢AA AF< ȌAAFNIAAHCEAH@،JAFCIAGHCEABH@`FAA FJIAGHCAAH2AA AAFQAHUEHCAHBEAAH@ADEBAHCAHTDADHCEHGHCBAHXhlaAA AF J L A G H C I A A H C A A H 8<AFCIAGHCAH8<AFCIAGHCAH<"AA AAC R,A0H a$A(A,D0D4A8AAA AC 4,SCAA AUE HEEBA H,S+dqQ-q}AA A<8- tDAA AVAAC HMAAC Htx-tAA AAFEGAHxEFAHjEAAHMAAH4-tuAA C0G8E0ACGADD He8>8C0ed>?AC$Le>iAA AAC te>dAA C e ?#CHeF2,; wlqze'K,  )5 t { 5` a }1u_,{*s6cY ]Wy&\c[_ U7[Q#SOEE M(u  ~ fA | M8K d z i x x @)'yhw큀 SO^uSI^SR^FSYR^Kh6KIhKhBKUh4 I_ \rꀀh##v1r9zGfRz`dh;yhw 'FN7~ , ]oFFB!{a2u02 " YU .] > Ny <PP>^$>;<U%>3L(6y g:Y8>8 s :B28-:,8 !!Py~T08lI4@@n1yhw큀 B'MV >  P< c!;s>]&$dÀA937 E411HÀA'C[S4yꀀh++ /= )O#]kr5)'77?s0P)c x P \o؁ \ 8@Ho8ooTƓ֓&6FVfvƔ֔&6FVfvƕ֕&6FVfvƖ֖&6FVfvƗ֗&6FVfvƘ֘&6FVfvƙ֙GCC: (Ubuntu 7.4.0-1ubuntu1~18.04.1) 7.4.0clang version 6.0.0-1ubuntu2 (tags/RELEASE_600/final).shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment TThh !oP+ ؁ 3\;oTTHo88W H` B@@8ixx#do  x00F~``DR$3$Tx;xf!xPP> \\>``>>s?@AAJ 0AaBrar/order.htm0000644000175000017500000000637614462150076011014 0ustar zz How to buy WinRAR and RAR license

How to buy WinRAR and RAR license.

If you wish to use WinRAR and RAR after the evaluation period of 40 days, you need to purchase its license from one of the regional dealers listed here. You can also check the latest price list and buy on-line at www.rarlab.com.

Upon receipt of your registration fee you will receive an email containing a registration key file corresponding to the user name string which you have chosen. Please specify a valid email address when buying the licence, as it will be used to send you the key file.

The registration email will also contain all necessary instructions, so please just follow them. Below, we provide a brief explanation of the typical registration procedure, but instructions in the email are more up to date than this file and should thus have a higher precedence.

If you use WinRAR, you will need to copy the registration key file (rarreg.key) to a WinRAR folder or to %APPDATA%\WinRAR folder. By default WinRAR folder is "C:\Program Files\WinRAR", but it can be changed by a user when installing WinRAR. You can also drag rarreg.key file and drop it to WinRAR window to register.

If the key is archived in a .rar or .zip file, please extract rarreg.key from the archive before copying it. If archive name is rarkey.rar, another way to install the key file is to open such archive in WinRAR and answer "Yes" to confirmation prompt.

You can place rarreg.key to the same folder as WinRAR installer .exe file if you wish the installer to apply it automatically. Such rarreg.key file is used only if no previously installed key files are found.

If you use RAR/Unix and RAR for macOS, you should copy rarreg.key to your home directory or to one of the following directories: /etc, /usr/lib, /usr/local/lib, /usr/local/etc. You may rename it to .rarreg.key or .rarregkey, if you wish, but rarreg.key is also valid.

Now WinRAR, command line RAR for Unix and macOS use the same registration key format, so you can use the same key with current WinRAR and RAR versions for all mentioned platforms. It is not guaranteed for WinRAR and RAR versions that are not equal to version included to this distribution file.

Please send your further questions about sales and licensing to . English, French, German or Spanish please.

rar/readme.txt0000644000175000017500000000126414462150076011154 0ustar zz RAR archiver: * RAR introduces an original compression algorithm. It provides high compression ratios on executable files, object libraries, large text files, etc. * RAR provides functionality for creating a 'solid' archive, which can raise the compression ratio by 10% - 50% over more common methods, particularly when packing large numbers of small files. * RAR offers the ability to create and change SFX archives using default and external SFX modules. * RAR offers the ability to create a multi-volume archive as SFX. * RAR offers a number of service functions, such as encrypting files, adding archive comments and repairing physically damaged archives. rar/rar.txt0000644000175000017500000032461114462150076010507 0ustar zz User's Manual ~~~~~~~~~~~~~ RAR 6.23 console version ~~~~~~~~~~~~~~~~~~~~~~~~ =-=-=-=-=-=-=-=-=-=-=-=-=-=- Welcome to the RAR Archiver! -=-=-=-=-=-=-=-=-=-=-=-=-=-= Introduction ~~~~~~~~~~~~ RAR is a console application allowing to manage archive files in command line mode. RAR provides compression, encryption, data recovery and many other functions described in this manual. RAR supports only RAR format archives, which have .rar file name extension by default. ZIP and other formats are not supported. Even if you specify .zip extension when creating an archive, it will still be in RAR format. Windows users may install WinRAR, which supports more archive types including RAR and ZIP formats. WinRAR provides both graphical user interface and command line mode. While console RAR and GUI WinRAR have the similar command line syntax, some differences exist. So it is recommended to use this rar.txt manual for console RAR (rar.exe in case of Windows version) and winrar.chm WinRAR help file for GUI WinRAR (winrar.exe). Configuration file ~~~~~~~~~~~~~~~~~~ RAR and UnRAR for Unix read configuration information from .rarrc file in a user's home directory (stored in HOME environment variable) or in /etc directory. RAR and UnRAR for Windows read configuration information from rar.ini file, placed in the same directory as the rar.exe file. This file can contain the following string: switches= For example: switches=-m5 -s It is also possible to specify separate switch sets for individual RAR commands using the following syntax: switches_= For example: switches_a=-m5 -s switches_x=-o+ Environment variable ~~~~~~~~~~~~~~~~~~~~ Default parameters may be added to the RAR command line by establishing an environment variable "RAR". For instance, in Unix following lines may be added to your profile: RAR='-s -md1024' export RAR RAR will use this string as default parameters in the command line and will create "solid" archives with 1024 MB sliding dictionary size. RAR handles options with priority as following: command line switches highest priority switches in the RAR variable lower priority switches saved in configuration file lowest priority Log file ~~~~~~~~ If switch -ilog is specified in the command line or configuration file, RAR will write informational messages about errors encountered while processing archives into a log file. Read the switch -ilog description for more details. The file order list for solid archiving - rarfiles.lst ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ rarfiles.lst contains a user-defined file list, which tells RAR the order in which to add files to a solid archive. It may contain file names, wildcards and special entry - $default. The default entry defines the place in order list for files not matched with other entries in this file. The comment character is ';'. In Windows this file should be placed in the same directory as RAR or in %APPDATA%\WinRAR directory, in Unix - to the user's home directory or in /etc. Tips to provide improved compression and speed of operation: - similar files should be grouped together in the archive; - frequently accessed files should be placed at the beginning. Normally masks placed nearer to the top of list have a higher priority, but there is an exception from this rule. If rarfiles.lst contains such two masks that all files matched by one mask are also matched by another, that mask which matches a smaller subset of file names will have higher priority regardless of its position in the list. For example, if you have *.cpp and f*.cpp masks, f*.cpp has a higher priority, so the position of 'filename.cpp' will be chosen according to 'f*.cpp', not '*.cpp'. RAR command line syntax ~~~~~~~~~~~~~~~~~~~~~~~ Syntax RAR [ - ] [ <@listfiles...> ] [ ] [ ] Description Command is a single character or string specifying an action to be performed by RAR. Switches are designed to modify the way RAR performs such action. Other parameters are archive name and files to be archived or extracted. Listfiles are plain text files containing names of files to process. File names must start at the first column. It is possible to put comments to the listfile after // characters. For example, you can create backup.lst containing the following strings: c:\work\doc\*.txt //backup text documents c:\work\image\*.bmp //backup pictures c:\work\misc and then run: rar a backup @backup.lst If you wish to read file names from stdin (standard input), specify the empty listfile name (just @). By default, console RAR uses the single byte encoding in list files, but it can be redefined with -scl switch. You can specify both usual file names and list files in the same command line. If neither files nor listfiles are specified, then *.* is implied and RAR will process all files. path_to_extract includes the destination directory name followed by a path separator character. For example, it can be c:\dest\ in Windows or data/ in Unix. It specifies the directory to place extracted files in 'x' and 'e' commands. This directory is created by RAR if it does not exist yet. Alternatively it can be set with -op switch. Many RAR commands, such as extraction, test or list, allow to use wildcards in archive name. If no extension is specified in archive mask, RAR assumes .rar, so * means all archives with .rar extension. If you need to process all archives without extension, use *. mask. *.* mask selects all files. Wildcards in archive name are not allowed when archiving and deleting. In Unix you need to enclose RAR command line parameters containing wildcards in single or double quotes to prevent their expansion by Unix shell. For example, this command will extract *.asm files from all *.rar archives in current directory: rar e '*.rar' '*.asm' Command could be any of the following: a Add files to archive. Examples: 1) add all *.hlp files from the current directory to the archive help.rar: rar a help *.hlp 2) archive all files from the current directory and subdirectories to 362000 bytes size solid, self-extracting volumes and add the recovery record to each volume: rar a -r -v362 -s -sfx -rr save Because no file names are specified, all files (*) are assumed. 3) as a special exception, if directory name is specified as an argument and if directory name does not include file masks and trailing path separator, the entire contents of the directory and all subdirectories will be added to the archive even if switch -r is not specified. The following command will add all files from the directory Bitmaps and its subdirectories to the RAR archive Pictures.rar: rar a Pictures.rar Bitmaps 4) if directory name includes the trailing path separator, normal rules apply and you need to specify switch -r to process its subdirectories. The following command will add all files from directory Bitmaps, but not from its subdirectories, because switch -r is not specified: rar a Pictures.rar Bitmaps\* c Add archive comment. Comments are displayed while the archive is being processed. Comment length is limited to 256 KB. Examples: rar c distrib.rar Also comments may be added from a file using -z[file] switch. The following command adds a comment from info.txt file: rar c -zinfo.txt dummy ch Change archive parameters. This command can be used with most of archive modification switches to modify archive parameters. It is especially convenient for switches like -cl, -cu, -tl, which do not have a dedicated command. It is not able to recompress, encrypt or decrypt archive data and it cannot merge or create volumes. If no switches are specified, 'ch' command just copies the archive data without modification. If used with -amr switch to restore the saved archive name and time, other archive modification switches are ignored. Example: Set archive time to latest file: rar ch -tl files.rar cw Write archive comment to specified file. Format of output file depends on -sc switch. If output file name is not specified, comment data will be sent to stdout. Examples: 1) rar cw arc comment.txt 2) rar cw -scuc arc unicode.txt 3) rar cw arc d Delete files from archive. If this command removes all files from archive, the empty archive is removed. e Extract files without archived paths. Extract files excluding their path component, so all files are created in the same destination directory. Use 'x' command if you wish to extract full pathnames. Example: rar e -or html.rar *.css css\ extract all *.css files from html.rar archive to 'css' directory excluding archived paths. Rename extracted files automatically in case several files have the same name. f Freshen files in archive. Updates archived files older than files to add. This command will not add new files to the archive. i[i|c|h|t]= Find string in archives. Supports following optional parameters: i - case insensitive search (default); c - case sensitive search; h - hexadecimal search; t - use ANSI, UTF-8, UTF-16 and OEM (Windows only) character tables; If no parameters are specified, it is possible to use the simplified command syntax i instead of i= It is allowed to specify 't' modifier with other parameters, for example, ict=string performs case sensitive search using all mentioned above character tables. Examples: 1) rar "ic=first level" -r c:\*.rar *.txt Perform case sensitive search of "first level" string in *.txt files in *.rar archives on the disk c: 2) rar ih=f0e0aeaeab2d83e3a9 -r e:\texts\*.rar Search for hex string f0 e0 ae ae ab 2d 83 e3 a9 in rar archives in e:\texts directory. k Lock archive. RAR cannot modify locked archives, so locking important archives prevents their accidental modification by RAR. Such protection might be especially useful in case of RAR commands processing archives in groups. This command is not intended or able to prevent modification by other tools or willful third party. It implements a safety measure only for accidental data change by RAR. Example: rar k final.rar l[t[a],b] List archive contents [technical [all], bare]. 'l' command lists archived file attributes, size, date, time and name, one file per line. If file is encrypted, line starts from '*' character. 'lt' displays the detailed file information in multiline mode. This information includes file checksum value, host OS, compression options and other parameters. 'lta' provide the detailed information not only for files, but also for service headers like NTFS streams or file security data. 'lb' lists bare file names with path, one per line, without any additional information. You can use -v switch to list contents of all volumes in volume set: rar l -v vol.part1.rar Commands 'lt', 'lta' and 'lb' are equal to 'vt', 'vta' and 'vb' correspondingly. m[f] Move to archive [files only]. Moving files and directories results in the files and directories being erased upon successful completion of the packing operation. Directories will not be removed if 'f' modifier is used and/or '-ed' switch is applied. p Print file to stdout. Send unpacked file data to stdout. Informational messages are suppressed with this command, so they are not mixed with file data. r Repair archive. Archive repairing is performed in two stages. First, the damaged archive is searched for a recovery record (see 'rr' command). If archive contains the previously added recovery record and if damaged data area is continuous and smaller than error correction code size in recovery record, chance of successful archive reconstruction is high. When this stage has been completed, a new archive is created, named as fixed.arcname.rar, where 'arcname' is the original (damaged) archive name. If broken archive does not contain a recovery record or if archive is not completely recovered due to major damage, second stage is performed. During this stage only the archive structure is reconstructed and it is impossible to recover files which fail checksum validation, it is still possible, however, to recover undamaged files, which were inaccessible due to the broken archive structure. Mostly this is useful for non-solid archives. This stage is never efficient for archives with encrypted file headers, which can be repaired only if recovery record is present. When the second stage is completed, the reconstructed archive is saved as rebuilt.arcname.rar, where 'arcname' is the original archive name. By default, repaired archives are created in the current directory, but you can append an optional destpath\ parameter to specify another destination directory. Example: rar r buggy.rar c:\fixed\ repair buggy.rar and place the result to 'c:\fixed' directory. rc Reconstruct missing and damaged volumes using recovery volumes (.rev files). You need to specify any existing .rar or .rev volume as the archive name. Example: rar rc backup.part03.rar Read 'rv' command description for information about recovery volumes. rn Rename archived files. The command syntax is: rar rn ... For example, the following command: rar rn data.rar readme.txt readme.bak info.txt info.bak will rename readme.txt to readme.bak and info.txt to info.bak in the archive data.rar. It is allowed to use wildcards in the source and destination names for simple name transformations like changing file extensions. For example: rar rn data.rar *.txt *.bak will rename all *.txt files to *.bak. RAR does not check if the destination file name is already present in the archive, so you need to be careful to avoid duplicated names. It is especially important when using wildcards. Such a command is potentially dangerous, because a wrong wildcard may corrupt all archived names. rr[N] Add data recovery record. Optionally, redundant information (recovery record) may be added to archive. While it increases the archive size, it helps to recover archived files in case of disk failure or data loss of other kind, provided that damage is not too severe. Such damage recovery can be done with command "r" (repair). RAR 4.x and RAR 5.0 archives use different recovery record structure and algorithms. RAR 4.x recovery record is based on XOR algorithm. You can specify 4.x record size as a number of recovery sectors or as a percent of archive size. To specify a number of sectors just add it directly after 'rr', like 'rr1000' for 1000 sectors. To use a percent append 'p' or '%' modifier after the percent number, such as 'rr5p' or 'rr5%' for 5%. Note that in Windows .bat and .cmd files it is necessary to use 'rr5%%' instead of 'rr5%', because the command processor treats the single '%' as the start of a batch file parameter, so it might be more convenient to use 'p' instead of '%' in this case. RAR 4.x recovery sectors are 512 bytes long. If damaged area is continuous, every sector helps to recover 512 bytes of damaged information. This value may be lower in cases of multiple damage. Maximum number of recovery sectors is 524288. Size of 4.x recovery record may be approximately determined as /256 + *512 bytes and cannot exceed the protected data size or 256 MB, whatever is less. RAR 5.0 recovery record uses Reed-Solomon error correction codes. Its ability to repair continuous damage is about the same as for RAR 4.x, allowing to restore slightly less data than recovery record size. But it is more efficient than RAR 4.x record in case of multiple damaged areas and shifted data positions. RAR 5.0 record does not use 512 byte sectors and you can specify its size only as a percent of archive size. Even if '%' or 'p' modifier is not present, RAR treats the value as a percent in case of RAR 5.0 format, so both 'rr5' and 'rr5p' mean 5%. Due to service data overhead the actual resulting recovery record size only approximately matches the user defined percent and difference is larger for smaller archives. Maximum allowed RAR 5.0 recovery record size is 1000%. Larger recovery records are processed slower both when creating and repairing. RAR 5.0 recovery record is more resistant to damage of recovery record itself and can utilize a partially corrupt recovery record data. Note, though, that 'R' repair command does not fix broken blocks in recovery record. Only file data are corrected. After successful archive repair, you may need to create a new recovery record for saved files. If you use the plain 'rr' command without optional parameter, RAR will set the recovery record size to 3% of archive size by default. While the recovery record improves chances to repair damaged archives, it does not guarantee the successful recovery. Consider combining the recovery record feature with making multiple archive copies to different media for important data. Example: rar rr5p arcname add the recovery record of 5% of archive size. rv[N] Create recovery volumes (.rev files), which can be later used to reconstruct missing and damaged files in a volume set. This command makes sense only for multivolume archives and you need to specify the name of the first volume in the set as the archive name. For example: rar rv3 data.part01.rar This feature may be useful for backups or, for example, when you posted a multivolume archive to a newsgroup and a part of subscribers did not receive some of the files. Reposting recovery volumes instead of usual volumes may reduce the total number of files to repost. Each recovery volume is able to reconstruct one missing or damaged RAR volume. For example, if you have 30 volumes and 3 recovery volumes, you are able to reconstruct any 3 missing volumes. If the number of .rev files is less than the number of missing volumes, reconstructing is impossible. The total number of usual and recovery volumes must not exceed 255 for RAR 4.x and 65535 for RAR 5.0 archive format. Original RAR volumes must not be modified after creating recovery volumes. Recovery algorithm uses data stored both in REV files and in RAR volumes to rebuild missing RAR volumes. So if you modify RAR volumes, for example, lock them, after creating REV files, recovery process will fail. Additionally to recovery data, RAR 5.0 recovery volumes also store service information such as checksums of protected RAR files. So they are slightly larger than RAR volumes which they protect. If you plan to copy individual RAR and REV files to some removable media, you need to take it into account and specify RAR volume size by a few kilobytes smaller than media size. The optional parameter specifies a number of recovery volumes to create. It must be less than the total number of RAR volumes in the set for RAR 4.x and must not be larger than tenfold amount of RAR volumes for RAR 5.0 format. Values exceeding the threshold are adjusted automatically. You may also append a percent or 'p' character to this parameter, in such case the number of creating .rev files will be equal to this percent taken from the total number of RAR volumes. For example: rar rv15% data.part01.rar If parameter is omitted, it is set to 10%. RAR reconstructs missing and damaged volumes either when using 'rc' command or automatically, if it cannot locate the next volume and finds the required number of .rev files when unpacking. Original copies of damaged volumes are renamed to *.bad before reconstruction. For example, volname.part03.rar will be renamed to volname.part03.rar.bad. s[name] Convert archive to SFX. The archive is merged with a SFX module (using a module in file default.sfx or specified in the switch). In the Windows version default.sfx should be placed in the same directory as the rar.exe, in Unix - in the user's home directory, in /usr/lib or /usr/local/lib. s- Remove SFX module from the already existing SFX archive. RAR creates a new archive without SFX module, the original SFX archive is not deleted. t Test archive files. This command performs a dummy file extraction, writing nothing to the output stream, in order to validate the specified file(s). Examples: Test archives in current directory: rar t * or for Unix: rar t '*' User may test archives in all sub-directories, starting with the current path: rar t -r * or for Unix: rar t -r '*' u Update files in archive. Adds files not yet in the archive and updates archived files that are older than files to add. v[t[a],b] Verbosely list archive contents [technical [all], bare]. 'v' command lists archived file attributes, size, packed size, compression ratio, date, time, checksum and name, one file per line. If file is encrypted, line starts from '*' character. For BLAKE2sp checksum only two first and one last symbol are displayed. 'vt' displays the detailed file information in multiline mode. This information includes file checksum value, host OS, compression options and other parameters. 'vta' provide the detailed information not only for files, but also for service headers like NTFS streams or file security data. 'vb' lists bare file names with path, one per line, without any additional information. You can use -v switch to list contents of all volumes in volume set: rar v -v vol.part1.rar Commands 'vt', 'vta' and 'vb' are equal to 'lt', 'lta' and 'lb' correspondingly. x Extract files with full path. Examples: 1) extract 10cents.txt to current directory not displaying the archive comment rar x -c- dime 10cents.txt 2) extract *.txt from docs.rar to c:\docs directory rar x docs.rar *.txt c:\docs\ 3) extract the entire contents of docs.rar to current directory rar x docs.rar Switches (used in conjunction with a command): -? Display help on commands and switches. Same as none or illegal command line option are entered. -- Stop switches scanning This switch tells to RAR that there are no more switches in the command line. It could be useful, if either archive or file name starts from '-' character. Without '--' switch such a name would be treated as a switch. Example: add all files from the current directory to the solid archive '-StrangeName' RAR a -s -- -StrangeName -@[+] Disable [enable] file lists RAR treats command line parameters starting from '@' character as file lists. So by default, RAR attempts to read 'filename' filelist, when encountering '@filename' parameter. But if '@filename' file exists, RAR treats the parameter as '@filename' file instead of reading the file list. Switch -@[+] allows to avoid this ambiguity and strictly define how to handle parameters starting from '@' character. If you specify -@, all such parameters found after this switch will be considered as file names, not file lists. If you specify -@+, all such parameters found after this switch will be considered as file lists, not file names. This switch does not affect processing parameters located before it. Example: test the archived file '@home' rar t -@ notes.rar @home -ac Clear Archive attribute after compression or extraction (Windows version only). If -ac is specified when archiving, "Archive" file attribute is cleared for successfully compressed files. When extracting, -ac will clear "Archive" attribute for extracted files. This switch does not affect directory attributes. -ad[1,2] Alternate destination path. This option may be useful when unpacking a group of archives. Switches -ad and -ad1 create a separate directory for files unpacked from each archive. These separate directories are created in destination directory for -ad and in each archive's directory for -ad1. Switch -ad2 places unpacked files directly to each archive's directory. Separate directories are not created. Destination directory parameter is ignored for -ad1 and -ad2 switches. Examples: 1) rar x -ad *.rar data\ RAR will create subdirectories below 'data' for every unpacking archive. 2) rar x -r -ad1 arc\*.rar RAR will recursively scan 'arc' directory for *.rar archives and create subdirectories in each archive's directory. -ag[format] Generate archive name using the current date and time. Appends the current date string to an archive name when creating or processing an archive. Useful for daily backups. Format of the appending string is defined by the optional "format" parameter or by "YYYYMMDDHHMMSS" if this parameter is absent. The format string may include the following characters: Y - year M - month MMM - month name as text string (Jan, Feb, etc.) W - a week number (a week starts with Monday) A - day of week number (Monday is 1, Sunday - 7) D - day of month E - day of year H - hours M - minutes (first two 'M' after hours treated as minutes) I - minutes (treated as minutes regardless of hours position) S - seconds N - archive number. RAR searches for already existing archive with generated name and if found, increments the archive number until generating a unique name. 'N' format character is not supported when creating volumes. When performing non-archiving operations like extracting, RAR selects the existing archive preceding the first unused name or sets N to 1 if no such archive exists. Each of format string characters listed above represents only one character added to archive name. For example, use WW for two digit week number or YYYY to define four digit year. If the first character in the format string is '+', positions of the date string and base archive name are exchanged, so a date will precede an archive name. If the first character in the format string is 'F', the rest of string specifies the default format string for -ag switch. Such -agf switch has a practical value only if placed to rar.ini configuration file or RAR environment variable. For example, if we set RAR environment variable to -agfYYYY-MMM-DD, we can use -ag without a parameter with YYYY-MMM-DD format string assumed. The format string may contain optional text enclosed in '{' and '}' characters. This text is inserted into archive name. All other characters are added to an archive name without changes. If you need to process an already existing archive, be careful with -ag switch. Depending on the format string and time passed since previous -ag use, generated and existing archive names may mismatch. In this case RAR will create or open a new archive instead of processing the already existing one. You may use -log switch to write the generated archive name to a file and then read it from file for further processing. Examples: 1) use the default YYYYMMDDHHMMSS format rar a -ag backup 2) use DD-MMM-YY format rar t -agDD-MMM-YY backup 3) use YYYYMMDDHHMM format, place date before 'backup' rar a -ag+YYYYMMDDHHMM backup 4) use YYYY-WW-A format, include fields description rar a -agYYYY{year}-WW{week}-A{wday} backup 5) use YYYYMMDD and the archive number. It allows to generate unique names even when YYYYMMDD format mask used more than once in the same day rar a -agYYYYMMDD-NN backup -ai Ignore file attributes. If this switch is used when extracting, RAR does not set general file attributes stored in archive to extracted files. This switch preserves attributes assigned by operating system to a newly created file. If this switch is used when archiving, predefined values, typical for file and directory, are stored instead of actual attributes. In Windows it affects archive, system, hidden and read-only attributes. in Unix - user, group, and other file permissions. -am[s,r] Archive name and time [save, restore] Switch -ams preserves the archive metadata, which includes the original archive name and creation time. It can be used with archive modification commands, such as 'a' or 'ch'. Saved metadata is displayed in header of 'l' and 'v' archive list commands. If used together with -tk or -tl switches, -ams saves the archive modification time set by these switches. Switch -amr renames an archive to saved name. Also it sets the stored time as the archive creation and modification time in Windows and as the archive modification time in Unix. It can be used together with 'ch' command only, which ignores all other archive modification switches if -amr is specified. Switch -am without 's' and 'r' modifiers is treated as -ams. Examples: 1) create files.rar and save its metadata rar a -am files.rar 2) restore the original name of myfiles.rar rar ch -amr myfiles.rar -ao Add files with "Archive" attribute set (Windows version only). If -ao is used when archiving, only files with "Archive" file attribute will be added to archive. This switch does not affect directories, so all matching directories are added regardless of their attributes. You can also specify -ed switch if you prefer to omit all directory records. Example: add all disk C: files with "Archive" attribute set to the 'f:backup' and clear files "Archive" attribute rar a -r -ac -ao f:backup c:\*.* -ap Set path inside archive. This path is merged to file names when adding files to an archive and removed from file names when extracting. For example, if you wish to add the file 'readme.txt' to the directory 'DOCS\ENG' of archive 'release', you may run: rar a -apDOCS\ENG release readme.txt or to extract 'ENG' to the current directory: rar x -apDOCS release DOCS\ENG\*.* -as Synchronize archive contents If this switch is used when archiving, those archived files which are not present in the list of the currently added files, will be deleted from the archive. It is convenient to use this switch in combination with -u (update) to synchronize contents of archive and archiving directory. For example, after the command: rar a -u -as backup sources\*.cpp the archive 'backup.rar' will contain only *.cpp files from directory 'sources', all other files will be deleted from the archive. It looks similar to creating a new archive, but with one important exception: if no files are modified since the last backup, the operation is performed much faster than the creation of a new archive. -cfg- Ignore configuration file and RAR environment variable. -cl Convert file names to lower case. -cu Convert file names to upper case. -c- Disable comments show. -df Delete files after archiving Move files to archive. This switch in combination with the command "A" performs the same action as the command "M". -dh Open shared files Allows to process files opened by other applications for writing. This switch helps if an application allowed read access to file, but if all types of file access are prohibited, the file open operation will still fail. This option could be dangerous, because it allows to archive a file, which at the same time is modified by another application, so use it carefully. -dr Delete files to Recycle Bin Delete files after archiving and place them to Recycle Bin. Available in Windows version only. -ds Do not sort files while adding to a solid archive. -dw Wipe files after archiving Delete files after archiving. Before deleting file data are overwritten by zero bytes to prevent recovery of deleted files, file is truncated and renamed to temporary name. Please be aware that such approach is designed for usual hard disks, but may fail to overwrite the original file data on solid state disks, as result of SSD wear leveling technology and more complicated data addressing. -ed Do not add empty directories This switch indicates that directory records are not to be stored in the created archive. When extracting such archives, RAR creates non-empty directories based on paths of files contained in them. Information about empty directories is lost. All attributes of non-empty directories except a name (access rights, streams, etc.) will be lost as well, so use this switch only if you do not need to preserve such information. If -ed is used with 'm' command or -df switch, RAR will not remove empty directories. -ep Exclude paths from names. This switch enables files to be added to an archive without including the path information. This could result in multiple files with the same name existing in the archive. If used when extracting, archived paths are ignored for extracted files, so all files are created in the same destination directory. -ep1 Exclude base dir from names. Do not store or extract the path entered in the command line. Ignored if path includes wildcards. Examples: 1) add all files and directories from 'tmp' directory to archive 'test', but exclude 'tmp\' from archived names path: rar a -ep1 -r test tmp\* This is an equivalent to commands: cd tmp rar a -r ..\test cd .. 2) extract files matching images\* mask to dest\ directory, but remove 'images\' from paths of created files: rar x -ep1 data images\* dest\ -ep2 Expand paths to full. Store full file paths (except the drive letter and leading path separator) when archiving. -ep3 Expand paths to full including the drive letter. Windows version only. This switch stores full file paths including the drive letter if used when archiving. Drive separators (colons) are replaced by underscore characters. If you use -ep3 when extracting, it will change underscores back to colons and create unpacked files in their original directories and disks. If the user also specified a destination path, it will be ignored. It also converts UNC paths from \\server\share to __server\share when archiving and restores them to the original state when extracting. This switch can help to backup several disks to the same archive. For example, you may run: rar a -ep3 -r backup.rar c:\ d:\ e:\ to create backup and: rar x -ep3 backup.rar to restore it. But be cautious and use -ep3 only if you are sure that extracting archive does not contain any malicious files. In other words, use it if you have created an archive yourself or completely trust its author. This switch allows to overwrite any file in any location on your computer including important system files and should normally be used only for the purpose of backup and restore. -ep4 Exclude the path prefix from names. If this switch is used when archiving, the specified path is excluded from archived names if it is found in the beginning of such name, but does not match the entire name. Comparison is performed with names already prepared to store in archive, with removed drive letters and leading path separators. For example: rar a -ep4texts\books archive c:\texts\books\technical removes "text\books" from archived names, so they start from 'technical'. Since comparison is performed with names, as they are stored in archive, we can't use -ep4c:\texts\books. If this switch is used when extracting, it works similarly to -ap switch. Path is removed if it is present in the beginning of archived file name. For example: rar x -ep4texts\books archive removes 'texts\books' from those archived paths, which start from it. -e[+] Specifies file exclude or include attributes mask. is a number in the decimal, octal (with leading '0') or hex (with leading '0x') format. By default, without '+' sign before , this switch defines the exclude mask. So if result of bitwise AND between and file attributes is nonzero, file would not be processed. If '+' sign is present, it specifies the include mask. Only those files which have at least one attribute specified in the mask will be processed. In Windows version is also possible to use symbols D, S, H, A and R instead of a digital mask to denote directories and files with system, hidden, archive and read-only attributes. The order in which the attributes are given is not significant. Unix version supports D and V symbols to define directory and device attributes. It is allowed to specify both -e and -e+ in the same command line. Examples: 1) archive only directory names without their contents rar a -r -e+d dirs 2) do not compress system and hidden files: rar a -esh files 3) do not extract read-only files: rar x -er files -f Freshen files. May be used with archive extraction or creation. The command string "a -f" is equivalent to the command 'f', you could also use the switch '-f' with the commands 'm' or 'mf'. If the switch '-f' is used with the commands 'x' or 'e', then only old files would be replaced with new versions extracted from the archive. -hp[p] Encrypt both file data and headers. This switch is similar to -p[pwd], but switch -p encrypts only file data and leaves other information like file names visible. This switch encrypts all sensitive archive areas including file data, file names, sizes, attributes, comments and other blocks, so it provides a higher security level. Without a password it is impossible to view even the list of files in archive encrypted with -hp. Example: rar a -hpfGzq5yKw secret report.txt will add the file report.txt to the encrypted archive secret.rar using the password 'fGzq5yKw' -ht[b|c] Select hash type [BLAKE2,CRC32] for file checksum. File data integrity in RAR archive is protected by checksums calculated and stored for every archived file. By default, RAR uses CRC32 function to calculate the checksum. RAR 5.0 archive format also allows to select BLAKE2sp hash function instead of CRC32. Specify -htb switch for BLAKE2sp and -htc for CRC32 hash function. Since CRC32 is the default algorithm, you may need -htc only to override -htb in RAR configuration. CRC32 output is 32 bit length. While CRC32 properties are suitable to detect most of unintentional data errors, it is not reliable enough to verify file data identity. In other words, if two files have the same CRC32, it does not guarantee that file contents is the same. BLAKE2sp output is 256 bit. Being a cryptographically strong hash function, it practically guarantees that if two files have the same value of BLAKE2sp, their contents is the same. BLAKE2sp error detection property is also more reliable than in shorter CRC32. Since BLAKE2sp output is longer, resulting archive is slightly larger for -htb switch. If archive headers are unencrypted (no switch -hp), checksums for encrypted RAR 5.0 files are modified using a special password dependent algorithm, to make impossible guessing file contents based on checksums. Do not expect such encrypted file checksums to match usual CRC32 and BLAKE2sp values. This switch is supported only by RAR 5.0 format, so you need to use -ma switch with it. You can see checksums of archived files using 'vt' or 'lt' commands. Example: rar a -ma -htb lists.rar *.lst will add *.lst to lists.rar using BLAKE2sp for file checksums. -id[c,d,n,p,q] Display or disable messages. Switch -idc disables the copyright string. Switch -idd disables "Done" string at the end of operation. Switch -idn disables archived names output when creating, testing or extracting an archive. It disables directory creation messages when unpacking a file to non-existing directory. It can affect some other archive processing commands as well. It does not hide other messages and total percentage indicator. Minor visual artifacts, such as percentage indicator overwriting few last characters of error messages, are possible with -idn. Switch -idp disables the percentage indicator. Switch -idq turns on the quiet mode, so only error messages and questions are displayed. It is allowed to use several modifiers at once, so switch -idcdp is correct. -ieml[.][addr] Send archive by email. Windows version only. Attach an archive created or updated by the add command to email message. You need to have a MAPI compliant email client to use this switch (most modern email programs support MAPI interface). You may enter a destination email address directly in the switch or leave it blank. In the latter case you will be asked for it by your email program. It is possible to specify several addresses separated by commas or semicolons. If you append a dot character to -ieml, an archive will be deleted after it was successfully attached to an email. If the switch is used when creating a multivolume archive, every volume is attached to a separate email message. -ierr Send all messages to stderr. -ilog[name] Log errors to file. Write error messages to rar.log file. If optional 'name' parameter is not specified, the log file is created using the following defaults: Unix: .rarlog file in the user's home directory; Windows: rar.log file in %APPDATA%\WinRAR directory. If 'name' parameter includes a file name without path, RAR will create the log file in the default directory mentioned above using the specified name. Include both path and name to 'name' parameter if you wish to change the location of log file. By default, log file uses UTF-16 little endian encoding, but it can be changed with -scg switch, such as -scag for native single byte encoding. Example: rar a -ilogc:\log\backup.log backup d:\docs will create c:\log\backup.log log file in case of errors. -inul Disable all messages. -ioff[n] Turn PC off after completing an operation. Use -ioff or -ioff1 to turn PC off, -ioff2 to hibernate, -ioff3 to sleep and -ioff4 to restart. Appropriate power features must be supported by operating system. If several RAR copies are started with this switch, PC is turned off by a copy finished last. Windows version only. -isnd[-] Control notification sounds. Use -isnd to enable notification sounds and -isnd- to disable them. -iver Display the version number and quit. You can run just "RAR -iver". -k Lock archive. Prevents accidental archive modification by RAR. See the 'k' command description for details. Example: rar a -k final.rar srcfiles -kb Keep broken extracted files. RAR, by default, deletes files with checksum errors after extraction. The switch -kb specifies that files with checksum errors should not be deleted. -log[fmt][=name] Write names to log file. This switch allows to write archive and file names to specified text file in archiving, extracting, deleting and listing commands. Its behavior is defined by 'fmt' string, which can include one or more of following characters: A - write archive names to log file. If RAR creates or processes volumes, all volume names are logged. F - write processed file names to log file. It includes files added to archive and extracted, deleted or listed files inside of archive. P - if log file with specified name exists, append data to existing file instead of creating a new one. U - write data in Unicode format. If neither 'A' nor 'F' are specified, 'A' is assumed. 'name' parameter allows to specify the name of log file. It must be separated from 'fmt' string by '=' character. If 'name' is not present, RAR will use the default rarinfo.log file name. It is allowed to specify several -log switches in the same command line. This switch can be particularly useful, when you need to process an archive created with -ag or -v switches in a batch script. You can specify -loga=arcname.txt when creating an archive and then read an archive name generated by RAR from arcname.txt with an appropriate command. For example, in Windows batch file it can be: set /p name= Set compression method: -m0 store do not compress file when adding to archive -m1 fastest use fastest method (less compressive) -m2 fast use fast compression method -m3 normal use normal (default) compression method -m4 good use good compression method (more compressive, but slower) -m5 best use best compression method (slightly more compressive, but slowest) If this switch is not specified, RAR uses -m3 method (normal compression). -ma[4|5] Specify a version of archiving format. By default RAR creates archives in RAR 5.0 format. Use -ma4 to create RAR 4.x archives. Use -ma5 or just -ma in case you need to override -ma4 saved in configuration and force RAR to use RAR 5.0 format. This switch is used only when creating a new archive. It is ignored when updating an existing archive. -mc Set advanced compression parameters. This switch is intended mainly for benchmarking and experiments. In the real environment it is usually better to allow RAR to select optimal parameters automatically. Please note that improper use of this switch may lead to very serious performance and compression loss, so use it only if you clearly understand what you do. It has the following syntax: -mc[param1][:param2][module][+ or -] where is the one character field denoting a part of the compression algorithm, which has to be configured. It may have the following values: A - audio compression; C - true color (RGB) data compression; D - delta compression; E - x86 executable compression; T - text compression. RAR 5.0 archive format supports only 'D' and 'E' values. '+' sign at the end of switch applies the selected algorithm module to all processed data, '-' disables the module at all. If no sign is specified, RAR will choose modules automatically, based on data and the current compression method. Switch -mc- disables all optional modules and allows only the general compression algorithm. and are module dependent parameters described below. Audio compression, delta compression: is a number of byte channels (can be 1 - 31). RAR splits multibyte channels to bytes, for example, two 16-bit audio channels are considered by RAR as four channels one byte each. is ignored. x86 Intel executable compression, true color (RGB) data compression: and are ignored. Text compression: Text compression algorithm provides noticeably higher compression on plain text data. But it cannot utilize several CPU cores efficiently resulting in slower compression time comparing to general algorithm in multicore and multiprocessor environment. Also its decompression speed is much slower than in general algorithm regardless of CPU cores number. This is why the text compression is disabled by default. You can specify -mct switch to allow RAR to select this algorithm automatically for suitable data. Switch -mct+ will force use of the text compression for all data. Switch -mct can also include and , so its full syntax is -mc[param1][:param2]t[+ or -]. is the order of PPM algorithm (can be 2 - 63). Usually a higher value slightly increases the compression ratio of redundant data, but only if enough memory is available to PPM. In case of lack of memory the result may be negative. Higher order values decrease both compression and decompression speed. is memory in megabytes allocated for PPM (1-128). Higher values may increase the compression ratio, but note that PPM uses the equal memory size both to compress and decompress, so if you allocate too much memory when creating an archive, other people may have problems when decompressing it on a computer with less memory installed. Decompression will be still possible using virtual memory, but it may become very slow. Examples: 1) switch -mc1a+ forces use of 8-bit mono audio compression for all data. 2) switch -mc10:40t+ forces use of text compression algorithm for all data, sets the compression order to 10 and allocates 40 MB memory. 3) switch -mc12t sets the text compression order to 12, when the text compression is used, but leaves to RAR to decide when to use it. 4) switches -mct -mcd- allow RAR to apply the text compression to suitable data and disable the delta compression. -md[k,m,g] Select the dictionary size. Sliding dictionary is the memory area used by compression algorithm to find and compress repeated data patterns. If size of file being compressed (or total files size in case of solid archive) is larger than dictionary size, increasing the dictionary is likely to increase the compression ratio, reduce the archiving speed and increase memory requirements. For RAR 4.x archive format the dictionary size can be: 64 KB, 128 KB, 256 KB, 512 KB, 1 MB, 2 MB, 4 MB. For RAR 5.0 archive format the dictionary size can be: 128 KB, 256 KB, 512 KB, 1 MB, 2 MB, 4 MB, 8 MB, 16 MB, 32 MB, 64 MB, 128 MB, 256 MB, 512 MB, 1 GB. You can use 'k', 'm' and 'g' modifiers to specify the size in kilo-, mega- and gigabytes, like -md64m for 64 MB dictionary. If no modifier is specified, megabytes are assumed, so -md64m and -md64 are equal. When archiving, RAR needs about 6x memory of specified dictionary size, so 512 MB and 1 GB sizes are available in 64 bit RAR version only. When extracting, slightly more than a single dictionary size is allocated, so both 32 and 64 bit versions can unpack archives with all dictionaries up to and including 1 GB. If size of all source files for solid archive or size of largest source file for non-solid archive is at least twice less than dictionary size, RAR can reduce the dictionary size. It helps to lower memory usage without decreasing compression. Default sliding dictionary size is 4 MB for RAR 4.x and 32 MB for RAR 5.0 archive format. Example: RAR a -s -ma -md128 lib *.dll create a solid archive in RAR 5.0 format with 128 MB dictionary. -me[par] Set encryption parameters. Now only "s" parameter is supported. You can use -mes switch to skip encrypted files when extracting or testing. -ms[list] Specify file types to store. Specify file types, which will be stored without compression. This switch may be used to store already compressed files, which helps to increase archiving speed without noticeable loss in the compression ratio. Optional parameter defines the list of file extensions separated by semicolons. For example, -msrar;zip;jpg will force RAR to store without compression all RAR and ZIP archives and JPG images. It is also allowed to specify wildcard file masks in the list, so -ms*.rar;*.zip;*.jpg will work too. Several -ms switches are permitted, such as -msrar -mszip instead of -msrar;zip. In Unix -ms switch containing several file types needs to be enclosed in quote marks. It protects semicolons from processing by Unix shell. Another solution is to use individual -ms switches for every file type. If is not specified, -ms switch will use the default set of extensions, which includes the following file types: 7z, ace, arj, bz2, cab, gz, jpeg, jpg, lha, lz, lzh, mp3, rar, taz, tbz2, tgz, txz, zst, xz, z, zip, zipx, tzst -mt Set the number of threads. parameter can take values from 1 to 64. It defines the recommended maximum number of active threads for compression algorithm also as for other RAR modules, which can start several threads. While RAR attempts to follow this recommendation, sometimes the real number of active threads can exceed the specified value. Change of parameter slightly affects the compression ratio, so archives created with different -mt switches will not be exactly the same even if all other compression settings are equal. If -mt switch is not specified, RAR will try to detect the number of available processors and select the optimal number of threads automatically. -n Additionally filter included files. Apply the mask as an additional filter to included file list. Wildcards can be used both in the name and file parts of file mask. See switch -x description for details on mask syntax. You can specify the switch '-n' several times. This switch does not replace usual file masks, which still need to be entered in the command line. It is an additional filter limiting processed files only to those matching the include mask specified in -n switch. It can help to reduce the command line length sometimes. For example, if you need to compress all *.txt and *.lst files in directories Project and Info, you can enter: rar a -r text Project\*.txt Project\*.lst Info\*.txt Info\*.lst or using the switch -n: rar a -r -n*.txt -n*.lst text Project Info -n@ Read additional filter masks from list file. Similar to -n switch, but reads filter masks from the list file. If you use -n@ without the list file name parameter, it will read filter masks from stdin. This switch does not replace usual list files or file masks, which still need to be entered in the command line. It is an additional filter limiting processed files only to those matching the include mask specified in -n switch. Example: rar a -r -n@inclist.txt text Project Info @listfile.txt -oc Set NTFS Compressed attribute. Windows version only. This switch allows to restore NTFS Compressed attribute when extracting files. RAR saves Compressed file attribute when creating an archive, but does not restore it unless -oc switch is specified. -oh Save hard links as the link instead of the file. If archiving files include several hard links, store the first archived hard link as usual file and the rest of hard links in the same set as links to this first file. When extracting such files, RAR will create hard links instead of usual files. You must not delete or rename the first hard link in archive after the archive was created, because it will make extraction of following links impossible. If you modify the first link, all following links will also have the modified contents after extracting. Extraction command must involve the first hard link to create following hard links successfully. This switch is supported only by RAR 5.0 format. -oi[0-4][:] Save identical files as references. Switch -oi0 (or just -oi-) turns off identical file processing, so such files are compressed as usual files. It can be used to override another -oi value stored in RAR configuration. If -oi1 (or just -oi) is specified, RAR analyzes the file contents before starting archiving. If several identical files are found, the first file in the set is saved as usual file and all following files are saved as references to this first file. It allows to reduce the archive size, but applies some restrictions to resulting archive. You must not delete or rename the first identical file in archive after the archive was created, because it will make extraction of following files using it as a reference impossible. If you modify the first file, following files will also have the modified contents after extracting. While typically it is possible to unpack a reference without unpacking the first file, in some cases it might be necessary to involve the first file into extraction to create following files successfully. Such cases include a multivolume archive stored on several removable media and archives containing a very large number of references. It is recommended to use -oi only if you compress a lot of identical files and will not modify an archive later. If all identical files are small enough to fit into compression dictionary specified with -md switch, switch -s can provide more flexible solution than -oi. Switch -oi2 is similar to -oi1, with the only difference: it will display names of found identical files before starting archiving. Switches -oi3 and -oi4 allow to utilize RAR to generate lists of identical files. Though you still need to provide a dummy archive name to make the command syntax valid, in this mode an archive is not created and nothing is compressed. If -oi3 is used, file sizes and names are displayed and every identical file group is separated with empty line. Switch -oi4 displays bare file names and skips the first identical file in every file group, so only duplicates are listed. Optional value allows to define the minimum file size threshold. Files smaller than are not analyzed and not considered as identical. If this parameter is not present, it is assumed to be 64 KB by default. Selecting too small may increase the time required to detect identical files. Switches -oi1 and -oi2 are supported only by RAR 5.0 format. Examples: 1) rar a -oi -ma archive Save contents of current directory to archive.rar. Store identical files as references. 2) rar a -oi3:1000000 -r dummy c:\photo\*.jpg List all duplicate *.jpg files, larger than or equal to 1000000 bytes, found in c:\photo and its subdirectories. -ol[a] Process symbolic links as the link [absolute paths] Save symbolic links as links, so file or directory contents is not archived. In Windows version it also saves reparse points as links. Such archive entries are restored as symbolic links or reparse points when extracting. Supported both for RAR 4.x and RAR 5.0 archives in RAR for Unix and only for RAR 5.0 archives in RAR for Windows. In Windows you may need to run RAR as administrator to create symbolic links when extracting. RAR adds all links regardless of target when archiving with -ol switch. When extracting, to prevent placing files outside of destination directory RAR can skip symbolic links with absolute paths, the excessive number of ".." in link target or other potentially dangerous link parameters. Also it can convert some of links to directories. You can turn off these security checks and extract all links as is with -ola switch. Placing files outside of destination directory can present a security risk when extracting. Use -ola switch only if you are sure that archive contents is safe, such as your own backup. Links that are considered safe by RAR are extracted always regardless of -ol or -ola switch. -oni Allow potentially incompatible names. While NTFS file system permits file names with trailing spaces and dots, also as reserved device names, a lot of Windows programs fail to process such names correctly. If this switch is not specified, RAR removes trailing spaces and dots, if any, from file names when extracting. It also inserts the underscore character in the beginning of reserved device names, such as aux. Specify this switch if you need to extract such names as is. It might be associated with compatibility or even security risks. Windows version only. -op Set the output path. Specify the directory to place extracted files in 'x' and 'e' commands. This directory is created by RAR if it does not exist yet. Unlike command line parameter, -op switch also accepts paths without trailing path separator character. Example: rar x -opdest archive unpacks contents of archive.rar to 'dest' directory. -or Rename extracted files automatically if file with the same name already exists. Renamed file will get the name like 'filename(N).txt', where 'filename.txt' is the original file name and 'N' is a number starting from 1 and incrementing if file exists. -os Save NTFS streams. Windows version only. This switch has meaning only for NTFS file system and allows to save alternate data streams associated with a file. You may need to specify it when archiving if you use software storing data in alternative streams and wish to preserve these streams. Streams are not saved for NTFS encrypted files. -ow Use this switch when archiving to save file security information and when extracting to restore it. Unix RAR version saves file owner and group when using this switch. Windows version stores owner, group, file permissions and audit information, but only if you have necessary privileges to read them. Note that only NTFS file system supports file based security under Windows. -o[+|-] Set the overwrite mode. Can be used both when extracting and updating archived files. Following modes are available: -o Ask before overwrite (default for extracting files); -o+ Overwrite all (default for updating archived files); -o- Skip existing files. -p[pwd] Set password Set password to encrypt files when archiving or to decrypt when extracting. Passwords are case-sensitive. Maximum password length is 127 characters. Longer passwords are truncated to this length. If you omit a password in command line, you will be prompted with "Enter password" message. You can also use file redirection or pipe to specify a password if parameter is missing. Examples: 1) rar a -psecret texts.rar *.txt add files *.txt and encrypt them with password "secret". 2) rar -p texts.rar *.txt < psw.txt set contents of psw.txt file as a password. -qo[-|+] Add quick open information [none|force] RAR archives store every file header containing information such as file name, time, size and attributes immediately before data of described file. This approach is more damage resistant than storing all file headers in a single continuous block, which if broken or truncated would destroy the entire archive contents. But while being more reliable, such file headers scattered around the entire archive are slower to access if we need to quickly open the archive contents in a shell like WinRAR graphical interface. To improve archive open speed and still not make the entire archive dependent on a single damaged block, RAR 5.0 archives can include an optional quick open record. Such record is added to the end of archive and contains copies of file names and other file information stored in a single continuous block additionally to normal file headers inside of archive. Since the block is continuous, its contents can be read quickly, without necessity to perform a lot of disk seek operations. Every file header in this block is protected with a checksum. If RAR detects that quick open information is damaged, it resorts to reading individual headers from inside of archive, so damage resistance is not lessened. Quick open record contains the full copy of file header, which may be several tens or hundreds of bytes per file, increasing the archive size by the same amount. This size increase is most noticeable for many small files, when file data size is comparable to file header. So by default, if no -qo is specified or -qo without parameter is used, RAR stores copies of headers only for relatively large files and continues to use local headers for smaller files. Concrete file size threshold can depend on RAR version. Such approach provides a reasonable open speed to archive size tradeoff. If you prefer to have the maximum archive open speed regardless of size, you can use -qo+ to store copies of all file headers. If you need to have the smallest possible archive and do not care about archive open speed in different programs, specify -qo- to exclude the quick open information completely. If you wish to measure the performance effect of this switch, be sure that archive contents is not stored in a disk cache. No real disk seeks are performed for cached archive file, making access to file headers fast even without quick open record. -r Recurse subdirectories. May be used with commands: a, u, f, m, x, e, t, p, v, l, c, cf and s. When used with the commands 'a', 'u', 'f', 'm' will process files in all sub-directories as well as the current working directory. When used with the commands x, e, t, p, v, l, c, cf or s will process all archives in sub-directories as well as the current working directory. -r- Disable recursion. Even without -r switch RAR can enable the recursion automatically in some situations. Switch -r- prohibits it. If you specify a directory name when archiving and if such name does not include wildcards, by default RAR adds the directory contents even if switch -r is not specified. Also RAR automatically enables the recursion if disk root without wildcards is specified as a file mask. Switch -r- disables such behavior. For example: rar a -r- arc dirname command will add only the empty 'dirname' directory and ignore its contents. Following command: rar a -r- arc c:\ will compress contents of root c: directory only and will not recurse into subdirectories. -r0 Similar to -r, but when used with the commands 'a', 'u', 'f', 'm' will recurse into subdirectories only for those file masks, which include wildcard characters '*' and '?'. This switch works only for file names. Directory names without a file name part, such as 'dirname', are not affected by -r0 and their contents is added to archive completely unless -r- switch is specified. Example: rar a -r0 docs.rar *.doc readme.txt add *.doc files from the current directory and its subdirectories and readme.txt only from the current directory to docs.rar archive. In case of usual -r switch, RAR would search for readme.txt in subdirectories too. -ri

[:] Set priority and sleep time. Available only in RAR for Windows. This switch regulates system load by RAR in multitasking environment. Possible task priority

values are 0 - 15. If

is 0, RAR uses the default task priority.

equal to 1 sets the lowest possible priority, 15 - the highest possible. Sleep time is a value from 0 to 1000 (milliseconds). This is a period of time that RAR gives back to the system after read or write operations while compressing or extracting. Non-zero may be useful if you need to reduce system load even more than can be achieved with

parameter. Example: execute RAR with default priority and 10 ms sleep time: rar a -ri0:10 backup *.* -rr[N] Add data recovery record. This switch is used when creating or modifying an archive to add a data recovery record to the archive. See the 'rr[N]' command description for details. -rv[N] Create recovery volumes. This switch is used when creating a multivolume archive to generate recovery volumes. See the 'rv[N]' command description for details. -s Create solid archive. A solid archive is an archive packed by a special compression method, which treats several or all files, within the archive, as one continuous data stream. Solid archiving significantly increases compression, when adding a large number of small, similar files. But it also has a few important disadvantages: slower updating of existing solid archives, slower access to individual files, lower damage resistance. Usually files in a solid archive are sorted by extension. But it is possible to disable sorting with -ds switch or set an alternative file order using a special file, rarfiles.lst. Example: create solid archive sources.rar with 512 KB dictionary, recursing all directories, starting with the current directory. Add only .asm files: rar a -s -md512 sources.rar *.asm -r -s Create solid groups using file count Similar to -s, but resets solid statistics after compressing files. Usually decreases compression, but also decreases losses in case of solid archive damages. -sc[objects] Specify the character set. 'Charset' parameter is mandatory and can have one of the following values: U - Unicode UTF-16; F - Unicode UTF-8; A - the native single byte encoding, which is ANSI for Windows version; O - OEM (DOS) encoding. Windows version only. Endianness of source UTF-16 files, such as list files or comments, is detected based on the byte order mark. If byte order mask is missing, little endian encoding is assumed. 'Objects' parameter is optional and can have one of the following values: G - log files produced by -ilog switch; L - list files; C - comment files; R - messages sent to redirected files and pipes (Windows only). It is allowed to specify more than one object, for example, -scolc. If 'objects' parameter is missing, 'charset' is applied to all objects. This switch allows to specify the character set for files in -z[file] switch, list files and comment files written by "cw" command. Examples: 1) rar a -scol data @list Read names contained in 'list' using OEM encoding. 2) rar c -scuc -zcomment.txt data Read comment.txt as Unicode file. 3) rar cw -scuc data comment.txt Write comment.txt as Unicode file. 4) rar lb -scur data > list.txt Save archived file names in data.rar to list.txt in Unicode. -se Create solid groups using extension Similar to -s, but resets solid statistics if file extension is changed. Usually decreases compression, but also decreases losses from solid archive damages. -sfx[name] Create SFX archives. If this switch is used when creating a new archive, a Self-Extracting archive (using a module in file default.sfx or specified in the switch) would be created. In the Windows version default.sfx should be placed in the same directory as the rar.exe, in Unix - in the user's home directory, in /usr/lib or /usr/local/lib. Example: rar a -sfxwincon.sfx myinst create SelF-eXtracting (SFX) archive using wincon.sfx SFX-module. -si[name] Read data from stdin (standard input), when creating, extracting or testing an archive. When archiving, the optional 'name' parameter allows to specify a file name of compressed stdin data in the created archive. If this parameter is missing, the name will be set to 'stdin'. When extracting, the archive name specified in the command line is used only in informational messages, but actual archive data is read from stdin. So any dummy archive name can be applied. RAR cannot perform operations requiring backward seeks when reading archive data from stdin. Incomplete list of features unavailable in such mode includes displaying archive comments, testing the recovery record, utilizing the quick open information, processing multivolume archives. Any prompts requiring user interaction are not allowed with -si and lead to program termination. If overwriting existing files or unpacking encrypted files is possible, avoid such prompts with -o[+|-|r], -p or -mes switches. Examples: 1) compress 'type readme.txt' output as 'readme.rar' file type readme.txt | rar a -sireadme.txt readme.rar 2) unpack docs.rar to 'docs' directory type docs.rar | rar x -si -o+ -pmypwd dummy docs\ -sl Process only those files, which size is less than specified in parameter of this switch. Parameter must be specified in bytes. -sm Process only those files, which size is more than specified in parameter of this switch. Parameter must be specified in bytes. -sv Create independent solid volumes By default RAR tries to reset solid statistics as soon as possible when starting a new volume, but only if enough data was packed after a previous reset (at least a few megabytes). This switch forces RAR to ignore packed data size and attempt to reset statistics for volumes of any size. It decreases compression, but increases chances to extract a part of data if one of several solid volumes in a volume set was lost or damaged. Note that sometimes RAR cannot reset statistics even using this switch. For example, it cannot be done when compressing one large file split between several volumes. RAR is able to reset solid statistics only between separate files, but not inside of single file. Ignored if used when creating a non-volume archive. -sv- Create dependent solid volumes Disables to reset solid statistics between volumes. It slightly increases compression, but significantly reduces chances to extract a part of data if one of several solid volumes in a volume set was lost or damaged. Ignored if used when creating a non-volume archive. -s- Disable solid archiving -t Test files after archiving. This switch is especially useful in combination with the move command, so files will be deleted only if the archive had been successfully tested. -ta[m,c,a,o] Process only files modified after the specified date. Files matching the specified date exactly are also included. Format of the date string is YYYYMMDDHHMMSS. It is allowed to insert separators like '-' or ':' to the date string and omit trailing fields. For example, the following switch is correct: -ta2001-11-20 Internally it will be expanded to -ta20011120000000 and treated as "files modified after 0 hour 0 minutes 0 seconds of 20 November 2001". Use 'm', 'c', 'a' modifiers to specify modification, creation (ctime in Unix) and last access time accordingly, such as -tac20011120 for creation time or ctime. If such modifier is omitted, the modification time is assumed. It is allowed to use several modifiers in the same switch, such as -tamc20190215, to set the same date for all specified times. Alternatively you can add several time filtering switches to command line. By default, time filters use AND logic, so a file must match all such filters to be processed. It can be changed to OR logic with 'o' modifier, so a file will have to match at least one 'o' filter. For example, use -taco20190201 -tamo20190210 to include files created after 2019-02-01 or modified after 2019-02-10. -tb[m,c,a,o] Process only files modified before the specified date. Files matching the specified date exactly are not included. Format of the switch is the same as -ta. -tk Keep original archive date. Prevents RAR from modifying the archive date when changing an archive. -tl Set archive time to newest file. Forces RAR to set the date of a changed archive to the date of the newest file in the archive. -tn[m,c,a,o]

Assign work directory to

. RAR creates temporary files in some operations like archive modification. This switch can be used to specify the directory for such temporary files. This directory must be already exist. Example: use d:\tmp directory for temporary files when adding a new comment to info.rar RAR c -wd:\tmp -zcomment.txt info.rar -x Exclude the specified file or directory. Wildcards can be used in both the name and path parts of file mask. You can specify the switch '-x' several times to define several exclusion masks in the same command line. If mask contains wildcards, it applies to files in current directory and its subdirectories. It is not recursive without wildcards, so "filename" mask will exclude 'filename' file only in current directory when archiving or in root archive directory when extracting. Use "*\filename" syntax to exclude "filename" recursively in all directories. If you know the exact path to file, you can use "path\filename" syntax to exclude only this copy of "filename". If you use -xpath\filename syntax when unpacking an archive, "path" must be the path inside of archive, not the file path on the disk after unpacking. By default, masks containing wildcards are applied only to files. If you need a mask with wildcards to exclude several directories, use the special syntax for directory exclusion masks. Such masks must have the trailing path separator character ('\' for Windows and '/' for Unix). For example, "*tmp*\" mask will exclude all directories matching "*tmp*" and "*\tmp\" will exclude all 'tmp' directories. Since wildcards are present, both masks will be applied to contents of current directory and all its subdirectories. If you wish to exclude only one directory, specify the exact name of directory including the absolute or relative path without any wildcards. In this case you do not need to append the path separator to mask, which is required only for directory exclusion masks containing wildcards to distinguish them from file exclusion masks. Examples: 1) rar a -r -x*.jpg -x*.avi rawfiles compress all files except *.jpg and *.avi in current directory and its subdirectories; 2) rar a -r -x*\temp\ savec c:\* compress all files on the disk c: except 'temp' directories and files inside of 'temp' directories; 3) rar x -x*.txt docs extract all files except *.txt from docs.rar. -x@ Exclude files listed in the specified list file. If you use -x@ without the list file name parameter, it will read file names from stdin. Example: rar a -x@exlist.txt arch *.exe -y Assume Yes on all queries. -z[file] Read archive comment from file . This switch can be used with any archive modification command to read the archive comment from file and add it to archive. Use with -sc switch if you need to specify the character set for comment text file. If is not present, comment is read from stdin. Limitations ~~~~~~~~~~~ Command limitations: Commands 'd','u','f','c','cf' will not operate with archive volumes. Command 'a' cannot be used to update an archive volume, only to create a new one. Exit values ~~~~~~~~~~~ RAR exits with a zero code (0) in case of successful operation. Non-zero exit code indicates some kind of error: Code Description 0 Successful operation. 1 Non fatal error(s) occurred. 2 A fatal error occurred. 3 Invalid checksum. Data is damaged. 4 Attempt to modify an archive locked by 'k' command. 5 Write error. 6 File open error. 7 Wrong command line option. 8 Not enough memory. 9 File create error 10 No files matching the specified mask and options were found. 11 Wrong password. 12 Read error. 255 User stopped the process. Glossary ~~~~~~~~ Archive Special file containing one or more files optionally compressed and/or encrypted. Compression A method of encoding data to reduce it's size. Checksum Value calculating for data block or file and allowing to check data or file validity. SFX archive SelF-eXtracting archive. Archive in executable format, consisting of self-extracting module followed by compressed data. It is enough to run such executable to start extraction. Solid An archive packed using a special compression method which sees all files as one continuous data stream. Particularly advantageous when packing a large number of small files. Volume Part of a split archive. Splitting an archive to volumes allows storing them on several removable disks. Solid volumes must be extracted starting from first volume in sequence. Copyrights (c) 1993-2023 Alexander Roshal rar/whatsnew.txt0000644000175000017500000007600114462150076011560 0ustar zz RAR - What's new in the latest version Version 6.23 1. Bugs fixed: a) a security issue involving out of bounds write is fixed in RAR4 recovery volumes processing code. We are thankful to goodbyeselene working with Trend Micro Zero Day Initiative for letting us know about this bug. Version 6.22 1. Bugs fixed: a) extracting individual files from solid archives created by RAR versions older than 2.0, could fail in RAR 6.20 and 6.21. It didn't affect extracting the entire archive, which was performed correctly. Version 6.21 1. Bugs fixed: a) if unencrypted file was stored after encrypted in the same RAR archive and both files had been unpacked in the same extraction command, RAR 6.20 failed to unpack the unencrypted file. Version 6.20 1. Fixed the security vulnerability allowing to create unpacked files outside of destination directory and to copy files resided outside of destination directory into the destination directory. We are thankful to Simon Scannell from Google for reporting it. 2. If extraction command involves only a part of files in RAR archive, the additional archive analysis is performed when starting extraction. It helps to properly unpack file references even if reference source is not selected. It works for most of RAR archives except for volumes on multiple removable media and archives containing a very large number of references. Also in some cases such analysis may help to optimize the amount of processing data when extracting individual files from semi-solid archives created with -s and -se switches. 3. Switch -ams or just -am together with archive modification commands can be used to save the archive name and creation time. These saved parameters are displayed in header of "l" and "v" commands output and can be restored with -amr switch combined with "ch" command, such as "rar ch -amr arc.rar". If -amr is specified, "ch" ignores other archive modification switches. Restoring involves renaming an archive to original name and setting the saved time as the archive modification time. 4. Faster RAR5 compression of poorly compressible data on modern CPUs with 8 or more execution threads. This applies to all methods except "Fastest", which performance remains the same. 5. "Repair" command efficiency is improved for shuffled data blocks in recovery record protected RAR5 archives. 6. If file size has grown after archiving when creating non-solid RAR volumes, such file is stored without compression regardless of volume number, provided that file isn't split between volumes. Previously it worked only for files in the first volume. 7. When archiving from stdin with -si switch, RAR displays the current amount of read bytes as the progress indicator. 8. If wrong password is specified when adding files to encrypted solid RAR5 archive, a password will be requested again. Previous versions cancelled archiving in this case. Version 6.12 1. Security vulnerability allowing to create unpacked files outside of destination directory is fixed. This issue exists in Unix RAR only and doesn't affect WinRAR and Android RAR. We are thankful to Simon Scannell from SonarSource for reporting it. Version 6.11 1. Switch -mes can be also used to suppress the password prompt and abort when adding files to encrypted solid archive. 2. Additional measures to prevent extracting insecure links are implemented. Version 6.10 1. Switch -si can be used when extracting or testing to read archive data from stdin, such as: cat docs.rar | rar x -si -o+ -pmypwd dummy docs/ Even though the archive name is ignored with this switch, an arbitrary dummy archive name has to specified in the command line. Operations requiring backward seeks are unavailable in this mode. It includes displaying archive comments, testing the recovery record, utilizing the quick open information, processing multivolume archives. Prompts requiring user interaction are not allowed. Use -o[+|-|r], -p or -mes switches to suppress such prompts. 2. New -ep4 switch excludes the path prefix when archiving or extracting if this path is found in the beginning of archived name. Path is compared with names already prepared to store in archive, without drive letters and leading path separators. For example: rar a -ep4texts/books archive /texts/books/technical removes "text/books" from archived names, so they start from 'technical'. 3. New -mes switch skips encrypted files when extracting or testing. It replaces former -p- switch. 4. New -op switch sets the destination directory for 'x' and 'e' extraction commands. Unlike command line parameter, this switch also accepts paths without trailing path separator character. 5. If 'p' command is used to print a file to stdout, informational messages are suppressed automatically to prevent them mixing with file data. 6. "Generate archive name by mask" option and switch -ag treat only first two 'M' characters after 'H' as minutes. Previously any amount of such characters was considered as minutes. It makes possible to place the time field before the date, like -agHHMM-DDMMYY. Previous versions considered all 'M' in this string as minutes. 7. Maximum allowed size of RAR5 recovery record is increased to 1000% of protected data size. Maximum number of RAR5 recovery volumes can be 10 times larger than protected RAR volumes. Previous WinRAR versions are not able to use the recovery record to repair broken archives if recovery record size exceeds 99%. Similarly, previous versions cannot use recovery volumes if their number is equal or larger than number of RAR volumes. 8. Warning is issued if entered password exceeds the allowed limit of 127 characters and is truncated. Previously such passwords had been truncated silently. 9. Command line -en switch is not supported anymore. It created RAR4 archives without the end of archive record. End of archive record permits to gracefully skip external data like digital signatures. 10. Bugs fixed: 1) the total progress could be displayed incorrectly when using -oi, -f, -u switches or appropriate GUI options. Version 6.02 1. Switch -idn hides archived names also in 'v' and 'l' commands. It can be useful if only the archive type or total information is needed. 2. Bugs fixed: a) after archiving data including a lot of directories, Unix RAR could display less than 100% total progress percent, even though it added all specified files and directories to archive. Version 6.01 1. If -idn switch is used together with -t or -df in console RAR when archiving, it additionally disables "Deleting " or "Testing " messages, normally issued by these switches. Also -idn disables directory creation messages when extracting a file to non-existing directory. Version 6.00 1. "Ignore" and "Ignore All" options are added to read error prompt. "Ignore" allows to continue processing with already read file part only and "Ignore All" does it for all future read errors. For example, if you archive a file, which portion is locked by another process, and if "Ignore" is selected in read error prompt, only a part of file preceding the unreadable region will be saved into archive. It can help to avoid interrupting lengthy archiving operations, though be aware that files archived with "Ignore" are incomplete. If switch -y is specified, "Ignore" is applied to all files by default. Previosuly available "Retry" and "Quit" options are still present in read error prompt as well. 2. Exit code 12 is returned in case of read errors. This code is returned for all options in the read error prompt, including a newly introduced "Ignore" option. Previously more common fatal error code 2 was returned for read errors. 3. New -ad2 switch places extracted files directly to archive's own folder. Unlike -ad1, it does not create a separate subfolder for each unpacked archive. 4. When unpacking a part of files from solid volume set, RAR attempts to skip volumes in the beginning and start extraction from volume closest to specified file and with reset solid statistics. By default RAR resets the solid statistics in the beginning of large enough solid volumes where possible. For such volumes extracting a part of files from the middle of volume set can be faster now. It does not affect performance when all archived files are unpacked. 5. Previously RAR automatically resorted to extracting from first volume, when user started extraction from non-first volume and first volume was available. Now RAR does so only if all volumes between first and specified are also available. 6. Switch -idn hides archived names output in archiving, extraction and some other commands. Other messages and total percentage are not affected. You can use this switch to reduce visual clutter and console output overhead when archiving or extracting a lot of small files. Minor visual artifacts, such as percentage indicator overwriting few last characters of error messages, are possible with -idn. 7. Switch -mci is removed. Optimized compression of Itanium executables is not supported anymore. RAR still can decompress already existing archives utilizing Itanium executable compression. Version 5.91 1. Bugs fixed: a) Unix RAR failed to properly unpack files from subfolders of archives created by RAR 1.40. Version 5.90 1. RAR compression speed is improved for CPUs with 16 and more cores. 2. "Fastest" method (-m1 command line equivalent) typically achieves a higher compression ratio for highly compressible data types when creating RAR5 archives. 3. Maximum number of utilized threads is increased from 32 to 64. Command line -mt switch accepts values from 1 to 64. 4. "Repair" performance for RAR5 archives with recovery record and without data shifts is improved. It deteriorated in RAR 5.80 and is now restored to original level. 5. Password prompt is not issued when performing recovery record based repair for RAR5 archives with encrypted file names. This command can be performed without providing a password. 6. Bugs fixed: a) "Repair" command could erroneously display "Recovery record is corrupt" message when processing an archive with valid recovery record. This message did not prevent further repair operation. Version 5.80 1. It is allowed to combine several modifiers in the same -ts switch. For example, we can use -tsca instead -tsc -tsa. 2. Command line -agf switch specifies the default format string for -ag switch. It has a practical value only if placed to rar.ini configuration file or to RAR environment variable. For example, if we set RAR environment variable to -agfYYYY-MMM-DD, we can use -ag without a parameter with YYYY-MMM-DD format string assumed. 3. Switches -ed and -e+d can be used in archive processing commands for any combination of RAR and archive operating systems. In older versions RAR for Windows could not use them for Unix RAR archives also as RAR for Unix for Windows RAR archives. 4. Similarly to RAR5 volumes, recovery volumes in RAR4 format use the same width of volume number field as corresponding RAR volumes. While previously RAR could create arc.part01.rar and arc.part1.rev in RAR4 format, now both types of volumes will use "part01". 5. "Find string in archives" "i" command: a) if "t" modifer is used, additionally to already supported ANSI, OEM and UTF-16 encodings RAR will search the specified string in UTF-8 files as well; b) better performance, especially for case insensitive search; c) hexadecimal search output includes both text and hexadecimal representation of found matches. 6. Bugs fixed: a) previous RAR version failed to unpack folder records in archives created by RAR 1.50. Version 5.71 1. Ctrl+C allows to abort RAR "l" command quickly. In previous versions it could take several seconds until list command stopped. 2. Bugs fixed: a) in "RAR x -x arcname" command, parent directories of files matching the specified mask also were excluded from extracting. Version 5.70 1. Command line -ta, -tb, -tn, -to switches accept 'm', 'c' and 'a' modifiers after the switch name. So file time conditions can include not only the file modification time as in previous versions, but also creation (ctime "change time" for Unix) and last access time. Such switch can include multiple modifiers to set the same date for all specified times. For example, -tamc20190215 will process files modified and created after 2019-02-15. New 'o' modifier permits to switch from AND to OR logic, so -tamco20190215 includes files modified or created after 2019-02-15. It is also allowed to specify several time filtering switches with different dates in the same command line, like: -taco20190201 -tbmo20190210 Switches -ta and -tn also include files matching the specified date exactly. Switches -tb and -to exclude such files. 2. New -ad1 switch can be used when unpacking multiple archives recursively, such as 'rar x -r -ad1 arc\*.rar'. It creates a separate folder for files unpacked from each archive, but unlike already existing -ad switch, it creates such folders in each archive folder. 3. Bugs fixed: a) RAR mixed up source and destination file sizes and times in the overwrite prompt when updating a file in RAR archive with -o switch; b) commands modifying an existing RAR4 volume reset the volume number field to 1. While it did not affect extraction, tools like WinRAR displayed a wrong volume number for such volumes; c) fixed a crash when reading an archive comment from a corrupt RAR file. Version 5.61 1. Fixed a crash when processing corrupt RAR archives. This issue may be also associated with security risks. Version 5.60 1. "Repair" command efficiency is improved for recovery record protected RAR5 archives. Now it can detect deletions and insertions of unlimited size also as shuffled data including data taken from several recovery record protected archives and merged into a single file in arbitrary order. 2. If encoding of comment file specified in -z switch is not defined with -sc switch, RAR attempts to detect UTF-8, UTF-16LE and UTF-16BE encodings based on the byte order mask and data validity tests. 3. "Update" and "Fresh" commands ('u' and 'f' in the command line mode) quit immediately if no files are to be updated. Previously they created a temporary archive before quitting when updating archives with recovery record or quick open information. 4. "Repair" command issues "Recovery record is corrupt" message after repairing RAR5 archive containing a broken recovery record. Previously such message was issued only by "Test" command and "Repair" handled most of recovery record damages silently. 5. Bugs fixed: a) fixed potential security issues when processing corrupt RAR archives; b) -tl and -tk switches did not work with archive modification commands; c) command like 'rar a arcname.rar subdir/arcname.rar' erroneously issued "No files" warning and refused to add the file. Version 5.50 1. RAR uses RAR 5.0 archive format by default. You can change it to RAR 4.x compatible format with -ma4 command line switch. 2. Added support for 1 nanosecond file time precision on Unix platform. 3. You can specify 'f' charset value in -sc switch to use UTF-8 encoding. For example: rar a -scfl arcname @filelist.txt to read contents of filelist.txt as UTF-8 text. 4. RAR "lt" and "vt" commands display file times with nanosecond precision. Such precision is used in RAR5 archives created by RAR/Unix 5.50. Archives created by Windows RAR version have 100ns file time precision. 5. Only '+', '-' and '1' precision modifiers are supported in -ts switch now. Use '+' to store the file time with maximum precision, '-' to omit the file time and '1' to store it with 1 second precision. Intermediate precision modes previously defined with '2' and '3' modifiers are not available in RAR 5.0 archive format and ignored by -ts switch. 6. If a wrong password is entered when unpacking an encrypted file in RAR5 archive, RAR proposes to enter a valid password for same file again instead of aborting extraction. 7. Bugs fixed: a) fixed crashes and security vulnerability when unpacking corrupt RAR archives; b) directory owners were not set when extracting RAR5 archives created with -ow switch; c) if only creation or only last access file time was stored in RAR5 archive with 1 second precision, such as with -ma5 -tsm- -tsa1 switches, this stored time was ignored when extracting. Version 5.40 1. If RAR recovery volumes (.rev files) are present in the same directory as usual RAR volumes, archive test command verifies .rev contents after completing testing .rar files. If you wish to test only .rev files without checking .rar volumes, you can run: rar t arcname.part1.rev 2. Previously "Synchronize archive contents" mode (-as switch) aborted if some of archiving directories could not be read. Now RAR continues performing the operation and preserves archived files matching unreadable directories. 3. If -iver switch is specified, RAR displays the version number and quits. You can run just "RAR -iver". 4. If -p switch is used without optional parameter, a password can be also set with file redirection or pipe. For example: rar -p myarc.rar myfiles < psw.txt 5. RAR treats 'arcname.partN' as 'arcname.partN.rar' if 'arcname.partN' does not exist and 'arcname.part#.rar' exists. For example, it is allowed to run: RAR x arcname.part01 to start extraction from arcname.part01.rar 6. Maximum comment length for RAR archives is increased from 64 to 256 KB. 7. Switch -scul can be used to process big endian UTF-16 list files as well, provided that they have a correct byte order mark. Previously it allowed only little endian file lists. Version 5.30 1. Directory wildcards are allowed in RAR command line in file names to archive. For example: rar a backup c:\backup\2015*\* Recursion is enabled automatically for such directory wildcards even if -r switch is not specified. 2. New 'R' object for -sc switch defines encoding of console RAR messages sent to redirected files and pipes. For example: rar lb -scur data > list.txt will produce Unicode list.txt with archived file names. 3. Console RAR "l" and "v" commands display file time in YYYY-MM-DD format. 4. "Test" command also verifies contents of NTFS alternate data streams in RAR 3.x - 5.x archives. Previously their contents was checked only during extraction command. 5. Bugs fixed: a) console RAR crashed instead of displaying an overwrite prompt when attempting to add files to already existing volumes; b) console RAR "lt" command did not display seconds in file timestamp. Version 5.21 1. While previous versions could produce RAR5 volumes of slightly smaller than requested size sometimes, such situation is less likely now. In most cases volume size equals to specified by user. 2. Now by default RAR skips symbolic links with absolute paths in link target when extracting. You can enable creating such links with -ola switch. Such links pointing to directories outside of extraction destination directory can present a security risk. Enable their extraction only if you are sure that archive contents is safe, such as your own backup. Version 5.20 1. RAR can read the default set of switches from .rarrc file stored in the user's home directory. Previously it was possible to define only the same set of switches for all RAR command with "switches=" string. Now .rarrc also allows to specify separate switch sets for individual RAR commands using the following syntax: switches_= For example: switches_a=-m5 -s switches_x=-o+ 2. File overwrite prompt displays the size and modification time for existing and new files. 3. When archiving from stdin with -si switch, RAR sets the current system time to modification time of archived file. Previous version did not set this time at all. 4. It is possible to use -si and -v switches together. Previous versions did not allow to create volumes when archiving from stdin. Version 5.11 1. Timestamp is set to extracted symlinks. 2. Bugs fixed: a) deleting a file in RAR5 solid archive containing files stored with -ver switch caused such files to lose version information. Version 5.10 1. Switch -ai can be used when creating RAR archive, so predefined values, typical for file and directory, are stored instead of actual attributes. Previously this switch could be used only when extracting. Version 5.00 1. New RAR 5.0 archiving format. You can use -ma command line switch to create RAR 5.0 archives. By default RAR creates archives in 4.x format. 2. Changes in RAR 5.0 compression algorithm: a) maximum compression dictionary size is increased up to 1 GB in 64 bit RAR. 32 bit RAR version can use up to 256 MB dictionary when creating an archive. Both 32 bit and 64 bit versions can unpack archives with any dictionary size, including 1 GB; b) default dictionary size for RAR 5.0 is 32 MB, typically resulting in higher compression ratio and lower speed than RAR 4.x 4 MB. You can use -md switch to change this value; c) -md switch syntax is modified to support larger dictionary sizes. Append 'k', 'm' and 'g' modifiers to specify the size in kilo-, mega- and gigabytes, like -md64m for 64 MB dictionary. If modifiers are not present, megabytes are assumed, so -md64m is equal to -md64; d) RAR 5.0 format includes Intel IA-32 executable and delta compression algorithms, but RAR 4.x text, audio, true color and Itanium algorithms are not supported. These excluded algorithms are not efficient for modern data types and hardware configurations; e) RAR 5.0 decompression can utilize several CPU cores. Though not to same extent as in compression algorithm, it improves the decompression speed on large files with poorly compressible data or when using BLAKE2 checksums. 3. Changes in RAR 5.0 archive format: a) file times are stored as Coordinated Universal Time (UTC) instead of former local time, making file exchange among several time zones more straightforward; b) file names and archive comments use UTF-8 encoding. 4. RAR 5.0 recovery record is based on Reed-Solomon error correction codes. If recovery record size is large enough, 5% and more, the new error correction scheme provides much higher resistance to multiple damages comparing to RAR 4.x recovery record. Smaller record, such as 1 - 2%, or less random damage type would result in less difference between 4.x and 5.0. For single continuous damage 4.x and 5.0 efficiency is about the same. Additionally to usual data erasures, the new recovery record is able to detect deletions and insertions of much larger size than in previous RAR versions. Maximum insertion size is several megabytes. Maximum deletion size depends on the damage type and in some cases can be as large as the recovery record size. Still, the best recovery performance and efficiency is achieved if no deletions and insertions are present, so all data including damaged sectors preserve their original positions. Thus, if you use some special software to copy an archive from damaged media, it is better to choose the mode, when damaged sectors are filled by zeroes or any other data instead of cutting them out completely from resulting file. RAR 5.0 recovery record is more resistant to damage of recovery record itself and can utilize a partially corrupt recovery record data. Note, though, that "Repair" command does not fix broken blocks in recovery record. Only file data are corrected. After successful archive repair, you may need to create a new recovery record for saved files. New recovery record is not based on 512 byte sectors anymore and incorporates more complicated data structures. So it is impossible to specify its size in sectors. For RAR 5.0 archives the parameter of -rr[N] switch and rr[N] command is always treated as a percent of archive size regardless of presence of % character. Typically N% recovery record can repair up to N% of continuously damaged data and increases the archive size by only slightly more than N%. Ability to fix multiple damages is proportional to N. We used "Screaming Fast Galois Field Arithmetic Using Intel SIMD Instructions" paper by James S. Plank, Kevin M. Greenan and Ethan L. Miller to improve Reed-Solomon coding performance. Also we are grateful to Artem Drobanov and Bulat Ziganshin for samples and ideas allowed to make Reed-Solomon coding more efficient. 5. "Test" command verifies validity of RAR 5.0 recovery record. Recovery record is tested after processing all archived files. If corrupt archive contains the recovery record, it might be possible to repair it even if recovery record validity test is failed. "Repair" command attempts to utilize even a partially damaged recovery record. So treat the negative recovery record test result as a reason to re-create the archive if original files are still available, but not as a reason to avoid "Repair" command. 6. Changes in RAR 5.0 encryption algorithm: a) encryption algorithm is changed from AES-128 to AES-256 in CBC mode. Key derivation function is based on PBKDF2 using HMAC-SHA256; b) special password verification value allows to detect most of wrong passwords without necessity to unpack the entire file; c) if archive headers are not encrypted ("Encrypt file names" option is off), file checksums for encrypted RAR 5.0 files are modified using a special password dependent algorithm, to make impossible guessing file contents based on checksums. Do not expect such encrypted file checksums to match usual CRC32 and BLAKE2 values. 7. Switch -htb allows to utilize 256 bit length BLAKE2sp hash ( https://blake2.net ) instead of 32 bit CRC32 as a file checksum. While producing slightly larger archives, BLAKE2 can be used for file contents identification. If two files have the same BLAKE2 value, it practically guarantees that file contents is the same. BLAKE2 error detection property is also stronger than in much shorter CRC32. 8. Features removed: a) authenticity verification feature did not provide the required level of reliability and was removed; b) switch -en (do not add "end of archive" block) is not supported by RAR 5.0 archives, which always have the end of archive block. This block helps RAR to safely skip external data like digital signatures appended to archive; c) old style extension based arcname.rNN volume names are not supported by RAR 5.0 archives, which use only arcname.partN.rar volume names; d) file comments are not supported anymore both in RAR 4.x and RAR 5.0 archives. Console RAR 'cf' command is removed. It does not affect the archive comment support, which is present in both versions of archive format and is not planned for removal. 9. Switch -oh stores hard links as link instead of file. It is available only for RAR 5.0 archive format. 10. Changes in recovery volume processing in RAR 5.0 archive format: a) maximum number of RAR+REV volumes in RAR 5.0 format is 65535 instead of 255; b) recovery volume operations are faster than in RAR 4.x; c) additionally to recovery data, RAR 5.0 REV files also store service information such as checksums of protected RAR files. So they are slightly larger than RAR volumes which they protect. If you plan to copy individual RAR and REV files to some removable media, you need to take it into account and specify RAR volume size by a few kilobytes smaller than media size. 11. Command line RAR returns the exit code 11 if it can detect that user entered a wrong password. This code can be returned only for RAR 5.0 archives. It is impossible to distinguish a wrong password and data damage for RAR 4.x archives. 12. 'v' and 'l' commands display archived file names in the end of line, not in that beginning as before. Also some fields previously available in 'l' and 'v' output are now shown only by 'lt' and 'vt'. 'vt' and 'lt' commands provide the detailed multiline information for every archived file. 'vta' and 'lta' also include service headers into list. 13. UTF-16 little endian encoding is used in RAR log file rar.log, so Unicode file names are stored in the log correctly. You can use -scg switch to change the default log file encoding, such as -scag for native single byte encoding. 14. Command line 'r' (repair) command can include an optional destpath\ parameter defining the destination folder for repaired archive: rar r archive.rar destpath\ rar/acknow.txt0000644000175000017500000000524114462150076011200 0ustar zz ACKNOWLEDGMENTS * We used "Screaming Fast Galois Field Arithmetic Using Intel SIMD Instructions" paper by James S. Plank, Kevin M. Greenan and Ethan L. Miller to improve Reed-Solomon coding performance. Also we are grateful to Artem Drobanov and Bulat Ziganshin for samples and ideas allowed to make Reed-Solomon coding more efficient. * RAR4 text compression algorithm is based on Dmitry Shkarin PPMII and Dmitry Subbotin carryless rangecoder public domain source code. You can find it in ftp.elf.stuba.sk/pub/pc/pack. * RAR encryption includes parts of public domain code from Szymon Stefanek AES and Steve Reid SHA-1 implementations. * With exception of SFX modules, RAR uses CRC32 function based on Intel Slicing-by-8 algorithm. Original Intel Slicing-by-8 code is available here: https://sourceforge.net/projects/slicing-by-8/ Original Intel Slicing-by-8 code is licensed under BSD License available at http://www.opensource.org/licenses/bsd-license.html Copyright (c) 2004-2006 Intel Corporation. All Rights Reserved Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * RAR archives may optionally include BLAKE2sp hash ( https://blake2.net ), designed by Jean-Philippe Aumasson, Samuel Neves, Zooko Wilcox-O'Hearn and Christian Winnerlein. * Useful hints provided by Alexander Khoroshev and Bulat Ziganshin allowed to significantly improve RAR compression and speed. rar/makefile0000644000175000017500000000065414462150076010660 0ustar zz################################################################### # Installing RAR executables, configuration files and SFX modules # # to appropriate directories # ################################################################### PREFIX=/usr/local install: mkdir -p $(PREFIX)/bin mkdir -p $(PREFIX)/lib cp rar unrar $(PREFIX)/bin cp rarfiles.lst /etc cp default.sfx $(PREFIX)/librar/license.txt0000644000175000017500000001514114462150076011340 0ustar zz END USER LICENSE AGREEMENT The following agreement regarding RAR (and its Windows version - WinRAR) archiver - referred to as "software" - is made between win.rar GmbH - referred to as "licensor" - and anyone who is installing, accessing or in any other way using the software - referred to as "user". 1. The author and holder of the copyright of the software is Alexander L. Roshal. The licensor and as such issuer of the license and bearer of the worldwide exclusive usage rights including the rights to reproduce, distribute and make the software available to the public in any form is win.rar GmbH, Marienstr. 12, 10117 Berlin, Germany. 2. The software is distributed as try before you buy. This means that anyone may use the software during a test period of a maximum of 40 days at no charge. Following this test period, the user must purchase a license to continue using the software. 3. The software's trial version may be freely distributed, with exceptions noted below, provided the distribution package is not modified in any way. a. Nobody may distribute separate parts of the package, with the exception of the UnRAR components, without written permission. b. The software's unlicensed trial version may not be distributed inside of any other software package without written permission. The software must remain in the original unmodified installation file for download without any barrier and conditions to the user such as collecting fees for the download or making the download conditional on the user giving his contact data. c. The unmodified installation file of WinRAR must be provided pure and unpaired. Any bundling is interdicted. In particular the use of any install or download software which is providing any kind of download bundles is prohibited unless granted by win.rar GmbH in written form. d. Hacks/cracks, keys or key generators may not be included, pointed to or referred to by the distributor of the trial version. e. In case of violation of the precedent conditions the allowance lapses immediately and automatically. 4. The trial version of the software can display a registration reminder dialog. Depending on the software version and configuration such dialog can contain either a predefined text and links loaded locally or a web page loaded from the internet. Such web page can contain licensing instructions or other materials according to the licensor's choice, including advertisement. When opening a web page, the software transfers only those parameters which are technically required by HTTP protocol to successfully open a web page in a browser. 5. The software is distributed "as is". No warranty of any kind is expressed or implied. You use at your own risk. Neither the author, the licensor nor the agents of the licensor will be liable for data loss, damages, loss of profits or any other kind of loss while using or misusing this software. 6. There are 2 basic types of licenses issued for the software. These are: a. A single computer usage license. The user purchases one license to use the software on one computer. Home users may use their single computer usage license on all computers and mobile devices (USB drive, external hard drive, etc.) which are property of the license owner. Business users require one license per computer or mobile device on which the software is installed. b. A multiple usage license. The user purchases a number of usage licenses for use, by the purchaser or the purchaser's employees on the same number of computers. In a network (server/client) environment the user must purchase a license copy for each separate client (workstation) on which the software is installed, used or accessed. A separate license copy for each client (workstation) is needed regardless of whether the clients (workstations) will use the software simultaneously or at different times. If for example you wish to have 9 different clients (workstations) in your network with access to RAR, you must purchase 9 license copies. A user who purchased a license, is granted a non-exclusive right to use the software on as many computers as defined by the licensing terms above according to the number of licenses purchased, for any legal purpose. 7. There are no additional license fees, apart from the cost of the license, associated with the creation and distribution of RAR archives, volumes, self-extracting archives or self-extracting volumes. Owners of a license may use their copies of the software to produce archives and self-extracting archives and to distribute those archives free of any additional royalties. 8. The licensed software may not be rented or leased but may be permanently transferred, in its entirety, if the recipient agrees to the terms of this license. 9. To buy a license, please read the file order.htm provided with the software for details. 10. You may not use, copy, emulate, clone, rent, lease, sell, modify, decompile, disassemble, otherwise reverse engineer, or transfer the licensed software, or any subset of the licensed software, except as provided for in this agreement. Any such unauthorized use shall result in immediate and automatic termination of this license and may result in criminal and/or civil prosecution. Neither RAR binary code, WinRAR binary code, UnRAR source or UnRAR binary code may be used or reverse engineered to re-create the RAR compression algorithm, which is proprietary, without written permission. The software may be using components developed and/or copyrighted by third parties. Please read "Acknowledgments" help file topic for WinRAR or acknow.txt text file for other RAR versions for details. 11. This License Agreement is construed solely and exclusively under German law. If you are a merchant, the courts at the registered office of win.rar GmbH in Berlin/Germany shall have exclusive jurisdiction for any and all disputes arising in connection with this License Agreement or its validity. 12. Installing and using the software signifies acceptance of these terms and conditions of the license. If you do not agree with the terms of this license, you must remove all software files from your storage devices and cease to use the software. rar/unrar0000755000175000017500000131377014462150076010244 0ustar zzELF`4p4 (444  TTTHH H N  hhh Ptd006 06 \ \ QtdRtdHH H /lib/ld-linux.so.2GNU|A q|(ȁ ҝcŬKx fUa&9ByIkMRpbC|K}Dv%# ie=.c)N[l^M-v:b0;4(;. XQ)aqSC }   " X ,! ,!sdm !7@"   !TH" ~  !Нlibstdc++.so.6__gmon_start__pthread_createpthread_join__cxa_call_unexpected__cxa_end_catch__cxa_throw_ZTVSt9bad_alloc_ZTISt9bad_alloc_Znaj_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEE10_M_replaceEjjPKwj_ZSt9terminatev__cxa_begin_catch_ZTVN10__cxxabiv116__enum_type_infoE_ZSt20__throw_length_errorPKc_ZNSt7__cxx1112basic_stringIwSt11char_traitsIwESaIwEED2Ev_ZSt17__throw_bad_allocv__gxx_personality_v0_ZTVN10__cxxabiv120__si_class_type_infoE_Znwj_ZNSt9bad_allocD1Ev_ZTVN10__cxxabiv117__class_type_infoE__cxa_allocate_exception_ZdlPv_ZdaPvlibm.so.6libgcc_s.so.1_Unwind_Resume__udivdi3__umoddi3__divdi3libpthread.so.0writepthread_cond_destroypthread_mutex_initpthread_cond_broadcastpthread_cond_waitpthread_mutex_unlockpthread_cond_signallseek64pthread_cond_init__errno_locationpthread_mutex_lockpthread_mutex_destroyfsynclibc.so.6_IO_stdin_usedputwcharwmemsetfflushstrcpyexitsprintfsetlocalembrtowctowlowerwcsncpystrncmpstatvfs64wcrtombwcspbrkftruncate64mbsrtowcsclosedirstrncpymkdirreallocclocktowupperstdinmemchrgetpidstrdupchmodflockfgetws__ctype_get_mb_cur_maxisattylchownsymlinkgetpwnamstrlenwcschrlocaleconvstrstrutimensatrmdirmemcmptouppervfwprintf__fxstat64getgrnamstdoutmemcpyfclosewcscmpmallocgetpassumaskremove__lxstat64opendir__xstat64getenvstderrwcscpyfilenogetcwdfreadrenamelocaltimemktimereaddir64wcsdupvswprintfwcstolfopen64wcsrtombsaccessstrcmpstrerror__libc_start_mainwcslenwcsncmpwmemmovesysconfwcsstrfreewcsrchrGCC_3.0GLIBC_2.0CXXABI_1.3GLIBCXX_3.4.21GLIBCXX_3.4GLIBC_2.2GLIBC_2.6GLIBC_2.1GLIBC_2.3.2            E0P&y ii '@ӯk1q<t)KiPii Wii aii kii 'ii kii Wii 'ri u uX }   ~  " |@" H"       $ ( ,  0  4  8  <  @ D H L P T X \ ` d h l p t x |     ! " #  $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; <! =! >! ? ! @! A! B! C! D ! E$! F(! G,! H0! I4! J8! KLtT$@oAo fpfpJ u9t$)D ffff.IuD |$  D$P11R)؉D$fff.E;$lsQt,RT$9u$h\$ D‰苬$hA|Ջ|Fu1ꋄ$hL^_[]@WVP P D$1AF=P  P" hVP̰LJLB ^_SWVT$t$D$ffffff.8 t tu1tJ11@t "u$@"t tF tAt39s/tg|$\$ V~ @fy/t H}j.QttWh V$^_[^_[DVt$t%4$ ~ @@y/tH}1Ή4$D$.^@WVPt$tx>ts V~ @f.y/t H}|$j.QtWh VTWh(VB^_Vt$tU4$,~ @@y/t H}Ή4$D$.=tL$$L$1^ D$th0PW1  D$$o1 f D$$O fDVt$4$Pt|/tA;L$s/D^USWV $, $$ $ \$hVSN 6 St"|/tAwD /DhUSWS$4  ^_[]fffff.SWVt$||$N WS~ P@y/t J}\$)9r(~4@f.~/t H})VWS^_[ÐVt$4$~(L9/tHP} qM^fWVPD$|$t$t Hv(1K ht#WVPR%W4ВVWhV^_USWV |$$t$(l$ ft+V4ԒWALfff. ht VWP豦VhWffff. Wt |/tA9s/DVUWE|$,t W+C6 ^_[]fffff.USWV t$ 4$ ~ @Dy/tH}>u v΃>to4$|$9vtfD݋E$]9vu9v.t$u9w ^_[]É4$D$.9C߅D߉fff.SWV|$ \$$!<$"~ @y/t H} $D$./ƅ~t,4$D$߫t4$D$$˫ى4$D$))L$>.~D$(F$j*F $W4$GLA:LD9@H.4A0H@:t\$D$$_\$<$D$<$~ @fy/t H} $D$.ƅt >.^_[É<$[Ƌ@:ufff.9F0r@$Kt2@:t뮍F)D$8$)\$w닉<$ N9t9P@u1_aTfffff.Vt$j:V-t1^Ët‰D rt.uQ/uf.QuօthDVf.USWV t$ .tu\$$D`Efff.UW ut __t" t.t :t D~/u_nu ^_[]fSVT$D$Jt.t$ 1ffff.\/tt߈<A9r1^[fff.SVT$D$Jt.t$ 1ffff./\tt߈<A9r1^[fff.SWVT$D$Jt/t$1fff.<\/ttA9r1^_[fDSWVT$D$Jt/t$1fff.$t4u$X=$T=t$D$ $,$;<$l؁<=^_[] Ɖ,$;<$C4$ USWV $( t$h$( VD$ l$Uj|$ 1ff. VG t@{h$( V(D$ $0 UW}C|$ uLCrD$, u: $, hPV$0 US'$( V$,  ^_[]fUSWVDL$ B+L$lEƒ8Eȃ$hQVR1111 D{C{t}tT$L$ P菢HDYDDDMutD$MINl$ $ ElD$ u"GNtL$9v[ VL$ )wBD$D$ U@PUt$$bt$jNt$L$ $El$ 9G\;1T$CD$$D$ |$,WD$0PW%\$to Sa~ @@y/t H}كj.QtǍ$$DŽ$$t0hWD$Pfq$$DŽ$$D$ S~$ @ffffff.y/t H}ك9DȃhQt$D$D\$HxD)x"1ɃD$(H PHm$Iʉ))1\$t$,hP$t$0hP$t$4hP$t$8hP$t$G#Gu#VhT RjhT  ^_[]fUSWV $$$ $(l$hUVN) @hPU諹GGG0GGGhVP~G#GuVhT 1 ^_[]Vt$FN!t~tFFF^É$AFFFu׀~t0$T t$1WVPt$|$0WV訿tWVthWV1^_fUSWV l$(|$ \$$Gu"O!u jغGOUSPO9G0D$ff.jt$hT tP9s.~*݋X WP)jRPWӉl$8USwø9ut$ jhT 1G  ^_[]fffff.USWV|$01 dD$D$u WPD$T$D$4\$8O01L$ D$f.u1GG GSt$ Pʼn\$tQ|$0\$)Gl$tffffff.LJ0 tG11t$t$0L$T$jRQVPBÃ~u1FF NPt$ Qt$DŃD9|$fD$D$D$utPuG u#t$hT 1|$0\$AB1w D$PD$PD$Pt$$hT x |$u|$uuu~w$G(1^_[]ff. T$L$D$zuBB1RQPRۺVt$t$t$t$V6u~t0VhT ^Ã^fffff.USWV $ EM!$($$$,}}tu`M$E(9|R)dz)E$M( EB΃QL$QUP1}yat]E UPtBD$EjjjUPE UPD$E$jSt$UPD$$ƋE1E SWVP!ƒÉ؁ ^_[]ËEt$hVUP~ff.E$M(EhVUPfff.USWV t$  VPD$jjjVP VPËjWt$VP؉ ^_[]Vt$F#Ft~u(F$V(=~t-F0PhT ~tjjjv^ø^ffff.ffffff. D$D$ T$jRPQD$ f D$jPt$fDVD$p PQRPV^Ð D$@$~ f.ffffff. D$0t$t$PÐUSWV$4$8t Ft G1Ʌu1ۉ<̓D$ hP$<t3 W_\$D$ W[jhʚ;RP\$D$?D$ t/ VD$ Vjhʚ;RPв ?D$D$jSD$$Pj[^_[]ffff.USWV L$$|$(t$ t"ʚ;^LnHՃUPQ\$,t"ʚ;NTnPՃUPWt$ʚ;NDn@փVPSZ ^_[]ffff.SWV`t$x|$tD$pL$Qpj\t$ʚ;L$Ll$HӃSPW|$|t$ʚ;L$Tl$PӃSPVt$ʚ;L$Dl$@փVPW`^_[fD L$AI!t$D1 USWV,\$Ll$HD$$Mƅu $T ؃D$t$5D$$ ȉL$D$1D$ 览|$ى\$(EŁML$@ʋ ID$t$$щŅD$l$D$D$D$\$$D$ |$(T$ L$DD) \$t$WٹF 1D$t 4$|T$,^_[]Ët$D$ ut$Džt4$J<$"fffffffD$H#HfffffffSV$t$hV$z۸t$PVk1u誮19@^[fDUSWV ($ (B8f)$9$ |$t$É$\D$ DŽ $D$lj|$z<$D$藫tG$((u=$@$ $L$$ʿD$$xE*$$(uF4$8$u0D$ 4$D$lj|$py<$D$À1ۉ؁ (^_[]fD t$ t$t$D1ffff.WVd($hhV$|(|$hhWVx|$dEǃL$QP1u$L$d$ʁd(^_ffffff.Vt$ hV$`xjV©^fSWVP@$`@4$x$H <$t$<$%DŽ$, DŽ$( DŽ$4 DŽ$0 DŽ$< DŽ$8 D$<$D$D$É<$衹-|$4$D$|$w<$D$É؁P@^_[Ɖ<$Z4$"ffffff.#D$=@fffff.L$tɁt t1D#D$=fffff.#D$=fffff.V$t't$ hVPvhV芧^ffffff.Vht$lhV$|@vD$ PVj 1uD$h^fDWV$|$hW$uVW^_f.USWV$ $ W迪D$D$ \$$S SjhRP 膧D$عZ| )t$l$ t$$L$ iP)Ð St$$hj2V軩 Vt]D$;$ sPt$ Vt$Zh$W$ tjWCMt$ 1^_[]fffff.USWV$$$$ QPʼnT$ |$ t$5 u $D$ T$tRfnfpfD$0fD$@fD$tD$pfD$`fD$PD$x D$oSW^_[ffffff.Vt$ hV$n Vd^@Vt$ hV$n V账^ffUSWV D$0t$(t Vto1ۃ|$$l$<|$,SUt$Dt$DWVt$<蘼 tt1ufhhT . Vul$$tF|$@WVUu_D$ OPjVWVU:D$ OPjV VzD$0t1ۉ؃ ^_[]fffff.USWV $ Wfƃ W84E)l$VjWShhU躡 U~tBfG=?BwOVW$, ShhUy U=GuŃ$( U$, 1 ^_[]fffffUSWV l$ t6E\$$ UPƉ׃SU-ËEjWVUP1 ^_[]fff.USWV$0$4u`E,$D$ D$L$P,$,$ 14fE04p(,$D$ D$D$։,$2P*uu 0fn$Pfp$TDŽ$dDŽ$hDŽ$lDŽ$tDŽ$pDŽ$|DŽ$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$:DŽ$$P$[1 ,$cT$D$,$D$ ։,$D$7Q^_[]󃽤_0 \$ $G|$zu$T 1MD$It$D$,$щËL$99 $| 9G|$ D$D15D$x\$ $莹Ƅ$uQ,$D$,$\$ pD$xˉ$'D$كƅ  D$xl$D$$fnƍ$4Ƅ$fpD$<$D$D$/Ƅ$D$x$PD$4$_4$D$D$ f$MDŽ$MƄ$MD$4$D$xgt<$g4f9ueD$$T$(L$xD$T$ $R\$ D$$3@9C+CD$$iCL$Gr0fnfpD$,D$<D$@D$DD$LD$HD$TD$PD$\D$XD$dD$`D$lD$p:D$hl$(D$($\$ ZC D$D$ $+D$(S T$L$$h$ț9Cs+CD$$TC14$aD$x$艹t1D$$T @t0\$D$D$D$$T9L$ k9iqsYD$D$+AD$ $诪9vBL$D 9Gʼn $D$mŅu"D$1D$$T  .9wl$|$ DOL$D$,$g$蝚9Gs+GD$<$),$M>^_[]ËD$0D$fnfp$TDŽ$dDŽ$hDŽ$lDŽ$tDŽ$pDŽ$|DŽ$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$:DŽ$$P$P$jD$$V"l$Åt$,$7É4$_ÍD$x$;$USWVW)$jjPt$<]tQ\$D$k9ʼnl$vET$ tD9Չv@RhhhT  hT L$D$14$A| 9GWt$ ƅu hT Y4$|$D$|$4D9os+oUWoD$0uw7t$ i9x$uwQPeSQPf 79GsO)ȃPWyG$t P菘؃^_[]Ƌ$t Pn VB ffffff.USWV,l$@@*^W)D$E@,$ЉƉ׍D$,$D$ËE@|$t$,$D$ ЄtB\$|$D$$e$觼L$)DljD$ $ D$t$苗,^_[]ƋD$t$o4$G@USWV\$0$8 4$h)<$t$藱X*|$ǃH*ǃD*,$1{|$4`4X4ǃ\4ǃ`4ǃt4ǃp4ǃTǃTǃTǃTǃTǃTǃTǃTǃTǃTǃǃǃ$ǃ ǃ,ǃ(ǃ4ǃ0ǃ<ǃ8ǃ@*<*u$glj<$}@*4K,ǃǃH*ǃD*fǃǃL*ǃǃǃǃǃǃǃǃ$8ǃ|4ǃx4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ǃ4ƃwǃwǃƃʼƃT*ƃ3ǃǃмǃ̼ǃؼǃԼǃܼǃǃ^_[]ÉD$<$貒D$ND$TD$ZD$t$Tt$X49t$d,$,yD$$D$$ $D$$耕ffff.WVPt$<*@*gt$g$Hgt$6(gt$$ft$pft$ft$<$vt$ԒTt$’X4`49t$:X*$wh)$讯8 4$ ^_VfD D$$ fVXt$`D$dD$4$0fnD$fp$D$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P9D$Ht$苮D$$T X^fUSWVl$ƃƃ S[0fnfpD$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H;$D$@\$ D$ P譭4jWSPǃ4R 4Rua|>SuZ|>FuS|>XuLrBau=|ru6|!u/|u(|u!T^\Ef@I96t Vs0fnfpD$D$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H<D$@$ D$ P贪4jVSP>4 SQ tNf.jSPP*t&u T*u S u11$t Љ<fnC0fpD$D$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@$ D$ PD$U04҈tT*t ^{T SPP*Ɖ)D$P SP*ttRu!t 41jSP SPu<:86420.,*lj4$*O&"  $D$@,t$Dt4$4$N$t$?P<$R@VXt$`L$fn $fpD$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HF0D$lƆD$$T vX^ÐUSWV |$ <$=ƅtNl$$fffff.t P*t)u%9P*t<$H<$Cu1 ^_[]ffff.USWV |$ <$ƅtrxfff.P*tPtt-f$P*uD$$,$D$Qt<$<$LCu1 ^_[]fUSWV l$ 24D4 H4tzE UPNjEjH4D4UP Uƅt1u(P*uxh(PIPEjSWUP UƅtrxP*tYtt.f#P*uh(WOt! Ur UCu1 ^_[]WVTt$`4$11 u33 0fnD$fp$D$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P8D$Ht$PiD$$T <T^_fDVXT$`L$dD$hfnfpD$D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P"0T$L$ L$D$HD$ $hD$$T }~X^VXt$`@*ggN0t$dPQjpnur VP fnfpf$fD$fD$DD$@fD$0fD$ D$H D$ PghhT y@*ƀ*X^DWVP|$t$@*u4$|@*u4$3^_ffff.VD$ u1Ҁ P$T$(f0/t6\tu3ff.uu_/^fDUSWV $ $ K);K3 K' $ $ q(ABt$4r0h |$\D$`t$$ $JƸ|$\C$ t$|$$K7$ t0<$dJ\$`Ƹ<$Ct$\$PK3$ @t<$$JC@t<$ JCƆ@$ uF1)ʋ|$D9WsЉ+G<$D$$HWT$4$D$J4$I$ $ 4$H< $L$ D$D$É$?fo$L$tG9r^_[]@SWVL$D$t-T$\r|r \t9΍vr^_[USWVt$l$|$OD OVwEEωօuf.=w)O|!$? ]Ef.ǁu!:u 8$=w0I|3 ]$? ?ˀ]EO=DI8] ?ˀ]$? ?ˀ]EE^_[]fWVL$ 11t|ffff. @XCw#u#q!ցux B@qu@^_fUSWVT$D$ t$$ $Nffff.JxFʅSk<$uIDu. ˁ? υuT ˁZ݁??  ˉ߅'فutju`D$Bub???  NjD$!N8| $$$$^_[]ËD$$fff.SVPt$4$*u@IFtuy@tg t4t*t tu5fff.IFBffff.tu JIF}1^[ffffff.SVL$tsT$ 1y7@t_ t(ttt u-IBr FtuNIB}u1^[fffff.USWV \$ |$$$g*Ƌ$[*9u-f|+t,+$>*Ƌ/$1*9t19D 1 ^_[]USWV \$(1tjt$ l$$$)NjE$)9u8|t29t.$)NjD$$$)E9t19D 1 ^_[]ffff.USWV t$ >tI\$$;tB1D.$+Nj+$+9u|+mu~vu1 ^_[]ff.*ff.WVPt$t~$*Gu^_@WVPt$t~$(Gu^_@(ff.USWVD$0H-E19WЃ w01 1Z9ӃЃWЃ r܉مHȃ-Eȉ^_[]fDUSWVD$x-E/EЃ w=1 1ffff.Z/ӃЃUЃ r܃-ƺŅڄDDӉ^_[]fffffffff.ffffff.)ff. =` thhT Xà fffffSWVt$|$Ɔ& fdž$ t1G1110È$ % & Gu^_[f.SWV|$ t$$$)4$%D$t$$+f( f* LJ, t2F11fҋ11f, f. FuՃ^_[fffff.Vt$$ )dždž( eG!dž, sR^D$ǀfǀ$ ƀ& MÐSD$t,D$D>$D$<>>L$4D$,jjj P">PD$d>HD$\>8>@L$TD$L>X>`D$ L$>hD$>pD$$$t+D$$CD$CD$ L$K$t<1@T LA0 uD$Tj P~ t($  L$8WhQPVd D$4j P@ l^_[]fSWV0|$@t$D GD$ D$\$ jjjjPjS] GfnL$fnT$f`fafnD$f`faf`faffnL$f`faffnT$ f`faffnL$$f`faffnT$(f`faffnL$,f`fafffof ЕfpffpffpfpfbfpNffpff~OuQG\$ jjjjSj PW D$(GD$ G~D$~L$fO fG0^_[ÐUSWV |$ 1<$IG1$D$G$D$mG($D$XG8$D$C_<$GL$D$GT$D$Gd$D$Gt$D$_x$$D$$D$$D$$D$u$$D$G$D$1$D$$D$1$1$D$$D$ 4$D$8$D$ X$D$ x$"$D$W$D$ A$D$+$D$ $D$ $ $D$$D$ <$D$@$D$ `$D$ y$$D$K$D$ 5$D$$D$ $D$  $U]LJLJLJD$D$<$ ^_[]Íƍ $ $ x$${ƅuOsƅuƉ$)߃ff.$8ăT$ 111fȉ݉0 B߉u$ % & 1) P D$WPWj8 f( f* dž, \$ L$ 11fD11Auf, f. eD$PVeR P$PUQV 6 $L $L $L $L P$,PUQV0hD$Ph$Pt ^_[]@USWV$hhƅt)VjU$ǃ V9D$,D$( t$4V. VƉ‰=d 1ۃL$ T$|$JD$fo=fnfnfofo$fbft$fn<fpfofofffL$0fo fofofffofofpd$Df$ff\$fD$Pfo0fT$pfrf$foft$@f$ffl$`fo\$fofofrfrffffrfof$fffbfjfo$fofoffpNfpNffofffofffofjfbfofoffpNWfofWffpNffoffofjfofbfffpN׈fofpNffo$fofffoffofb-Pfj5PfoWd$@߈W\$ffpNffoffof\$PffpNffofo$ffol$0fo5Еψ($WL$pfffWfL$`fffgfoT$pffot$@fgfo @fgfo\$!fofffffffofoD$Pfl$0fol$`ffX9Ӊ֋L$ T$tQ,\$É΃8֋T$ ؋\$L$ D։$1@T$C9uD$d ^_[]ÐWV|$ G$D$G$D$G($D$G8$D$^_!Ɖ<$4$ ffffffWV|$ G$D$TG $D$ AG@$D$.GD$D$ Gd$D$ ^_Ɖ<$4$ ffffUSWV |$$t$ 9GʼnL$)͋N)9v5@ ULǃUt$ WYvt$)։9s*t_Vt$ Rt$ G~+Gt$ tTUt$ RA1t P,>F#t$ L$|$1ҍ )tPQW^ ^_[]UffD$xtfo fo fofo%fffofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvffffffff.USWVPl$ \$D$u1f 8t GN03l 9u)3A׉$Ël 3l %3l 3l $3l 3l %3l ؉3l wD$ ))t.D$Lfffff.A03l Mu؃^_[]VL$D$t)T$ fffff.2BƉIpu^fff=p tfo fo fofo%ff.fofoffrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvfffffofrffofvffffl f.l 3 l l 3 l l 3 l l 3 l l 3 l l 3 l l 3 l l lfffffD$@@ @@@@@@D$@@@@ffffff.L$D$AA AAAAA@USWV T$ \$$ztjjB)9)ȉ߃ǃWRFWRPQƋD$ (WUpD__;t5SROGSPQRw ؉މB1 ^_[]fff.SWVt$t+|$\$VScCVWPs^_[fDL$A;As PQ 1DL$QB;As Q1ÐVL$1Qr;qs Q^ÐUSWVL$1ҋqAn9s9^<7Y119Ÿs9|$$|00\0 (1q |$ ڋ$ ^_[]USWVD$($HX9ˉL$D$(C111D$fDT$(|$4$1ZT$||$  EE|$4$|$ IIy?w;\$[$r$ $1ҋ$^_[]ffffff.WVt$ L$1V9v!61<y |@9r1@^_fUSWV L$ l$(\$$yA)9BtVPSL$09s)UjSq ^_[]fffff.WVP|$t$D$OTq;WsVPQwVjPK^_DVL$1yr-D$qEPRj^fffff. T$JrQPjЃ ffffff.USWV D$,L$$);l$(sY111|$|$$t$n/|$ 4714$ EEt$|$<$IIy;l$(rD$,11 ^_[]fffffD$@@@ USWV(|$LD$H1ҾD$tD$|$T?97l$\$|$PD$ D$B;T$Ds;T$Ts D$@mыl$Ll$<ft MD$H 0FME<,<D<l9F$D$H0+|$DƉ+D$T9D$ G)v9ʼnD$F݃l$l$PDl$@D$D$ 9GD$9F)|;|$v|$Pl9D$ |$,D$)|$:1fnT8fn8f`f`fafafrfrT\9|$uƋD$;D$4$9smD$H|$P0F D$RfF9sJD$H7|7 NjD$P<%f9sD$H|$P0FD$D$|$LB;T$TM]s9D$TNɋL$PE(^_[]fD$ff. hhl t$ l  fffffUSWV @$(@$$@$ @<$MÃr$$$@\$<$D$t~D$ <$D$D$$$@$ D$\$$ƃtuPD$ \$$U$$@ #/\\ ED$ $ubt <$t_|$ D$ $D$D$ \$$u\D$ \$$t1u<$$@exD$ \$$}uD$ \$$wu$$@<$4 lj$* uxD$<$5‰4$$D$<$& @^_[]fDUSWV ֊T$ ffffff.O?t-*t1 9tԃ.t׃\t҃.tuO_.uv/*u"4$D$.uG4$D$.stxt-Ή$D$0unD$.,$@tST$ t/ffffff.ى<$u1~vu1 ^_[]ðɰty#|$ tl$<$ l$<$WVP|$t$Gf^jhʚ;PQ$ D$ PUlHHANH NHN HNNHN@F jhʚ;w7F^_Ð D$Hf^jhʚ;QR;WV4|$Dt$@GD$GD$ G D$GD$GHD$D$D$D$($ʚ;GjL {V4^_ffff.ʚ;L$d$jL {Qf D$jjdp0{Vdkt$dL$d$ ։q^@L$Qf^ff.jLL$ D$T$ {HSWVD$ Hf^jhʚ;QRD$ D$PtHPxp @  ` ȃ^_[USWVP?L$MT$|$\$l$ D$$D$D$0$Hʚ;jL {V<^_[]fUSWV L$ I f^jhʚ;QPD$ D$PYplH xXhF|$,tcD$jhʚ;D$(p0L$Pt$SWt$VUht$Pt$PF04t$,ht$0SWQVUht$@t$@ ^_[]DUSWV\|$tWD$$D$ )D$tt1ۍl$fffff.$(t%rC@wDW LJЉCuƸl$L$$T$ \$|$D$u 1111wL$0T$4\$8l$<Dt$@D$DD$0D$P$Mʚ;t$pjL {V\^_[]f.USWV |$$tp1D$@$1wB$ЗiŀQD$/iD$#k<D$l$$tDtCЋuD$D$$+ʚ;t$d$׺6eĉ)t$ jL {V ^_[]ffffff.Vt$D$$ʚ;d$jL {V^fffff.D$T$L$ Jfffff. ff.VL$t15Q°kd9ui9^fffffUSWV t$ D$$3v,$%v$v$0 {lj<$~H$0 blj<$~LF F$F F,F(F0fFXFZFFfdžF5F1F<F8F`F\FhFdFpFlFxFtFPF@FDFTdžF|dždždždž ^_[]Ɖ<$ Ɖ$t,$tD$$t4$ffff.D$@ @$@ @,@(@0f@X@Z@@fǀ@5@1@<@8@`@\@h@d@p@l@x@t@P@@@D@Tǀ@|ǀǀǀǀf.WVPt$~Ht<$\<$R~Lt<$\<$;$}s$osƔ4$as^_ff.USWVD$8l$0\$4ǃD|1D$D$fE4}D$ uut$@uEulEpt$M(U,)‰M(U, EY tD$uTjUt$)[fDU(M,9ȃL…f}Yt*Dt9}L$ƍ )΅NƋL$  QPEE4VSPQ}3L$ E@4EȀ VSt$t1D$E4}0+} L$ @*T$]$}lL$]p}|Rt$SWD$ T$L$Lu.;EPt)t$t$SWUUuxut }Pt!t t$ t$wFd^_ffff.Vh$t$h$D$t$ҙfnD$fp$D$D$,D$0D$4D$<D$8D$DD$@D$LD$HD$TD$PD$`D$\D$Xt$h^fDL$D$t!u!8w-@Ãtu8u@Ã8 t@Vt$ D$$D$D$4$ $$؜D$$ĜX F$ $D$D$( f t$jt$ USWV\$p$x F~ $tfnfpD$`D$pD$tD$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$XDŽ$\$\ l$dU. PhUP)fnfpD$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$PD$LD$Hl$ D$Pa~ t\^_[]Éً$$|D$X SPUWQ |$XtF ;tF fff.Vt$ D$$L$(L$D$4$`$D$؜D$$ĜF$$D$D$(5 fWVd$x$t$p|$`fn‰<$fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$d${|$$D$诔fnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$Fd^_fUSWV\$p~ $x$t$pl$\$D$l$蠓fnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$Pl$É<$D$+uF 1ۉ؁\^_[]@WVd$p~ $t|$`fn<$fpD$dD$tD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$D$`$|$$D$ؑfnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$$x$؜ D$$Ĝ>wF$B$D$D$(d VX $d $h $XL$t$PhV fnfpD$\D$lD$pD$tD$|D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$X t$dV PhVPȏfnfpD$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$PD$LD$Ht$ D$PX ^DWVd$x$t$p|$`fn‰<$fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$L$`DŽ$D$d" $|$$D$fnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$[F譗d^_@ t$jt$ WVd$x$t$p|$`fn‰<$fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$dR=$|$$D$OfnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$ Fd^_fWVd$x$t$p|$`fn‰<$fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ L$`DŽ$D$d荼$k|$$D$蟊fnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$XD$TD$P|$ Fd^_fVXD$dt$`fnL$fp $D$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PD$HD$ > tFX^ffff.VXL$dD$ht$`fnfpD$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PL$L$D$HD$ $`> tFX^ffff.\L$dD$hfnfpD$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X!L$L$D$PD$ $=T w T X \WVt$$|$ u u^_Åt!t$؜ZD$$Ĝ*t$<$.$蒷0$D$D$(踼 D ` ^ $$x: @x: s ${VD$L$APEVj׹Vj̹^ Xt( P9tt$t$Pq1 @  fVt$0^ffffffD$D D$t$ Vt$>u$臷^WVPt$|$FGFGFN O GF t?PWJ#NN$w< DG~ F ^_ffffff.USWVXL$pAm|$l$G=KW7T$1҃1$n_t9 $t9rffff.U\$xсy) x U9rOA=Qw1ҍF9GD$ L$ t$)T$1ҍ \$0$DD$1ff.9raL$\$\ 4L$\$)Ή)L)ߋ\$L)މL9t$9\$O9͋L$ OƋt$*<$C9r1T$D$0RDT$1D9rgL$t <2L$t$)ω)щLt$+t$L+|$L9|$|$|$9t$O9ϋL$ O֋t$*C9r$T$D1҉D$@9r[D$L((4 L$D$)Ɖ)щL+|$L+t$Lt$9t$9O9ȋL$ O֋t$*$C(9rt$ A9T$0L T1T119rnG=1XO1҉ȁD$4AGD$3,|W $ߋ<|O 3<|K 3|S 3<|W ͉|$<|O $3<|K |O %3|S 3|K $3<|W T$3|S 3|W 5t$Bt$$fff.3n3T$3~L$t$3N\$$,|O L$T$3,|K %3|S 3,|W  $͋ |O 3 |K 3|S \$(\$3 |W Ƌ$|O 3|K 3|S ڋ\$L$3|W T$($,$4|O 34|K 3|S t$3|W T$J fL$,$T$@<$f3]43}(3M,3E0\$<$|: |: |: |: |:  |: fn \$\$ ։t$fd$|: f`faT$$|: |: |: $|: |$ t$|: |: |: fnfl$fnfD$ fnf`ft$fafr|$|: f`faff|: fD$@frffoXftfًt$T$L$ foIfoP,^_[]ffffWVPD$|$1Gt% hΗƃhjVYw ^_ffff. D$xu@ t$ ËD$HL$ʃHD$P  +H@WVPt$|$F t~u$耙~ F^_fUSWV\D$|l$xL$puUD$tE8@8E0@0E(@(E @ E@E@EMH9Eˋq|$ {D$(ES[ MD$,D$ ʉ1!1ٍyZ1!1ً\$,ˉ]ى yZ]\$$ˉ]1!1yZ} |$0ω} 1!1>yZut$8ΉuƉ1!1Ɖ0yZut$ Ήu։1!1։2yZUT$ ʉUʉ1!1ʉyZ‰L$M1!1L$4ɉMىыT$1 yZU T$DʉU |$!1ډyZU$\$HT$ʉU$‰D$1!1‰yZE(T$D$@ȉE(t$1!1׋T$HyZE,D$ȉE,1#t$1yZG04$D$ȉG0ȋL$L$1!1ȉyZO4D$L$ɉO4ыT$1!1yZ1!NjF81߉D$<‰D$HF8t$@<yZD$LȉD$ËD$(1!1Ӊ3D$DyZ1!3D$13D$$ʼnD$(D$,݉+yZ3D$1!13D$<3D$0ƉD$,މ3yZӉ1!ËD$$13D$@3D$L3D$8D$$ى yZ1!ËD$013D$3D$ 3D$(ljD$0߉;yZωD$PD$81|$T1ˋL$ 3D$13D$,‰D$8D$Pډn1ËD$ T$13D$3D$43D$$ƉD$ D$<މ3n1ljD$1L$n|$ t$x3|$H1ЋT$41ȋL$3|$03|$|$ ʼn(n$l$ttuF$FBÉF^_[ffff.USWV l$ \$(|$$EtAt\urEvou uk hfƃjVYu ECESWPnEEuSWumEEt u ML P SWQ^_[]Éǃ Vi Wm DUSWV\ $p $t  ttt%gHJuHщJGX1|$L,ڃ<9ߍ ,, ,,t5h+Pf+,+, @v)89ߍ9@999$8 $< $@ $D t1h0 Plf@ $H D $L $P H h SP3f$t PW\\ ^_[]fffff.L$19uAffffff.WV$t$8|$Wt$<t VWuY$t(L$41tut uuD$;A$^_1uuoD$oIftf=uoD$oI1ftfɁtfffffffSWVp$$<$%$O4$D$D$跷\$p<$D$\$O2$p4$D$|$42|$$XifnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XD$Pt$y$T 荙D$ $T Y.fnfpD$tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$t$pt$pfD$`4$萃foD$`4$fD$pf$fDŽ$DŽ$f$f$DŽ$<D$ $T (1ۉ؁p^_[f.USWV $ $( $$ uO9BWVP33Bكl$SPU bD WVU5 ^_[]ffffff.USWVl$$$lD$L$$M/D$l$<$bm<$aHDt$l)͉D$4$l$bD,l<$Cdh4$PcDžo$4$gD$hGl$D$$l$e0fnD$fp$D$ D$0D$4D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`\\$D$Xt$D$ $T D$h4$D$ڷ-<$~fnfpD$ D$0D$4D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`Z|4$~fnfpD$ D$0D$4D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`[0L$\$D$XD$ $D$$T 訕l^_[]ffff.USWV\$t$p\$\D$\$<$p,ut3u,$at@wvu@uvt*v,$`t @w uBww$L$D$b0fnD$fp$D$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X\t$D$P|$:~D$ !,$U|fnfpD$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XZ|,${fnfpD$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X[0L$t$D$PD$ $}D$$T \^_[]Dffffff.VD$t^Àtt$u卆xhP buʃt$ V^ D$t'D$uutt$ Pà DUSWVL@$`@4$W^1=$d@|$t$D$<$t,$#^ƅtt$l$<$^1ۅDދD$$h@t11D;us%M;u$;}E9G؋DFuօۉt"lfff.E$}u<$]|9$(@t$ffffff.$|td$ CC CCC4$D$D$hn$%@tt 4$ҸtO9w$h@Ë$`@slj<$\D$|$ t$$D$>\؁L@^_[]1ff.USWVL@$d@$׉t1$l@1ۉ,$軉$h@D$fKE.ttHf.}.}u׋E$|{u}u…tE$c{tD$멃|$4$[=X$L t$D$$ r$[H 9$( f$ztjD$EEE EEE$D$D$lt$% $$ 9w$d@u$`@ǁ@,$ZÅt*\$l$4$ZutF$2zu'T$99 ˉ؁L@^_[]f.SWVϋ1w.uHG$yuÃ?.\$u*.u$G$yuÀ|$tCFB1ۀ|$u7-ff.$hytt$Vynu1^_[USWV ($0($((\vUh S)Wt$hVSN$UuL\$jhSyZjhS^ZhSS褄$hUV%$ 1ۅufffff.FʀҀsCffffff.u܍$1p҃sAu9ua$ (TTT$WP$8(1% 4,tTv1ۉ؁ (^_[]Ãt$UV$0(cv19uD, $$(UD$żjUU VqUPVUst$UCnUoUDÃPt$UP$hPV_$-$ 1ۅ$,( f.FʀҀsCu더$1p҃sAu9$ (t}\$hSRS$0(TTWPUR U׃e4U$0(PV@ $S藃%4SUPVNffff.USWVL$`OփPjS* S辱|$PhWS WVR$h$d Uj$?E E?t Ukjhʚ;RPTD$ SjD$ Ct Skjhʚ;RP^TƉt$ hPWjRUS8fnfpD$D$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H^D$@$ D$ PIrfnfpD$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$H$D$@\$ D$ PqjhT 蛇1L^_[]fffffUSWV\$0k$CC CCC,$nt$4 AAǃAǃ AD$s ǃǃ!C$@"OC$D$@D$GUǃƃA$Nljl$<$\%D$<$^_[]ÉƉ<$RƋA;D$t$Q,$~pt$PS4$(UDWVP|$<$t4$4$QGt$QA A9t$QG$$pt$R^_ÍAƉ $!NG$$o<$nA4$RSWVt$ ~tD11f.L8t $p8$cRD8$URC;^rʅt$>RFFFD$@D$$S^_[SWV@ $P ƇAG %Oxt DŽ$$ DŽ$ DŽ$, DŽ$( DŽ$4 DŽ$0 $D$t$]\t\\$D\$4$D$at $ $ G t$D$$\uG (g$=[G t$$#O t$ $D$[O *„t/tg $`fLJ @<$ht둄tg $`G u%It T  uJN%Iu $`=X $$` X L$AfnD$fp$D$D$$D$(D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$XDD$Pt$dl T u*D$ $T F$xH_$ t@ ^_[fDUSWV$0$8@s U蜷C tDŽ$@@Ƅ$ tPU踎1jU@ 1$$tu$uk ub$PhVW{VW!t/ VΟtC (gjVP3\1 U轵{u3C u'$$$`@RQPSC$C8hPQ2cCƃ h,4 VaotjjhWVzWV t+ W͞tC (gjWP2[uVjs 1F h]VPqhVn1tjhT  U!^_[]Í$`@$4 hPQb1$ 1fD1$Ph$< S=sEEE EEEjD$PS\1Ʉt$ $ ΄x$0$0@1C$UPOnǃǃƃK gun!CC}ƃ!ƃ ƃ C PeǃAAC %ItTuIƀuƀL$1QP-gK  t$jQPUCǀ ǀ $0 f. UƄ$0 VPUSu܀$0 tzDŽ$ DŽ$ DŽ$ DŽ$ DŽ$$ DŽ$ L$jQPZt$ NC >$/SUP ƍ$0@ƃ U V~K ff.Vt$D$N$D$ $ldždžƆN gulN!F}Ɔ!Ɔ Ɔ F $bdžAA^fffff.USWV$0<$7G f$VfO $Rt04$D$!K4$D$ K$8$4t)$<T$0D$D$T$ ɉL$#L$0D$D$ $]$0 t$0D$(D$$\$#1ۉD$,f,$hD$,t$0G ,$D${t$,$D$G,$D$?\$,~D$(t;|$,u G L$0$D$L$]$G@D$($mu$0Sfff.,$k$Jtu?D$Hw$T$lut$muk1ۉ,$둋D$$$ $uu;|$,uGL$0$D$L$\u$G G $T$D$D$D$D$ D$L$y(Gǀ @ǀ@$uD$(wtD1CD$$u$JHG9rڋ$0?BwE$u$BƉ<$D$j4OtDDDD$$$mufffff.1$,$m D$#uO1$L$0D$D$ $kt!Gǀ ǀ @ǀ@,$;tGD$@D$$F^_[]Ɖ,$4$gF@USWV유$$$C %WP*C@ @ t:33 u* ' O0QP~F ƃ!l$ UyLJULJTUk y$ǀUǀUEhu;(fr  $D$4$T$hWjjRQP% ƅD$EduV(hWPXE( PYa(E POet Eǀ(l$tD$uƃ  $Ug+gDŽ$`DŽ$`DŽ$`tU@ P4Ƌgg $`$`$`)t9UPV:(DŽ$`DŽ$`11퉜$`1$$`g$`D$$DUD L$dQt$@Ut$DP$`W@Ujt$TY0t$1ۀeUfU;D$XujU1;L$\t$!foD$@$ $h DŽ$x DŽ$| @@ @@@@@@$@ D$ DŽ$ $` $@DŽ$ $d $l PTD$j hT i11foD$@$ $h DŽ$x DŽ$| @@ @@@@@@$@ D$ DŽ$ $` $@DŽ$ $d $l P-Sgȃ PVF W FRjhT h1ɉȁĜ^_[]à jjjjjjjjQqW0|$ PuLƃA1D$`,t$dt V V4ۋ$t$t|$ PtHD$$t@u5u,At#!@ARPQD$ $l WqUD$0|$ PD$$D$!D$` WBL$` <u7T L$ljPUUQhWjD$400L$`tD$$` D$tiL$ Ut0D$tL$ ~pD$D$tWUSD$D$u$@P jjjP6PL$D$tƃ!ȄɉL$D$$|$ P|$$ $l Pt}0fn$fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$;|$`DŽ$!\$d D$lPOSWhT h$|$ IBD$O/|$tY hMB$@QPW UH'D$ WnL$ TDD$ $ hA$!QPVD$D$dt$@PUSf hoA$@QP;V$ h8IA$@QPVD$Lt$Ou/O$OtUD$$ǁǁǁǁ%UT$HR$UI %T$H2P~T$fpD@D$d PUt$4QL$$$\$t$,1ɈHUXV1UU\$L$ ABL$$ƒTUL$$\$ 9T$ 1}ttL$ |: UNxU9T\$ъL$$}5UUPQ$l PxUU\$L$$D$ɉt$4t$,|$8ƒ|$ PÊ$} U ӉlU\$ t$dhVPYhVVQM $`hPVU$̠ $`\$ o4e$!h$`RPq s1ɀ=Uu&nUoUDPt$Ht$HUt%4t+UU|4t1$ D$ufuatxD$ 1ۃIkPbD$OuJLL$@D9 hG:t h O1?Ut&eUt t$ fnE0fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`$@DŽ$D$d D$lP)FjhT \U€|$ Ā|$$t$$` ]t$ $` Xt E= ЋT$D$0u|$ $t L$8T$4 t.u$33 t $l PprD$TTTE΅DڅEPSQ$l Ptr $l P1j$!PUq RD$DDWV$l P!rD$$!4Vo{fnE0fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`DŽ$t$d D$lPC hT X$ƃ!$ WYcL$D$UUPJD$ &fnE0fpD$hD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$`$@DŽ$D$d D$lPBSURQPD$ APWhܣ4J!7!W(&$" ƃ W#95ƃ $l Pa>ƃ W4D$`,|$dt W WG# V& USWV `$(`$$`t$ PhVUQ$@hVW9$ hUV9WU&tA Wut;ShWJWUt&u̓$4`D$PVh9$4`V$8`N9`^_[]USWV t$ \$0|$,l$(F t\$l$<$ 9r@\$<$D$8F @t3@$A04$Au4$Au \$<$Et$ N wrD$$$P$JA\$D$<$ 9\$<$D$c8\$<$D$OC\$<$D$88<$F\$<$dEN (((D؉$!ƅt*,$!9rt$l$$7|$,t$ N %Xu#du$:@t 1ۃEu1ۋF du,$?@L$0D$L$ D$0l$D$<$7$Ƅ_u#G$8@ƿwt G:?__u{/G/lD$?uD$?u |׸9G)lE$?u}|$,t$  ^_[]fffff.SVTt$d42tȀ4 À0t$lVhT ]dfnfpD$ D$D$ D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$P$D$Ht$ D$P=؃T^[SWVPt$`\$l|$hF g!D$dU hL/WPCF x h/ P:HtuRhhT rNF gSPWj]Bu$1"gSPWjCBtF ƀ*P^_[øfnfpf$fD$fD$DD$@fD$0fD$ D$H D$ P;1Ɔ!ff.USWVl $ C tZO $ hb.VP5C hE.PhxC| 1ɀ$ !4QVl Vlots V|q Ppt'C 4VqT L$tjPUUQhVjs x0C OPjVlC 1ɀ4QVl  VvFtO0o0fnfpD$lD$|DŽ$DŽ$f$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$tDŽ$l$h D$tPC9hVD$tP1jVEfo$D$h,$D$$D$4D$<D$8D$DD$@D$LD$HD$TD$PD$\D$`#l$D$D$Xt$ D$$P8 Vmt V%o P9nC u%At@AQPVC OPjVzjC 1ɀ4QVi $fnfpD$pDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$L$hDŽ$t$l D$tP27 hT BLj hT M!uVC Ou> h@)VP> h)Phx>ƃ!VWs !C TDʍTDӁTDWRQV/jl ^_[]ÐUSWVl $ $ F %EtXtP;E/"$ !T T$jt$VUURhVUP@t0|$ $ X0VShT qW Vjt} V%l P9ktafnfpfD$`fD$pfDŽ$DŽ$f$f$DŽ$b D$lP5 VXA fnfpD$dD$tD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$tDŽ$\$` l$lU74hVU$ ,jV@E u%At@AQPV袷E OPjV)f jt$$ UUD$'PhVWu r0fnD$`fpD$D$,D$4D$0D$<D$8D$DD$@D$LD$HD$TD$X#\$D$D$Pt$ D$P2VShT T1ۉ؁l ^_[]fUSWV $ t$lV2RjUVThj9ƅu hT sC11f.hVD$lPoYDžjjjj$ $ US1 WV$ X뜋$ $ XtE(11t5$ Mu D5G9rҋ$ $ ShT D$ fnfpD$ D$fD$PD$$D$ D$,D$(D$4D$0D$<D$8D$DD$H4$\$D$@|$ |$ W0foD$PD$D$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HD$@4$ Wk01ۃ D$lP9P؁Ĝ ^_[]ót݃ V:ωËD5L5 ‰σT5|5 $  $ PWS{mtc$ @jWQЃt$ @jjjQЃ$ Nj t0D0jW$ SjSD$lPPDžt V' D$lPN W USWV D$$ƅu $T ?\$(l$$ )ËD$ t$D$$8/Dž~&9M~ҋD$ |$t$$N2볅t4$p ^_[]Džt4$X<$0ffffff D$t$+ fffSWV|$ GOD$$9ȉGvmW t.9v*T$D$h$T 2L$T >GO\ 9G؋L$$_ƅu $T >7_^_[ÐUSWV,@$@@$D@P*@*w4L$D D$[St~D$9l ,h D$1 D$ED$VQt$ftt$D$1t$fnE0fp$0 DŽ$@ DŽ$D DŽ$L DŽ$H DŽ$T DŽ$P DŽ$\ DŽ$X DŽ$d DŽ$` DŽ$l DŽ$p $( DŽ$h F($, $4 P+L$$D$ E UP|$D$T$tG|E UP E0$, hD$PW#1PhW>5thW1t$E\$VWUP5$L@Hw6s,TXDȃ Qt$P2jU`{D$ t$8fnD$ fpD$,D$<D$@D$DD$LD$HD$TD$PD$\D$XD$dD$`D$lD$p9D$hD$( D$4P*jhT <|$$t$$Uc1ۉD$ |$t$D@ǀǀuGht$D$4S"jhS^3EVSUPD$ ui|$u $4 P]xu{h$4 W/t_EVWUP'jt$t$EVWUPD$ \$|$fn$( fpD$,D$<D$@D$DD$LD$HD$TD$PD$\D$XD$dD$`D$lD$pED$hD$( D$4P'EVt$UPEjSWUP1 U訇$H@P*u2 UE+TUjQRUPtMD$Ou@ hu4QPB/D$Lu h4%/|$tu|$u $D@1!~P $D@fpDF FYUVw,FpFlƔD$%h V؁,@^_[]ÃhD$0PW$ffffffUSWV$1%Tu %AË%D$,$hPU#*t$Tg\$@$D$<D$(T$D11 1ۈD$1D$0T$4ft t$PUVRq$PVHu8 Vth$PUe*u9D$ jVv|$BD$ Vo h*$QPh, h<Ph4,$T|Dʺ\DʃQhh,$Xt& hPhdhh,$dt& hئnPhdh8,$Ytg$Tu7 hd, h$$|AQP+& hPhdh+$_t& h@- Phdh+$[t& h Phdhg+$`t& hmPhdh7+$ 6t( hX=$ 6Ph+$ 6 $$6tH1|$TPj2D$PP$,6P hL$LQPh* h*D$HD$D$D$D$D$$\$8fD VG!$,t9E@jjjjj$t6PUe 1|$,VL$1ۃBD$ 1TO $h6WS\$LPt$8D$#P $Vu"D$L$$V$VD$$D$L$D$$VD$D$$VD$D$ eDD$ tYD$BtPTuK|$@tD1|$,VO $yWjjPD$#P D$ @ V'|$yt;$Tu1 h$|A QPhȧj2D$dPm |$th h h@Php(|$Ht& hPyL$LQPhC( h3(,D$BT|$j$Pt$t$j$dPt$ t$(|$,Vur hh't$t$t$ t$(J=t$,L$TQP$tP$(Ph' L h Pb'^ hP't$$D$LP$Ph2' h"'D$D$4D$\$D$0D$$|$D$(lD$< pt~$Vu$,uj$yt_%jjV>tHjjjVzZ|$Bt-)ˍ IT) |9t#K9T)Ӎ+P @19~A)ʉ\T)ȉT)Ɔ4$A0^_[ËD$ǀJǀHǀPǀLUSWV |$ phjPJD$HKhjPJ~|$@;wt:^~w|$$>^~t$|$()HuD$ xt l$@ED$1ɍ@DBfffff.A8@t)l$@EP)f9fEueul$DߊVNf.(|$G=JHKHK\$|$@TGWO|$D@)fL$A9u]JJ]8HKt+L$ @HKPSVL$؉YJJ)@J7J9u)DKIDK7J)э4RJʋHKHK]T,^_[]USWV t$ JtIdžJD$ 1 |>t:D$\>D>D> >>4>4L$}E L$Ѓ>$PQ&3DŽ>(DŽ>$+$D>L$T$D>Ƅ>4Ƅ>LiJT>D> >D>$>8QPU>>IL$u V$ƅV>8D$u=} D$D>T$$>DAD$)x,=|%>HuEt$J9Ɖ$L$-$1D$%D$D$D$D$ L$D$Mt$1҉ǃtp1l$(L$D$@iJ)B9Bσ|$EMuPR2!ffff.Uh@rL$9w|$ $Lp貺1D$D$@x7J,7u.l$ UP7J$@l$tUPtv7JN7JucD7(uL$JA;L$L$n$L$t$@)ց 9T7$@l$T7i щl$))URt$D7 $@+D7D7D7$D7 C |$D7D7tXCl$$JJL$hJt$ PCL$\$JJD$Ƅ7JD$$D$ȋ$@$ Hx,1ۅt3E ƒVRP1҉ 1!Ep U EiL$Jt$$T(VDL D0NhJPt$,<^_[]fff.SWV\$t$uwhJjP[FXFTF`F\FhFdFtFpFl@=@B#0KFHFFdžLLdžHLF|FxdždždždždžPƆTƆ@džLdžHdžDhpjPGWh?jP.ƆUhjPdždžPdždžt-1 t QG9rdžt,1fD t QG9r܄džuƆV^_[USWV\$8l$4|$0C }GxH9MO)x)@|%~Gt$$L$Gwx=u 1*W)Ɖt$‰ $T$Ox~OxO|Wt T29NщW|E,$؃D$8+,$P+Ɖ,$D$+1 t$ٍG1ۉt$A Fq,$+D$,$D$*G1,$*UƃЃEOEUuҋL$\$|$8/1ˉ111ӀZt11L$0GDʋJ|9NL$B|$GO^_[]ff.USWVD$4JVJt$0INDL$\$ fff.Vp0K!)щVpt4!w* V ȍ~ŃՉnFeMw;|8rMvEعŃ)ՉnF+|0|t;~0C~ rfS=lD$,Pt$l$\U}H r U}H rEHEp}t)T$,1WtL$؋4))щL$)L$֋t$TNFl$P}ht$ WUwVUG|$|$L$NF+)L;CЍV*ŁfD$P‹B\B`BTJXJ\BXjTZhUSUVƆJe^USWV,t$@Ft~HNpnD8KD$1ۉ|$$l$ )F$!щD$L$L$ D$V(L$8$L$H|$9)耾8L|$$tƉ<$D$ tVUD,D$)$9FىL$M։ht$Frfff. \,EK$L$D$ L$;D$9$1G$w1,$iƃuD ,$D$Bffffff.,$8ƃun ,$D$l ,$D$ $D-)D.CvɍIuj ,$D$ $KRD.D$ى$9CىL$o)C@uExH9M))@|%~Et$$L$茳Eux=u 1)M)ET$ $D$Mx~MxM|Ut T29NщU|?G $WL$4<)%;;s9)8<F8@ʉуL$MUfDt$Ow1ffffff.$;;rOvGꋼ$у$Wʹ+;);;;CB8H$D.C ƅVu;Ex~1$D$ 2ƍD$.t$D$06$`D$ @L$D$6$D$ L$D$5$,D$ ,t$D$5^_[]ffff.USWV |$$t$ FxH9N))@|%~F\$$L$ͰF^x=u 1*V)É\$‰ $T$Nx~NxN|Vt T9NщV| <$W11FуW<$WŃуNWu֋D$(h<$WW11FуWf.<$(WŃуNWu֋t$(1@FʼnF<$ <$D$>u$<$ F <$D$1ۉ؃ ^_[]fUSWVt$0~H r4$~H rFHVpFtL$4nD)u Y1Y!9ӈA !YI,$D$L$D$臇NHFDD$L$LD^_[]fff.USWV\$4t$0É4$D$Buddž`Wdž\WdžhWdždWdžpWdžlWdžXW5džW džWdžWdž|WdžTWdžtWdžxWFxFY)ND$L$$Nx~NxN|Ft D9NF|tFtfoжfo f.foffqfFRRFRNFRPfFRTuRTRURPD$D$$8|$\$1Fp)s<#L$<$D$4KVpT$D$ $ƆELT$L$<$E^_[]DD$|$udǀ`Wǀ\WǀhWǀdWǀpWǀlWǀXW5ǀW ǀWǀWǀ|WǀTWǀtWǀxW@xÐWVPt$NxF)xI)=@|#~NȃWPQԨF~xu 1+1SF)ȃRP6Nx~NxN|Vt T:9NщV|^_WVfoжD$ fo ffoffqfHRRHRNHRPfHRTuRTRURPD$D$ $(t$|$^_DUSWV |$ _$ Ɓs$D$ 12ؽf.94kvl$$ ))4wRR@TWRVńRVuORRRVl$\$wRR@TWRVńRVtORRfwRRfORR ^_[]fWVPt$~pFt9tƆFL4K)s5#PQRvp4K6ƆELWQRFpFt^_ff.USWVl$0u4$J XWÉt$D$vr'sO4$D$ 1`^rg4$D$ 19PwvD$t$$ L)Í){6rf4$D$R 19~vD$|$$" )ÍԺ rh }4$D$19~vD$|$$)ÍsU4$D$1lf9 ~vD$|$$R)Í>fD9~vD$|$$)Í8)tWt"Eǁ|$FDž-H'pWHpW||Wu DžtWXW)ȉXWW=WrDžWѭWUp}SL4KrupEp@!AEpufDUSWVl$0DžpWW=WrDžWѭWdW}<$D$ ƋdW|$ zr'sH<$D$1a@rssz<$D$1@94_vD$ \$$r|$ ))4sU<$D$sfD94H_vD$ \$$D|$ ))4x0fffff.AtAΉ<$D$dWt$)ȉdW<$Ë\W=)r!sH<$D$u1e=rq <$D$I19wvD$ t$$|$ )Íse<$D$1|fffff.9 wvD$ t$$|$ )Í>f9wvD$ t$$b|$ )Í8)\W)ȉ\WuRPC RU„ۈ RUuUt$RPRUf|$t$D$ERPC RU„ۈ RUt̋|$ t$ERPfuRPfERP<$Ɖ<$D$ މpT$hWt.t)u;Wv tAA)ЋT$hW;WB BºwXW) Fу|$@CщWMdQUd\TedEh]l)MpA!HMpuۃ^_[]USWVl$0EDžpWD$$|xWuwD$D$$=rOEhMl)MpA!@MpufDUSWVD$L$)@A5ffffff.USWV T$ rF9Bx@tpBj<0)iH L$ X;W)ȉXʼnBj{\BZ<0)ٸ;sl)ȉ:É؃BZz A\$w]D$W;AyƇPL3O|t(GۉD$ t U<$o<^_[]É4$݇LJP<^_[]WD$$fffff.WVPt$NxF)x_=@|#~NȃWPQBlF~xF)ȃRP6蛇Nx~NxN|1^_fDUSWV$OxGQ9~y)=@|%~Ot$ȉ $D$kGwxW)Ήt$ʉ$T$Ox~DWxG|O|JGw4$؃D$t$4$f%LJPLJLJĘrD$D$$Kj|$D$<$1D<$(É<$D$ށuv<$Ɖ<$D$ tVUD,D$)$9FىL$iMDEEw"vufffff. \,EK$L$D$ L$D<D$u1>fffff.w(D$$,ƃu$SD$ <L$D$$lD$ L$D$$X-D$ L$D$żt$D$,$`ļ^_[]ÐUSWVl$0MpEt҉L$)1!t$XL$t$ffffff.4o~t F`)#|$;|$LV9L$T$uT$|$T$ %QPU L$}p)ωD$ !ljȋT$9,|$  !ǍG|$ 9s>4K)ȉT$RPjt$W|$4Kt$ W4KRPj|$WƴHLFN,PWV0v4T$t P:aCL$;f.Nj,9M9U}Rt$j\$SHLEM,PSeE0U4D$t) P~` f.GL$;B ߉߉Rt$ udƅFLHLLLMpD$ L$)T$!ыL$C9uƃt$ VUs EpEt^_[]Ë9s닕f4t ~tFC9rUSWV\$0Ș,$wtYD$tu_,$Wǃt7uO',$?ƃt,$0ǃtu&1,$}ǃP1ǃG $GljD$bƅu$T -11f,$踂t(C9rD$|$ t$D$D$0$,$3}D$01ۅǀPt4$_؃^_[]ÉDžt4$_<$afffff.SVD$ HpP1)fx&ӃHPU1^[BуHPƀU^[IfUSWV|$0_oW+)уփȉwWŀt"uC3F)щwW܃.3)щwWu1OÃC GÃPj&au hT b1D$ Wx1\$D$CD$Gffff.J9||)xg=@|#~OȃVPQ`Gwx)WPR7s{Wx~‰WxJO|;l$sua1;l$r@GOw)L$ <)EȋL$Gw9BQt$Vt$WR t$ 1ۅt VH]؃^_[]É t$ Džt V$] W^ DUSWV<\$Pl$\D$X|$Tǃǃ||BՉD$T$ $;YX,$ݢt$ x4$sDžt8O9;l$0D$L$,ǃǃt'1D t $ZF9rǃt,1f. t $kZF9rǃl$01D$D$,$8D$8V9C4Cuu t$4,$D$3$8tVL$@4@D$(uDt$8JD$S 4$M5D$,DEt$4{ D$(D$Pt$ tv11҉|$\$$fDӋ<4)41ҋ1<tE9r҅tl$ \$$|$t$PAt$ \$$|$= r $Xi $D$ 2t$P)Љ,$L$T@DFpL# uT$,1;:s L$8 t$PKD$ $躪CFpNt)u1 #9CCCC,C CC(t$ CC$D$TtW4$޿ʼn4$D$謿un @f;|$4l4$ōE=w;D$\1ɉȃ<^_[]É|$ރ<$贩|$u4$虩Ch4$胩C[4$mC N4$WC$@A4$AC(f44$+C,;|$4) \$$$GʼnD$ZÅu$T 11@=w\4$\$;4$D$)G9rԋD$(@L$0D$ l$\$ $5$W\$$D$(@C$W ƅt$mW4$EYfWVPD$t$uKdždžt#1 t $UG9rdžt,1f. t $kUG9rdž^_USWVT$8\$4L$09tƁFL)sƁEL8L!D$08KHLLLL$T$D$ t$USQD$D$0T$L$ ~‰Ѓ؉FVmfffff.|$,l$ fD^9}H9F;z WUV* t$0WUVu Hffffff.;rqHveD$))ʋL$$@|)~FÃWSPRD$D$8=1@Ѓ)؉FV+l$ ;C~ |$w28LNp4KQVpfffff.r|$c>ˁD$-ʉՃō~1nV |$<);s2)>ʉу~N $VMw$f.;MvMBff.;`-'MvT$9w49w*9w 9w9w 19v D$ )9CЉfff.SWVt$LLHL}XWRLFD$ p r Jp pD$0)ЉXLJT1p @7pu鋇JJfffUSWV $ $$Xȉl$)uA $~$ oR1)9Í Y1$ v9r Í 19\LL) $f\$ J\$T$ 1ɋvp Dn8/pt$ 9n2HuӋt$1ΉJxJ|J+tJ1҉|Jl$9<9}t$ V9}u1JJ$ $D$ )ffffff.$ 9p EpuJfXl$fff.$ 9uV 9~މJJ$$ FKw)Ku$f#$ˋ,$È]$  $YTfE8}r WU$Ip lh1 ^_[]fffffffUSWV<|$PTHh1΃HQJuA< Aȃ`urB8tKfff.8X@uP:Pr/PfT$T$PfPPT$PT$fP@Prw Pf`trKl$QKK;KL$L$\$tl9L$rPjWD$`tfHD$ H}PjWTAPHeMTL$HHD$ HD$)HHL$ 19P)KL$L$P9@J)L$t$81\$0)ڃT$4D$,ML$u3JHKtZHKff.q΋U7J7J8É\$(FAJ@KR@K;DKv%Jk‰@KQt$?fMfHMEHrx ff.ɈHɋ\D$,T$$HKtHKuZJ@K I @K;DKv+T$PJkщ@KPt$?Dž.vPt$,VWj'D$PT$(HKHKL$}T$0}1 69э 499 ͍HfEJT$4L$844v9s#1919fÍ|2fD<41ۍ<994R19Tҋ\$t$L$fUE[CtP P|$PLPf]D$ m;(cD$HP|$PE W>Ƈp <^_[]fffffUSWVl$t$$L$ Up)994K, kpil$D*T$)f\Z\Z\Z\Z\Z\Z\ZwL$<$)uDt{f4K!@7UpB!IUpuHt@t7XZr,XZt$XZrXZtXZr@B^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$h$T Rc$T UGO\ 9G؋ L$$}*ƅu $T U7_^_[fffffffUSWV$0$4THɋxtl$D$l$ ~trN$8u-uAӋTA8t 8P@uΉڋH9u$95ENu΍D$9ʼnD$uF\19KF\$8t 8X@u^@C)ˍL9v[ۍD1H9ظGJD$L$|$ffff.DK];@Kt?DKL$fHL$HxpCtLL$9u?fDHKtHKuσjt$ 9|$(u1^_[]ffffffSWV|$ GOD$$9ȉGvoW t.9v*T$D$h$T `$T vSGO\ 9G؋ L$$'ƅu $T ;S7_^_[fffffffSWV|$ GOD$$9ȉGvmW t.9v*T$D$h$T 2`$T RGO\ 9G؋L$$_'ƅu $T R7_^_[ÐUSWV t$ D$(|$$pf l$8jUWSQA u.L$0t&ftf jUWSV 41 ^_[]@USWV `$ `jj$4`BD$ U&.$@hSU 0Wf SgBǃ 78B$$`tt1$,`u+fthhS9$,`t\ SOtL|$uhD$ P$4`N$4`D$ PSd3@jjSAlj?*uJ wlAt6DŽ$ .DŽ$ /hV$ P78$ $4`PW2uhSU.1 `^_[]f.1ffff.USWV,t$D.tC1D$l$$#t. otD$؋oÅu1D$D$D.0D$@T$\$ˉT$(T$$T$ D$ff.l$$#,$pAt;CtfM|$H|$LD$|$$9f|$HtP|$LD$|$$9f|$Ht@|$LD$$|$$9|$LD$|$$n9|$LD$ |$$N9|$LD$(|$$.9D$|$$ 8L$@؈D$|$$7L$@؈zD$$|$$7L$@؈\D$|$$7L$@؈>D$ |$$7L$@؈ D$(|$$p7L$@؈@.#,^_[]ff.SWVL$T$ tz92s11  t"Z9:s u T$ t#Z9:󊙵s   tZ9:suku^T$ tZ9:󊙶su5t6 tZ9:su t1^_[DUSWVT$D$5 u1/|$؉11 ŋl$t 9ʉ| 11 9 ^_[]fUSWV D$4t$$l$ t |$8t ~(pf jjWSPM uVft#1ۍf jjWPQ! t*H 8 @ RQPUuF$Et 1 ^_[]Ê t}u} t Eۉ|$u$\ X ‰΁ f U& Un*Džt\$,fff.St$ W,u/F U1*DžuC;} \,\$(tt$ W1D$4t$D^_ÃWh( > j fSWVD$ t$$$J DD$$*2$D$4$D$$D$$D$$D$ $D$$$D$$D$jtv$D$Vtb$D$BtN$D$p.t$D$t&$$H($m=ffff.$K=t$$T {G^_[@USWV|$0<$DfD$$!pfD$$!fD$$!(g4$!g$!g,$%LJgLJgLJg<$DLJ%LJFfLJ%LJ%Ƈ%D$$]!D$$Q!D$$E!4$=!$5!,$}'gg^_[]ÉD$ 6D$ >D$ FD$ RD$ ^D$ gt$,$&t$t$D$t$D$t$D$t$D$ $offf.Vt$4$Cfdž%džFfdž%dž%Ɔ%$$ pf$ f$ (g$g$g$.&gg^ffff.USWVD$0|$8D$D$ǀ%ƀ%1D$D$fD$<$QG9sJL$t 9G $D$D$u $T 1CD$<D$@D$|$D$D$$8|$4t!D$L$0D$ $ff.D$L$0D$ $E;l$8A|$4t$0u~(fu%uf$D$%$Hw@stƆVtLt s%BuƆ%|$t D$$%^_[]ƋD$t$ 4$fffff.WVPD$t$8-u %t)%t%hPV^_Ãx-xu xuƆ%h(WuƆ@jh<Wu%WV, Ps6jhPWWWV,= ,V&6=fffff.USWV< $T $P }-u %%%t&Ft~ U\hUV( 6ItSt V<PFLJ, j6L -FhUW'L }-u }UWL 1ۃ Sl0t1 SH0À 6ƃVh3Ru %1҅t3TttJ}@u %u;fUWlL O@hUW&L /T$DŽ$ DŽ$ DŽ$$ DŽ$ DŽ$, DŽ$( D$ jPUK!Ë%tt&tE}@uE D$ P2tFt$$ tEt Xt|$t @tJfUW{^Ƈ%UƇ%jjjfjjWt$s )@hUW%hW2< ^_[]ffff.Vt$(fu%ufD$$%$Hw@stƆVtLt s%BuƆ%^D|$-USWV<0$T0$E$P0$$fpfND@u<$714$|$$D$1+@%G$$ƃ\fw4$D$Aƃ5+G$AF H SƃzG$PGHσ<$ǃd)ƃ_G$P ƃ(wmwD$D$4$4$D$D$)4$D$$k4$D$D$41 4$D$@3 4$D$L $DG $wJ$dƃM:ƃN1ƃO(ƃLǃ,$!1ƃyuIG$_EB-ƃ!G$7$G- ǃǃǃǃ ǃǃ$ǃ0ǃ<ǃHǃTǃ`ǃlǃxǃǃǃJG$`HՃ,$ǃ4Bw4$9 =rmfnfpfnȍD$0fD$0fD$@D$`D$hD$dD$pD$lD$xcD$tfL$P$'gt$$<$ <$D$f G$|OG$h-6+<ǃ@ G$4/- ǃh Gw$ 5T4$X G$Vw$ƃ s$|$$f.$Z.D$$T 8P G$f-EPƃ |$$D$$D$+ ƃx `|$w+wGw$4$D$D$| s 0Ir w4$r8$a|$$5-$)-D$$T U74$D$: t^$6=|>$|$$,$,D$$T 6$$ $V $XTy $UwL}-ƃ^,GEȉL$$D$ ƃ` $D$D$h ƃ t$D$D$D$D$ D$<$D$uj ǃpǃl G$Rr <$@[ ǃpǃlB $k4$D$D$  3 1-@0ǃhǃhggD$ D$$\$($)ǃdǃ4lǃ,$*QG$gS= 3ƃ)'GЃ8 G|$< D$,$EȉL$t$< Äg\$(,$D$;[ƅt }].D$E݉$ct|$0\$D$<$ |$0\$ D$D$<$\$(|$$e<>c(G$N%H@ǃ@ǃ@ 1$Vt Du C  u1$Vt Du C u 3rǃ4cƃWƃG$fA<ƃ0@ ǃ4ƃƃƃǃǃxèGDG261<ǃG-u  1$FoÔ qƃQG$gStRǃH!ƃ](7ƃǃdǃd( ƃ$D$ <$D$ Pǃ|ǃ|$D$ |$D$'a$D$ |$D$=$|$)ƃyǃTG$$$TT%GhwG$<$0~G$k<$O1- T4$Zt*<$ND$,G$2uD$,?:ou7E$t(,$E$u}t$(D$($w,$1 E-t +u1҃+Go)ы|$,vt$(1 sC 1 3ƃÔ|$$D$iǃ,$~#4$D$D$\Qt]4$D$lƃPxǃiǃZǃHKƃ?GHσ;$Tǃ$|$$"$"D$$T -G oD$($RtLt&Cu0D$(th$D$(tVuD$(tGf$y |$$M"$A"D$$T m,D$(D$(u!Effnfp$$!<0^_[]Åuǃǃǃfffff.SWV$Džtm<$Ct2 $GD$-ƅu$T k*1\$t$<$D$ t$$7t4$;^_[ÉDžt4$&<$ff.USWV t$$jjVxÅt}l$ ff.) PDžtPSWV4ƅt9?-uPUW WjjVÅu ^_[]f.USWV, \$\SjjjjjjSh\^ F$@%|$ \$Pffff. Sƅu f 6 uj hxVluF$PU?tjWD$P |$ t$ǃ t$ O w.$sRD$t uVuD$D$Phj $S S>ǃWSVPUD$Pt P,^_[] ƋD$Pt P Vt Vt$$ t$$`$TD$$T (^ff.SWV|$$$\ t<$D$D$StI\$(1ffffff.$VtDuf u1^_[@USWV윑$%t%%tt$$tFFFu<$DƉD$k$Sƅ4$D$D$F$> $I$ \$D$4$k 4$D$D$ 4$KItNt$$D$3 8$)It$=K$UJt$D$D$ %$D$u (g\$$P%lsC$ |$$聢$$豣%u $Ĝ^_[]ù<$;%uȀt2$D$ D$DD$U't$ 4$\$4$}h$ L$ D$t$D$$(g$DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ DŽ$ fffff.l$$u0l$4$<$D$%$D$ L$t?Ɖ$Ɖ$D$ t$C4$ (gD$t$P7 (gD$t$t$P3ffffff.L$Q -Kw8\t|{PtjtbaHtPtHGt>t65t,t$# t@t@t u1A @VX|$dt$`<fnD$fp$D$ D$D$ D$$D$0D$,D$8D$4D$DD$@D$<D$PUD$HD$D$LD$(8fnD$fp$D$ D$D$ D$$D$0D$,D$8D$4D$DD$@D$<D$PUD$HD$D$LD$(@fnD$fp$D$ D$D$ D$$D$0D$,D$8D$4D$DD$@D$<D$PUD$HD$D$LD$(X^ffffSWV|$GG hƍ7_hjV_G fƄ@u^_[ÐUSWV,|$@l$DG O)t @@Iu}7G  Ub7@)9BQUVE1Ƀfnfofo-fo= ىfpfD$fofot$@f$foЕfofofo $fffffgfofffffo$fgoMfgfo@f% fffffew9t))Kf0FOu,^_[]à L$A Q)tfff.@Jut$[ L$A I)tffffff.@IuD$tL$tAHuSWV |$@D$8t$<9CPt$$0 >$ >$ VL$ T$>$| $9$ M>$ >$ $P $ $>$ U>$ G>$ 96$8 >$ >$t >$ h6$t D$4$>$ >$ $ *$ XD$$$ <$ 6$H 6$ 6$H >$ N6$L 6$ >$ $6$( >$ $ N|$D$D$<$L$ 2N|$D$L$ $X>$x 6$ 0$\ ,$ 1$  $ 6$  >$ J6$ >$l ND$<$L$$6$( $4 >$ zD$<$L$>$ >$ >$ 9VNT$ $ V ^NVD$ $T$L$ D$,$ $h >$ >$! >$"  >$" NL$D$<$$@# G$# ;$$ /$X% ]N "$H& I$& 8N $L$ $$@(  VT$ $( D$6$( $ X$) O$x VT$?$) 5$* $+ N $ $0 sL$$E[$T+ W$/$4#9$\, 5L$D$$6$ D$4$H^_$ - D$$, ِVt$Vt$t$7t ~ 1^1ffff. =l u(ϲ+" =[|$豲"  Vt$$- Lt$$ $- 4$^ÐUSWV t$,\$0l$(|$$$. $$x0 $EM   ^_[]SVt$ \$$$w0  Eȉ $t$D$$$1 `$^[fff. D$ $* fD =l tl $ ffffffUSWV,\$2 $@$D󥍼$ 3 PSiUS/<^_[]@WVP|$t$PWVƐǐPWV^_@USWV$$L$\PVQ$ QPRRdž/Bt@1ffffff.kT A9vtML$ Dl$ 1l$ D$P%N D$dP##C19ݺvTـ9v؉Dt!uD$`P$dfff.u\tXD$XPD$`P$P7 $PD$`P$P$P$S9(Ĝ^_[]ffff.USWV,$@$D?"VWEtRw<rHDr% Tɉ ˉ HуwFF1ۃ?t:$WUǐD$UWP|$ t\$Hw%DrFu ^ˁNrZ9v fffff.A9v @=stF,^_[]@USWV|T$X2 $$$󥍼$ 3 ƃVRnUWUJ9v9r'u,}DA9vU9sىEtV1ɺf.L DB9vt)@;Ev DELAщT@wۃh3 U=}D$ h3 U$Py}LPVW/t$ EL9Hw)LP@)ƒRjQ}Lw1MTUXfo%2 EPfnBM\fn%fbfn ^fnfbflfMPM`-MdfnKMhfnfbʍMlfnGfnfbflfM`MpþMtfnMxfnfbʍiM|fn#fnfbflfMpfnPfnmfbfnDfn=fbflfrj$ffff.H;MLv DELLAщT@w.~*9r&fff.TL9T rI}taEP1ҹf.)18+| FA9vρwtIHELtLLuHELt LLHt|^_[]DUSWVD$l$@@ @@@@@@$@ @,@(@4@0@<@8@D@@@HUp1u8Jtyw<r_D8r+L ݉O˃w8l$O\w4Dsf.\8u ˁr89vff.8C9v  A1GD$ fET$9w7D$9L 9LwH}xtw'|rBD$DT$s -r%DDL  ʼnDJȃwD$D$PFD$ M9~)9r%Bfff.L9L rH}tsL$ l$1)1+\Fˉ EO9vˋl$wffffff.tHG>J?Off.xt tGtZD$t.T$f\ ʉډL@L$9rD(T$|JT$\^_[]f.USWVL|$`D$ht$dGG GGGGGG$G G,G(G4G0G<G8GDG@GH T$QPR!>X1fffff.D$ds4,$A9w@9v9s~/~f.,$w<rE$D,$r,fffff.L ‰MȃwD$D$nfDtL1DA9vt(ED;v  Aщ@wt$tW3t$tD$ PCD$dF;0L^_[]D D$ QPt$fffff.WVL$T$ 299w9r~F|9|w rN}1^_fUSWVT$D$:t\H1۾D)19+<ÁFF);2vЁwtJQtuIDɉtIt^_[]ffff.USWV$2 $󥍼$( 3 ELPS$$V#UVVSt$TVSh3 VEt$PUV|$L$9Hw)@ )ƒRjQ<$w$1L$T$ D$fnBL$fn%fbfo2 fn ^fnfbflfL$L$-L$fnKL$fnfbʍL$ fnGfnfbflfL$L$$þL$(fnL$,fnfbʍiL$0fn#fnfbflfL$$L$4T$8\$<fnPT$@fnmfbfnDfn=fbflfL$4rK;$v $ Aщ@w"~9rOT9TH rI}tcD$1ҹff.)1+\LFA(9vρwtIH $$t)u"Iff.J҉$t ҉tA QPV1Ʌȁ^_[]USWV$ \$QPSD$L$ƒDщ$tXuL$9ffff.| DAT$9rDLL$|uIL$$L$TPSQh\$P1t{L$TT$TՁlu =ff.tT,6 ҉TPCl$P9rTP\P\$P|PuK\$P@u $ tQW- LJĜ^_[]USWV$u s$u AQSVL$$PQU $SVW$TWS $0SUWtl$WU WUU[ $WUUI UVW> W$4PS, USS! D$ PSPD$ PUVkÐAQSPtYdž<PSVƐ=ÐPSV^_[]à Ve D$ Qt$P1Ʌȃ f D$ QPt$fffff.USWV$DŽ$<DŽ$@>]|$VW $VWS $@PSS$^D$tY l l +T$ f.t4t"ڍ..FӋT$ 4tHũWS S$VS $t$]PSW肿f.WWWW  SWWMuۋD$L$ƒD;$tD$WVƐVNdždž@WWWWudžW)$ )$)$)$)$)$)$)$)$)$)D$p)D$`)D$P)D$@)D$0)D$ )$)D$^_[]W1)$ )$)$)$)$)$)$)$)$)$)$)D$p)D$`)D$P)D$@)D$0)D$ )D$pfWV$$$D$$VV&VVuĔ^_ff.USWVD$L$0l <1ۋ<tl ,??F\0NtV=l f1t,F݋,lNűD^_[]ø^_[]fUSWV\D$tt$p8|$xl @ LHuhjV3D$t} l T\$ @t$t44t6|$xt,@|t,77F<1>FT$1UIuˋL$ T$t$1)ՅtT$| uIL$ uT$ f.9s(K$DŽ$9r$tOt$ L$t$ @Tt;;FڋT$1Nuы$t$ tfu K$u1ۃl$9L T$|$ 4)BʋT$ L$tgo@t@fT$ FL$ 1tL M4uɅu鋌$@l$|$ )D$t(t$@@u&I$@uf.t$f.L$ +9s*$fffff.w2D29rtW$ڍ ff.4t"l$<..l$Ft14Juɋ$1$tD|uNuu1T$AxtZT$$+ t!|$4 F֋Kuʋ$$PQUcW1)$0)$ )$)$)$)$)$)$)$)$)$)$)$)$p)$`)$P)$)$)$)D$p)D$`)D$P)D$@)D$0)$)$@)D$ ^_[]f.D$8t@1ffff.SWVt$t FuO|$PVW2f.WWWW VWWqKu1^_[DD$8t@1ffff. D$AQt$Ph1Ʌȃ USWV$|$VWA$0WSU VUUUW UWWVS $WUV VSS WSSD$ PW$^_[]f.SWV $4$0\$PWS豱$QWPSV0^_[fUSWV T$$:wwt$(L$ rC1tS1f.,,C*9vt&E|%tPRQ )1 ^_[]f.L$tc fx\@uV rR rP rN rL rJrHxH@uG uFuEuDuCuB!1HÃÃÃÃÃÃÃÃÃÃÃÃÃf.VT$L$ 129vȀD^fSWV $01?t9$WSǐD$SWP0<$tt$ ^_[@USWVt$>tq+T$wtOD>L$r5fffff.L$Dʼn ͉݉ L$Ow܋V‰F^_[]fff.L$D$Afffff.USWVt$.tUt>^+T$fff.DщL$ ˉÉ G.9rߋL$,<uH^_[]USWVLD$dt$` T$QPRY<$1twL$fT$Ӂ\u :ff.l\- ҉G$9r<<$<uO<$@uL^_[]fff.SWV=l Gl 1~^_[$ӭƅ5l t`$軭l t[f<@D߉Au1ɐ Au1끉=l q=l 4$艰l ODVl 5l  l ut$Mt4$A^fff.|%@T1T1TDHyDy@y<y8 y4 y0 y,uw y(uk y$u_y uSyuGyu;yu/yu#y uyu 1yD$@@ @@@@@@$@ @,@(@4@0@<@8@D@@@HUSWV@$4@$@@$<@ @؃@LŃ|$ PWRQƅ5D$ L$ff.\$$8@l$$0@tfDVWUu'\Ku\$l$@r`T$ t$ EEٹ@9؋D$ L D$4@VWQPƅ\h@jW̮$4@jjjQP,@^_[]fD$@@ @@@@@@$@ @,@(@4@0@<@8@D@@fffff.SWVp$$\$$%<$XD$|$$%F$D$ (p^_[fff.SWVt$ 1\$D$~\k\ Po%jSW%D$<D$r΃^_[USWV$$$D$1\$ll$f.k\D P$D$<ujUS%D$D$9|à \$W$V$S $D$~|}1fffff.DPS& Sc$D$WD$ )D$D$9|% D$W$V$P? D$DE^_[]DUSWV$D$$1t$l\$k\D P#D$<ujSV#D$D$9|Å$t$fff.UWV#\Ku싼$$D$~eu1\$fff.DPSo% S#D$WD$ )D$D$9| $D$DE^_[]fffff. hht$,t$,t$,_,ff.SWV$NANt4fff.LBˈLl9ˆ\Lr߃ |$lW2"L$ PQWK"D$PWZ$D$^_[WVPt$|$<$GF<$uA9v D$VP$P1ۅál 5l  l u t P远t V诜؁Č^_[]ffffff. t$$t$$jt$(jt$,,ffff. t$(t$(t$(t$(t$(j,fffffUSWVl@$@DŽ$l tS$@t-$l $D$D$ D$L$$l D$D$ $MD$0$1$l tI$@$l D$D$0$qu'tD$$T 1D$@D$$Džu $T 01D$ffffff.D$ D$ D$D$0D$$ƅtkL$9v9ȉ<$L 9G͉L$L$kÅu1$T D댍$l D$D$D$0$t$ \$9s0؉<$\ 9Gމ\$Ņu$T @1$@1D$(D$D$,D$rvE|"uDfff.t$@|$$$@t# / t tD$t$處D$t$臕D$0$[؁l@^_[]À}11b|$4 (|$*ËD$t$%|$uÅt<$ D$0$$ٖfDSWV|$\$r0t$Qu苾t<$&|<$^t$輌^_fDUSWV$$$CD$$D$ $腭ưD$`t4$D$(4 _DŽ$l$$,$\$,$t$?$?D$,,$>D$,\$$D$D$ aƍ$\$D$<$T)޹4)L$$D$$4 -$$~|$$貗1ɍ$1DŽ$>DŽ$>DŽ$>DŽ$>DŽ$>DŽ$>D$@D$\D$Xfn1fpf$L$4|$0D$1ۍ$$=f$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("|4$הD$<D$0D$,~.11ɍ$t ?A<t@9D$,u 1ɍ$$$4o1ҹ0,t$,$$%Aȉ $uD$DL$0t$(t#|$D1L$<$E4F0,L$0;t$(rD$($1DŽ$D$|H$+L$4fnfpf$!f$!f$DŽ$"DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$"DŽ$ "DŽ$"DŽ$("4DŽ$$"$"$!4$6fo$f$!f$!fDŽ$$"DŽ$ "f$"f$"DŽ$("54$ܒ$C$T D$腴t$PL|$,$t$P;1D$04t!T$D$$vyt؋ڋIL$`ыډL$T$$T$`Nj$)t#$D$D$$~vD$0$9MNj$D$0F$;t$,J|$0GD$Xt$PD$ D$\4$D$D$|D$;$t@$Lu/D$XT$\L$|t$$x4 D$T$ L$>$L$0\$(D$|1҉ȉt$Pk=L11͋|$D$t$T);$Ei0,$\$, $L$L ,L5,$,,$?$$,$(,,,r#L$L$D$@ L$f~vL$DT$T$t$,D$8 ,JT$@L$HG1ۃ D$`D$TL$8t$4 D$44$!9t$4sD$4э!D$`9t$4rND$H$$!D$`oC F ut$4$D$`9t<L$@ʉ)ٍ!T$`CIuwD$8D$H\$@O$!l$L$ t$D$D$L$3o \$@~#1ɋG7A!G؈o 9|C;_ |$L$0$\$($B9$$a|$<t$P$$14t'$T$0L$$T$肴F;t$<|D$D$q$cfn$"fp$!DŽ$!DŽ$!@@ @@@@@@$@ $_DŽ$("2$!DŽ$ "$!$!$蔍`D$D$p|$,1$<$4@<$ЋIT$D$<$D$ щ<$D$<$D$<$D$<$D$޹<$D$ι<$D$边<$D$讹@ <$Ћ$F;t$,$c5$$! $D$$cD$D$$!$$!D$$$!D$$$|$L$$!D$D$ $$D$ D$$!$<1Ʌ~ uA9|9u<$|$L$$!D$D$ $F$!$w$!$$$Lu $P4 $ u$$Nu$`~$ $!lj $Aeelj4$l|xqǍ$Llj4$kea_4$!R'L Ǎ$ $-Ǎ$. lj$I4$x Ǎ$$$x,$<$n@USWV@$@<$藍ƅtD9v=1$~u>_uF$~tC9wփ$ |$D$,$貁,$誽$fnfpfD$0$ol$$D$Kc,$D$ D$D$#K${l$$胐$4w$D$ D$D$g$说Ɖ׃|$t$$D$ =$D$+$D$*$D$)$$@D$(1LL$,D$|$t$$D$ D$L$[T$*L$)t$+D$( ;t$,uG$zD$D$$ܣnfl$$T 蠚foD$0D$`D$HD$XD$\@@ @@@@@@$@ DŽ$l$@DŽ$l$DD$@$̆D$$T 踜,$D$D$萐$$q,$|$|$$T +@^_[]É$8 ƍ$Ɖ$4$kfSWV\$ D$$CCCC CC$C C,C(%s<Aȉ $fL$(C@tff.XJut C8/$cljt$<$V{8$+fCC^_[ÉƉ<$fƋt$2h4$ jUSWV t$ Ft$6hFt$'hFt/11fff. 9t  $PFC 9rN~G(O4Dt?1fffff.W FNWƒvRQUv vy9 E9uу ^_[]fUSWV t$$|$ ~G(O4Dt=1fff.W FNWƒvRQUv v 9 E9uу ^_[]fUSWV,\$@|$PC< 9BȉE1GD$(|$TFS8t$D$ D$$T$C(S4E1T$ff.s@Dl$<@|>D>D$uW|$ t$ j(`ǃ W,D$1Ҁ|$T8C$K(uS0RQPW}.l$L$Pt$|$ D$(\$ ;l$$l$LD9GыL$HЉT$T$T)؃|$L> l>T>\>D>r"Vh5D$0,X@L$l$@~L$LT$ UPRQjt$`D$,0I7 tQt> U FNUƒv RQW6D$,07 G9uffffff.L$PD$9sl$\$@D$ E;l$m\$8 3JT<^_[]Éƃ Wb Ve USWV $($ D$$D$ty$9vfDF$ut9w$94$D$))L$y$ DŽ$ aDŽ$ <$So\$<$oDŽ$`DŽ$`DŽ$`DŽ$`DŽ$`DŽ$`D$0DŽ$D$`1ۉ؁ ^_[]Ë$P$@<$D$t$%o9$]Ë$$$D$7$`ut$$qt4$D$,4 ]$D$du4$D$$Cu ƃ3@$D$ D$D$Љ4$ʼn19r;1@E$st!E$@ƍ<9sn$ $ H)9p)Ήt$$1|$0$ \$D$ $%ŅD$0u$ $T$`D$0@4$D$0/`$ D$@4$`9D$@v|$4$D$`vwuu8p$ i  Ou$ at$@u;$ $ a$@D$ D$D$4$Սtŋ$ $ ;hY$ i Ƅ Dt$$D$u"L$0u$,fnfpf$f$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$yDŽ$$$4$H||$0$ auI$ D$D$$$ aD$ D$D$$ $jfnfpf$f$fDŽ$DŽ$f$f$DŽ$x4${$ A4y,11fnfpfD$@<;foD$@$t;$DŽ$DŽ$DŽ$@@ @@@@@@$@ DŽ$fDŽ$$$$z$ ;It<>$ED>D>$>$ a,$D$D$mfoD$@$$DŽ$DŽ$DŽ$@@ @@@@@@$@ DŽ$vDŽ$$$ztfoD$@$$DŽ$DŽ$DŽ$@@ @@@@@@$@ DŽ$DŽ$$$s$8 QÉ$C$l$\$D$ D$D$D$D$ D$$$$uC$ul$$T $ɸ D‰D$$T bD>L>L$D$$ڟ>I $щݍ>\$,$D$wk,$D$D$<4 kfoD$@$D$tDŽ$DŽ$DŽ$@@ @@@@@@$@ DŽ$uDŽ$\$pD$p$0rfoD$@$D$xDŽ$DŽ$@@ @@@@@@$@ DŽ$w\$pDŽ$l$tD$p$ql$$>t$QDŽ>냼>D>$ aD$D$$*{T$0$  B;Q$D$<D$8$4xG4w,4$QG0t?$11ۃ:t  1ɄɈ u9s $ Ei4C 9u11ҋ$ )ȉF l$p,$F$N(V0T$ L$D$,$$ [$t:$ @ @$ Q$ 1ۉL$\D$dD$4Hfnfpf$f$fDŽ$DŽ$f$f$DŽ$7 $o$ @0t$R1ۉ,$7OL$@D$4($ ~$D$T$@9Lr‹N L$0NT$XT$L$$D$XD$0)\$ N$E 9rD$`\$hD$ $$D$D$4D$;l$d $$LD$`$L$4\$${4 D$T$ L$-ml$dN,t,11tI $ы$ N,G 9r؋F0t$BP$$$ l$pLu $P4 t$,u$$Nt$ l$p $`$ l$p_$tc3]WUS!Ɖ$NA=;9ƍ$ l$p,$+Ɖ$M ƍ$ <$3[4$PUSWVL|$dL$L$<$D$P14|$Rar!u 1|$Revtl$$E=\$ |$|$(<$Tl$<$T9D$$D$D$$PL$(l$L$$P19<$U<u<$U\$`C$<$UC(C$C,<$UȋC,9vG=w@L$<$UD$D$hC,s9Cs3)D$$Y C,9r%<1D$(t$ML^_[]ÉC9si  F 9r{$t911<$RU 1 1 <$U E1  ;k$rˋT$t$i  iƋD$(t$ M4$NUSWV@\$th$@Smb SaN$@$@$p D$ fnfpfD$`D WjSWu2ShT | W7 S۝ujjjSh h+\SPp h4p1|$ PWVƅt~1LPhhjjD$(PW= $@D$i D$ ; u+ h[PhhܣWpfoD$`D$0D$D$(D$,@@ @@@@@@$@ D$X\$D$P\$ D$PgjhT }jhSq W脇 S($@ W[Ĭ@^_[]ƃ W< V0L ffff.USWV$0$4$0,$t$赲|$,$D$t ,$D$}t-$$8u|$$T z1,$D$ D$D$|D$,$D$D$u%|$Rar!u 1|$Revt1ۅÃ,$荋,D$D$D$$JDŽ$D$$KDžu1$T vD$$DŽ$ D$D$$5J$CË%D$$6$($8t$D$ $4D$D$$ǻþ$0f4t$Qu苴$(t4$74$F$tO$HE|$t$D$<$$8t$<$D$ $4D$É<$,$;؁^_[]Éƿ<t$Qu苼$(t<$6<$ F$t@$jG6Ɖ<$>*&Ɖ$Eu Ɖt<$:Gƍ$0$蓳4$HUSWV\$t$xDŽ$\`b$\@|$D$$S\t$ \$$D$+t$\Ɖ\$D$,$\)޹D$$4 4\)$L$[\$$KRl$$R$ DŽ$4@DŽ$0@DŽ$<@DŽ$8@DŽ$D@DŽ$@@4@,$lƃ>1u!9r3$Xt%>0tfDl$$D$Ru$\`l$<$D$+[$\`$Q$ ,$|$,$D$ЃtT$@j$\@,$D$D$eu=$\@Rar!u1$`@Revt|$$T 8u1ۉ,$)$pWD$(D$ )D$)D$0%t$LAȉ $hBD$PtL$fHNuD$H|$|$\$<$U<$-SD$D$D$$E|$t$ffff.4t$Qu,$Ѐ\^_[]Éƿfffff.<t$QuƉ<$ Ɖ,$xƉ$O4$`EffffffSWV|$ GOD$$9ȉGvnW t.9v*T$D$h$T ~$T &qGO\ 9G؋i L$$Eƅu $T p7_^_[VD$L$ $1ƀ,҉ցOAuڹDu니^|fff.VD$1ɺ@҉ցOAuڹDu니^ffff.USWV $ $O$PjQ'C DŽ$ D$(D$ D$@~WjD$PB1ɉD$ D$DDŽ A$9|L$1҉\$9UfD9~FtB1ffff. t<1$@$81HD$uD$~fT$$<$0+fffff.$01ۅҍGt$t\1$ÍsA$0;$@{$8dž $){D$)L$ ff.ۉT$x~11\$ff.Ⱥʉ‰)Љ)‹t! $t1ՋT$\$G9|L$)Љ DŽ $x 1f,Ⱥt4ʉ‰)Љ)¸t 1 G$L$ 9߉~ T$Aȉ D$D$ R$ PjWd<1\$ff.$D$t>T$1+T$lt$0414C9|ӋD$\$$0@9u 9\T1@ۿL$l$D$ 111\$+t$ t$fȺtHʉ‰)Љ)‹$0t$0Ƌt$\$E19|L$ xz$8$0l$)ȋL$~m1Ʌt@ $0+$0$0t $40L D$0l$L$$E99^_[]fffffffWV|$ GGG GGG$G G$v6Ɖ7$f6G@džf ҉ׁ GAuׁD$D$4$9^_ffff.WV|$ $5Ɖ7$5G@dž ҉ׁ GAuׁD$D$4$8^_ffff.Vt$t$z7Ft$k7F t$\7Ft$M7Ft$>7^fUSWV,\$Hl$DL$@|$Li YAA#Aυt$6o _+$4Ɖ\$wtD$L\$4$D$3tfD9uT$@BAHu191Ƀ|$vtT$L.fffDfffff.fnYfn!f`f`fafaffuf9T$fpNffpff~t)FKuD$@P19L$@\$1At $5L$@yq AAЉ$!3L$@D$$AA1D$D$ff.<uuf.<[tT$ tLC1҉D$(fDո3l$(tL$@I+(D$\$+tVD$\$+t7x,1$\Lt($JHt ,1$GƋt.t!Y$D$D$?.u:Ft .u.~u($D$L$D$D$R?)PLJ 0\$D$<$>^_[f.USWV @$ @ $$@ DT WKD$uCPSW9t* a u1n tAPD$ǃÄ\$u#"|$u€ Ӄu uPT$ڀ, h "ƃ V3t$ hWV.=thhVGVt3$$@DQSP3tL1ɀ t ujSW\7 1, D$tD$ PUDŽ$ tt V2 V8%HD~!f.|HH|$}ruu PpQ jjjSP u! pDj/W@&ƅD$ hVP@;;}( 0 PChPD$P ;$ hWP:j/W%6hD$PWI;0$ PSQ5  ( D$ɉL$u WC$ hPQ6:hSW$: W#ƃ $ P#D=wfn$ fpD$D$$D$,D$(D$4D$0D$<D$8D$DD$@D$LD$PV|$D$ 4 D$HD$ D$P@$$@€u Rum1ۀ, pt$ jjjWPL$$L$$ u1ˁPWUhT B`j hT  V7D$ hPW81|$ @^_[]ÃhWEh$ PW8L$@ɉrh11ۃ}r1@sǃ V  W$ DUSWV\`$p`11 fA *t?t ttf4$v@tΉ΍ $\@D$D$D$$G7 PDŽ\@D$$+$P ,${-\$,$- \$ DŽ$4 DŽ$0 DŽ$< DŽ$8 DŽ$D DŽ$@ f$P \$D$$u-tm$, t׉l$$D$7$;?Ɖ4$D$Y#t4$D$E#u$ ED$\$$+t4Pt D$D$D$D$$,1ۍ$P $z,؁\`^_[]$P Ɖ $V,4$"ff.USWV $0 4Pt+ P D$|$$6,t  |PƅP$)|$D$1$+|$\$11D$C *t?tuGL$$=u $=tD$$tD$D롱7ƅP tuu ^_[]t|$D$D$<$l4<$D$A  $F=u$H=t\$\$D$$4$<lj$D$ t<$D$ u\$D$$a) $<DŽ u,t$D$4$@4$D$D$4ȁ ^_[]SWVP $d ?F$` pt.  jjjQP t?Pt QP(PtPjWO\ |$ThWVHfnfpD$D$D$D$D$$D$ D$,D$(D$4D$0D$<D$8D$DD$HWD$@<$ D$ P9 hT NP ^_[fffSWV|$ GOD$$9ȉGvoW t.9v*T$D$h$T W$T &JGO\ 9G؋ L$$ƅu $T I7_^_[fffffffWVPt$~<$~ džx džt dž dž| FFFF $;FFƆH ^_ÉƉ<$蚔4$"ffffff.USWV |$$t$ t-nt&fDE]t$.,$ۉuD$(>FFF ~u$FFƆH ^_[]fffff.SWVt$ ~t.ffffff._t$<$ۉuFt$t t$@4$腓^_[fffff.WVPD$pt!f~t$/4$u^_ff.USWV \$ H  tN@*gNgS WVԘQVPjjRR0ǃh ǃd ǃp ǃl t t P4ǃt ǃx ǃ| ǃ ǃ ^_[]l$(t$$ PQ׉ D$ ƃ jUVPQƀ3 P胕+ƅ3t$P*uxh4 Pt"EjWt$UP ƃH ^_[]L E UPX T H\ jWt$PQƃH .fDUSWV t$  PQd D$h T X jPQ6^\ ` l +d h )9ڃBډڃD1ۅtZFRPQ[Ņ~CtNFl RQP d h l jWt$PQ؃ ^_[]ÐUSWV t$ H l x 9 rE VGt% x 9 sˀH  D$$ʉ\$)\$(r&؉ˋL$x 9ŋD$$ωً\$(s]T$ tjRQ6]Ɔ SP6ZxL$,  9ƆH 1Ut SRP.D$, Ɔ # tj 6o\1 ^_[]fUSWVdu<$C^_[fff.USWV$>tv1\$l$ VhЍjS tDPh<5 jdU UhT J hT @jhT =D$DG;>rĜ^_[]f D$$1 ff.USWVt$0|$|$4$twhD$ ff.D$$T$$ u#,$ D$ Ɔd$,$ $ |$4$u^_[]fSWVt$ L<$h uT|$$t,D$D$5 $T HD$$T <tH<$K t1?|$$$  @?$ ^_[SWVt$ u4$|$(\$$@r4$ @ A? ^_[ffffUWVS l$(TH)t%1Ut$,t$,H9u [^_]ÍvScó[Maximum allowed array size (%u) is exceeded8RAR_EXIT *?/etc/rar/usr/lib/usr/local/lib/usr/local/etc.rar.exe.sfx00?*<>|"?*yyyymmddhhmmssYMDHISWAEN<`HOME%04u%02u%u%03u%05u80PP 4File` 0 Creating %-56s%u.%03u%.*ls(%u)%lsCMT( 0` 7Archive 8"Y$$$$$$M$T$**************D@@%E9FWvYXXXYZh%uhc%ux%uxc%u;%upef16RarCheckPassword13CheckPassword` S @hvector::_M_realloc_insertym?5u#6666666666666666\\\\\\\\\\\\\\\\  8888Q::Ȕ(Е#Iw0*XZWǓF\B (>VGeq{][C,kK1}Sr $|Y֍/y=®an6s9^i7? QLc3x)HˇfHa5WiَU(ߌ BhA-T @6#EgܺvT2g jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqƌhك[RQgrn<:Og jg jgrn<:ORQhك[                                   v?C2~%t,ȀOUOW..\??\/??/j.k.k.k.k.k.k.k.k.k.k k.k.k.kj.k.k.kjyIyhyy Done All OK Total errors: %ld %s is not RAR archive__tmp_reference_source_ Skipping %-56s Testing %-56s ------ Printing %s Extracting %-56s%s%s  ? %s - use current password ?_Yes_No_All*.* Testing archive %s Extracting from %s ... %-56s %s: %sArchiveDetailsRAR 1.4RAR 4RAR 5%s%ssolidSFXvolume %dencrypted headersOriginal nameOriginal time%.10ls %u %12ls: %lsServiceEOFFlags ----------- --------- -------- ----- ---------- ----- -------- ---- %21ls %9ls %3d%% %-27ls %u ----------- --------- ---------- ----- ---- %21ls %-16ls %u 0 files %21ls %9ls %3d%% %28ls %u%21ls %18s %lu %ls Attributes Size Packed Ratio Date Time Checksum Name Attributes Size Date Time Name%cB<-><---->%d%% %12s: %sSTMTypeNTFS alternate data streamTargetDirectoryFileUnix symbolic linkWindows symbolic linkNTFS junction pointHard linkFile referenceSizePacked sizeRatiomtimectimeatimeAttributes %12ls: %8.8XCRC32 MACPack-CRC32BLAKE2 MACPack-BLAKE2WindowsUnixDOSOS/2Mac OSBeOSWinCEHost OS %12ls: RAR %ls(v%d) -m%d -md=%d%sCompression1.55.0 %12ls: %ls encrypted %12ls: %uFile versionUnix owner#%d: %c%10ls %9ls %9ls %4ls %ls %8.8X %02x%02x..%02x ???????? %c%c%c%c%c%c%c%c%c*<-?->dt0P lį<     $(,048<@DHLPTX $(,048<@DHLPT,'1(00=0f+f+f+f+fe+f+f+f+f+fe+f+f"f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f+f/f@`@ "$  5u,<LPP!!!!!$  0@`  0@`    (08@P`p $  @i’V’Ҏ’’.E21e1E`l’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’O’’’’’’’’ʚ’’’’’OʔOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO2OOOOOOOOOOOOOOOOOOOOOAnzOOOOOћOOOOOOOO~5555d55555555r55555y#’ݘ’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’’-’’’’<LO(((((((O(((((B'ȜϜӜڜ^&jvǏЏُTcrݍ’’’’’’O.:’’H’’OLp<pH@h<p0p  t X( \pTT(d @dXMCAOmcao%d.%02d UNRAR %s freeware Copyright (c) 1993-%d Alexander Roshal Usage: unrar <command> -<switch 1> -<switch N> <archive> <files...> <@listfiles...> <path_to_extract\> <Commands> e Extract files without archived paths l[t[a],b] List archive contents [technical[all], bare] p Print file to stdout t Test archive files v[t[a],b] Verbosely list archive contents [technical[all],bare] x Extract files with full path <Switches> - Stop switches scanning @[+] Disable [enable] file lists ac Clear Archive attribute after compression or extraction ad[1,2] Alternate destination path ag[format] Generate archive name using the current date ai Ignore file attributes ap<path> Set path inside archive c- Disable comments show cfg- Disable read configuration cl Convert names to lower case cu Convert names to upper case dh Open shared files ep Exclude paths from names ep3 Expand paths to full including the drive letter ep4<path> Exclude the path prefix from names f Freshen files id[c,d,n,p,q] Display or disable messages ierr Send all messages to stderr inul Disable all messages ioff[n] Turn PC off after completing an operation kb Keep broken extracted files me[par] Set encryption parameters n<file> Additionally filter included files n@ Read additional filter masks from stdin n@<list> Read additional filter masks from list file o[+|-] Set the overwrite mode oc Set NTFS Compressed attribute ol[a] Process symbolic links as the link [absolute paths] op<path> Set the output path for extracted files or Rename files automatically ow Save or restore file owner and group p[password] Set password r Recurse subdirectories ri<P>[:<S>] Set priority (0-default,1-min..15-max) and sleep time in ms sc<chr>[obj] Specify the character set si[name] Read data from standard input (stdin) sl<size> Process files with size less than specified sm<size> Process files with size more than specified ta[mcao]<d> Process files modified after <d> YYYYMMDDHHMMSS date tb[mcao]<d> Process files modified before <d> YYYYMMDDHHMMSS date tn[mcao]<t> Process files newer than <t> time to[mcao]<t> Process files older than <t> time ts[m,c,a,p] Save or restore time (modification, creation, access, preserve) u Update files v List all volumes ver[n] File version control vp Pause before each volume x<file> Exclude specified file x@ Read file names to exclude from stdin x@<list> Exclude files listed in specified list file y Assume Yes on all queries v Create volumes with size autodetection or list all volumes ieml[addr] Send archive by email vd Erase disk contents before creating volume ao Add files with Archive attribute set os Save NTFS streams ep2 Expand paths to full oni Allow potentially incompatible names dr Delete files to Recycle Bin <@listfiles...> <path_to_extract/>AFUMcfg-ilogsc.rarrcswitches=switches_%ls=APLOG.rarlogSNDERREML@NULOFFVER7z;ace;arj;bz2;cab;gz;jpeg;jpg;lha;lz;lzh;mp3;rar;taz;tbz;tbz2;tgz;txz;xz;z;zip;zipx;zst;tzst*?.*.%ls ERROR: Unknown option: %sFUADPXETK.partAFUMD-ht-oh-qoRARKKKKKKKKKKKKKKKK Y`gX͹&4@LftԺ)CQ_m{ XXXXXXXXXXXXX#X4EVdyXXXXXXXǼؼ XXXXXXXXXXXX6LXӽ߽X HXbXXXXXXXXXXXXXyǾؾXXXX>XXXXXXXXXXXXXXXXa1 1 1 1 1  2 2 ,2 <2 L2 \2 l2  Overwrite %s ? Would you like to replace the existing file %s %6s bytes, modified on %s with a new one %6s bytes, modified on %s _Yes_No_All_nEver_Rename_Quit_Yes_No_All_nEver_Quit Enter new name: %3d%% %-20s - checksum error Checksum error in the encrypted file %s. Corrupt file or wrong password. %-20s : packed data checksum error in volume %s Incorrect password for %s The specified password is incorrect.Not enough memory Cannot open %s Cannot create %sCannot close the file %sSeek error in the file %sRead error in the file %sWrite error in the file %s Cannot delete %s Cannot move some files and directories to Recycle Bin Cannot rename %s to %s WARNING: Cannot change attributes of %s Cannot copy %s to %s. You need to unpack the entire archive to create file reference entries. Cannot create directory %s Cannot create symbolic link %s Cannot create hard link %s You need to unpack the link target first You may need to run RAR as administratorCorrupt archive - use 'Repair' command Corrupt header is found Main archive header is corrupt %s - the file header is corrupt ERROR: Corrupt data header found, ignored WARNING: Unknown data header format, ignored ERROR: Corrupt %s data block Recovery record is corrupt. Unknown method in %s Unknown encryption method in %s Renaming %s to %s You may need a newer version of RAR. ERROR: %s and %s belong to different sets Nothing to reconstruct Reconstructing... Reconstruction impossible Unexpected end of archive ERROR: Bad archive %s The archive comment is corrupt ERROR: Invalid file name %s Operation failed Unsupported archive format. Please update RAR to a newer version. No files to extract Cannot find volume %s WARNING: You need to start extraction from a previous volume to unpack %s Unknown extra field in %s. Corrupt %s extra field in %s. %s switch is not supported for RAR %d.x archive format. %ls%ls%ls ERROR: Path too long Cannot read contents of %s ERROR: %s group and owner data are corrupt WARNING: Cannot get owner %s ID WARNING: Cannot get group %s ID WARNING: Cannot set %s owner and group WARNING: Cannot read symbolic link %s WARNING: Symbolic link %s already exists %s is archived incompletely because of read error. %u files are archived incompletely because of read errors. Directory with such name already exists Password exceeds the maximum allowed length of %u characters and will be truncated. Adjusting %s value to %s. %s WARNING: Attempting to correct the invalid file or directory name Creating %s Calculating checksums of all volumes. %d recovery volumes found %d volumes missing WARNING: FAT32 file system does not support 4 GB or larger files Skipping the encrypted archive %s%s Testing the recovery record Insert disk with %s_Continue_Quit Choose 'Ignore' to continue with the already read file part only, 'Ignore all' to do it for all read errors, 'Retry' to repeat read and 'Quit' to abort._Ignore_iGnore all_Retry_Quit ERROR: Not enough disk space for %s._Retry_AbortJanFebMarAprMayJunJulAugSepOctNovDec8/%EhDHg OU%L Y(eV1e4sTSJMy^;Oo!+t 1B% ^-KGþi#Pm0123456789abcdefv*.rev.bad100%%RCRVRar!Revqpqqq/QO Thread pool initialization failed. pthread_create failed, code %d pthread_cond_wait error %d;X a h hi:pit Pj Pk lH l\ pm o pp @qqP`r|s0tt,@v(PdP dЈ0|00PxБ P4T H H@8` PTD`0 P, Pp@p @pH\, ` !X!! !"@"l"й" "p4##& x&`&&'P((())8*T*p,,P,,,(-0L-p *h-`-p-P-.0.0X.. /,/H/p/@/)/* 0/82`>?Їd?P?p??P @pD@@4AAA`AB`@ІAABlCĈpHJK@L4MXOPP0R̊@ST@VVԌ`ij(jllpm8phq0r@tȏ~0PTp P(Љ<Xȓt@Ԕtt00`(T4`0(hPp P@( Ht"ԟ0-. /83`89:ؠ;40=XCE@HHIإPJJ @LH0N0O`PЧQRP`TxpU0VW$WW`X@YY(ZtzR| \ 0TF J tx?;*2$"T,\0h]AC_AA HUBA HPT^AA A[A H]EAA H|AA HYAFB H^Cp |_AA AC zPLR|Н $$_4 AA AC pb5(`bt AA AAC  0cKAA AC  fAA AC (8c AA AAC <$cNAA AAC X,A0H J$A(A,D0H @dAFCIAGHCBAH( AA AF< AAFNIAAHCEAH@TJAFCIAGHCEABH@(FAA FJIAGHCAAH42AA AAFQAHUEHCAHBEAAH@ADEBAHCAHTDADHCEHGHCBAH | AA AAF^.CAFa.CGHO.CEHP.BBBAF.CEBHF.CEH.CHHB.CHHK.CABHL.CABHH.CAAAEF.DDDDHd.CEHB. BBBBDDDDH.O.CADHHN.CADHHS.BDDAIM.CEHJ.CHHS.CEHHr.CHH.CHHD.CAHa.CHHD.CHHD.CAH.CAEXaAA AF J L A G H C I A A H C A A H 8 <AFCIAGHCAH8\<AFCIAGHCAH"AA AAC R,A0H a$A(A,D0D4A8AܻYACqEA HGDA H8>;CfDA H(X>(AA AAF(>̽AA AAF >AA AC >LAA AAFPrPEPAPHPHPIPAPAPHPQPFPEPAPHPKPBPEPAPHPKPEPAPAPHPCPLPAPAPHPPGPAPGPHPGPFPHPdPEPAPGPHPePBPFPAPHPCPAPHPCPAPAPAPHPCPDPAPHPSPCPDPAPHPKPLPAPAPHP{PIPAPHP[PEPAPAPHPHPAPHPOPGPAPAPHPPPHPHPOPAPAPAPHPx@XeAA AAFSABAHCAHCIAAHCAAHZAHXAHBEAAHGAHNAHBEAAHMAABHEHEHCBEH(X@; AA AAC0@  A`AA AC  AAA AF@T@4 AA AAFG.CJAHg.CAAHJ.CBAHC.CEAAH.CAAHD.CAHL.CBAAHJ.CAHi.AAAAHd.CEAAH`.CEAHD.DEAAH.CAAHD.CAHL.CBAAHD.CABCHJ.CEH.CAAH.CEAHF.CBEH.CAHT.CLAAH^.CAEHHj.CBEAHD.CAAHi.k.CAHR.CDAHU.BAAAHh.CAHH.AAAAHV.CFAAHD.CAAAHb.CAH.CAE`EAC,XDTl AA AAF0 D AA AAFn.CAAH. CPABBAAAH\.CEAAHH.CAHN.CAHh.CHHm.CLAAHG. C\.CAAHH.CAHS.CEAAHR.ABAAHH.CBEHb.CAACH[.CAACH.CAHW.ABAAHJ.BFFAFa.CBACHS.CEHAHH.CLAAHj.CBHHa.CBHHB.CAHQ.BAAAF.CHH.CBEH@.CCHHI.CEAAH.CEAH.CEEAH.CEAH.CAL.KAAHHY. CEAHAAH.CIAAH.CHAEH.CHH.CBEH.CAHg.CEHB.CAH.AAAAHL.CAHj.CDAAH\.0CEDFDAHFBDH.CHHH.CBEH.CHHK.CAH.CAHL.CBEHO.0CBBBBBBBBAHe.CAH.CAHL.CAAAHD.CHHU.CAHU.0CFAFFAEABFHg.CAH{.CAAAH_.BBBAHO.CHH.CEH.CAAEHx.CEH.CHAHE.CAHO.CAHm.CEHM.CAAH].CHAAHE.CEH.CHAHB.CEH.CHAH~.@.CFFEHX.CFFAHY.CHADH.CAHn.CAAHHr.CIAAH.CEAAH. CLAAAGHt.EHACHq.CAFMH`.CDBAHm. CEAADAHF.CAAFP.CEHV.CEHi.0CuK.CAH[.CADDH.CEHI.CEH.CEHB.CBEH.CHHy.AAAHH.CHHO.CAACH\.CAAHH`.CFAH.CEH.CEHZ.CAHW.CFFAH.CEHN.CAAAHO.CAAEHE.Y.CAHP.CHHL.CAHP.CAH.CAH.CAEP@AA AAFVEAAHCLAAHCLAAHCAAHUAHGAEAHCAAHGGEAHCGAGK$Q8AA AAC 4RAA C`dDhAlEpH`lEpH`|8RUAA AC`}lEpH`ChAlApH`SlEpH`ClApH`VhElEpH`IdAhAlBpH`NdAhAlBpH`[lEpH`,Rx?AA AAFAjAEAHACAAAAAHACAEAHACAAAEAKAaAFAAAAAHAKAAAHAGAAAHACAAAHAWAFAAAHANAFAAAFAFAAAEAAABACAHAMAAABAAAHARAFAAAAAHAKAAAHAAEAHACAEAAAEAHACABAAAHAAEAHACAAAHAGAAAHACAAAHAkAAAAAAAHAMAAABAAAHARAFAAAAAHAAEAHACAEAHACABAEAHA]AEAHACAAAAAHACAEAHACAAAEAHAJAAAAACAHAwAAAAAAAHALT~AA AAFA[AHAGAFAFAAAEAAACAAAHA`AAAAAEAHACAAAHAGAAAHACAAAHAXAEAHACAAAHAAEAHACAEAAAHAHACABAAAHAcAAAAAAAHAMAAABAAAHACABADAMAFAEAEAAAAACAHAAEAHAGAAAAAEAHAU< AA AAFAG.CAEAHA.CABAAAAAHAH.CAEABAHAF.CAEAHAY.E.CAEAAAEAHAJ. BABABABAGAGAAAAAHA.CAAAAAGAHA^.CADAGAHAj.CAAAEAHA.CAEAHA.CAAAHAB.CAEAHAS.CAAAHAp.CAGAHA.CAAAAAHAR.CABAAAAAEAR.BABABAAAEAK.CADAHAQ.CABAAAGAHAH.CABAAAEAHAa.CAAAHA.CAEAHA.CAAAEA(V AA AAC  LXTAA AC pXAA AAFĀFȀÀDЀH̀HЀHV̀AЀFj̀AЀFFĀLȀÈAЀHOĀAȀÈAЀHLȀÈAЀH`ĀAȀÀAЀFt̀AЀHCȀD̀AЀHCȀB̀AЀH̀EЀHCȀB̀EЀHNȀD̀AЀHzĀEȀD̀GЀHCĀBȀÈAЀHFĀAȀÀAЀFàHЀHTȀÈHЀHJĀAȀÀAЀFPĀBȀD̀DЀHFĀAȀÀAЀF̀EЀHFĀAȀD̀AЀFEĀAȀÀAЀFJ̀AЀHS̀AЀH]ĀAȀÀAЀFT̀EЀHIȀÀAЀHP̀EЀHDȀÀAЀHWĀJȀF̀AЀHPĀEȀÈAЀH8Ze , AA AAFm.CLAAHe.CDH.CAAH.CHAHD.CAH.CEHAHY.CBAHX.CAH.CEH.CHAEH.CEH.CAEHb.CAEEHJ.CEH.CAEEHJ.CEH.CAEEHT.CEH.CEHH.CAAHB.CEH.CAEEHJ.CEH.CAEEHJ.CEH.CAEEHJ.CEH.CAEEHJ.CEH.CGAEHZ.ABEHH.CEH.CEAEH.CEHz.CAHH.l. CBBBBBHAHu. CLEADEH. CLBBAEHN.CAHY.CEHH. CAAEBEHG.CEH.CEAEHG.CEH.CEAEH.CEHf.BHDDH.BHDDHG.CEH.DDDDH. CDEAHHEHB.CEH.CAHB.CEH.DEHEH.CEHQ.FBBAHD.BBBAHU.CEH.CHAH.CAH.CEHAHL.CALa.IAAAJ.HAEAHG.AAAAH. CDEAEHEHB.DEHEHc.CAH.CAE8 b AA AAFU~UEUHUCUAUEUHUGUEUHUEUEUHUCUAUEUHUGUEUHUZUAUEUKUvUIUEUAUHUKUAUAUAUHUIUAUFUFUHUcUEUBUAUHUUEUAUEUAUAUDUDUEUBUAUHUHUFUEUAUHUUAUAUAUDUDUDUAUDUEUBUEUHUZUFUEUAUHUIUFUEUAUHUBUFUEUAUHUHUFUFUFUHUEUEUBUAUHUZUBUAUAUHUGUEUHUCUAUAUEUHUGUAUAUEUHUQUEUHUEUHUCUHUEUHU[UFUEUHURUEUAUHUPUAUHUSUGUHUEUEUHUCUAUAUEUHUkULUEUAUHUHUHUEUHUHUEUHUIUAUAUEUHUUUEUHUEUEUHUCUAUAUEUHUCUNUAUAUHUCUEUHUCUAUAUEUHUoUAUAUEUHUEUEUHUCUAUEUHUhUHUAUAUFURUSUAUAUHUCUEUHUCUAUAUEUHULUEUHUCUHUAUEUHUCUEUHUCUHUAUEUHUCUEUHUCUEUAUEUHUKUEUHUCUAUAUEUHUVUBUAUAUHUCUEUHUCUAUAUEUHUVUBUAUAUHUCUEUHUCUAUAUEUHUCUEUHUCUEUAUEUHUpUFUAUEUHUTUIUAUBUBUAUHUeUAUAUEUHUbUEUHUCUAUAUEUHUCUEUHU{UAUAUAUAUDUDUEUIUYUEUHUCUAUEUHULUEUHUCUAUEUHULUEUHUCUAUEUHULUBUAUHUIUEUHUCUAUAUEUHUPUEUEUHURUAUHUCUAUEUHUNUFUEUHUCUEUHURUAUHUCUAUEUHUNUFUEUHUCUEUHU$Hh)ACGEDA H(phAA AAFhAA AFXIAAHMEABH]EABHqAAAHCEAAHMFHIFH , AA AAF ,ԍ(^n AA AAF$ha @ AA AC <P cgAA AAC (C,A0A4A8CFVPT2R,TN; >l8z,'ZK\,R N )J5 Ht B 5F` ( D1<&,B*:F6*  $@`D*0L"$ O7"#EE M(u  ~ fA | M8K d z i x x @)'yhw큀 SO^uSI^SR^FSYR^Kh6KIhKhBKUh4 I_ \rꀀh##v1r9zGfRz`dh;yhw #'_)'FFT][7 , OoNN%ZJT  Z?BVZ`X FZR^\WVp k iP=VK:ꀀh,ShUW5UVQ8Sys s k [=   8 5mXNS:u NwZY*wuEwOM(onYs_8OQw8Yi sU<2q W!sqs-qDII!!Py~T08lI4@@n1yhw큀K B'A MVC E >? E I P<G ; f7 s9 = >9 &= $5 d)'*ÀA937 E411HÀA'C[S4)'** @6ꀀh++ /= )O#]kr5)'q2P)'YY y,` 'W&}R][GG C`#AS|3 /Zs  FYN<<Ld| 4}}  "  Nv32 0^>4EB2JE#  x}    0 $   @~r!>f%Fa  nkGjc\tfhLS\#c-*U m%p(#3M"+.:SꀀhY9*Jc,WyL0Y8Ln4mM 4)' >񃀀 w0(Xf# C|*^zD  ]7 E M o3 } wy&Jp @sWupꀀhww ^;  Zꀀh||$!D6 vS`Ӂ++ C m 8 L? K0{ )](@%eӁ l z)~@|ahu'$njnjpfZ& +)'%)'&& 2N ==JB)'YY |e,yhwN /7GR_ Tp @@;Ei  DH  T oH؁   0Hoؑooʐ VfvƗ֗&6FVfvƘ֘&6FVfvƙ֙&6FVfvƚ֚&6FVfvƛ֛&6FVfvƜ֜&6FVfvƝ֝&6FVfvƞ֞GCC: (Ubuntu 7.4.0-1ubuntu1~18.04.1) 7.4.0clang version 6.0.0-1ubuntu2 (tags/RELEASE_600/final).shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment TThh !oP+ ؁p3HH ;oʐHoؑW H` B00i#d@@ox  "~DD``Х06 0\ B 0 `H H T TX X s  !  "  J 0 am